BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_D06 (888 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC320.07c |mde7||RNA-binding protein Mde7|Schizosaccharomyces ... 27 2.7 SPBC23E6.07c |rfc1||DNA replication factor C complex subunit Rfc... 27 4.7 >SPCC320.07c |mde7||RNA-binding protein Mde7|Schizosaccharomyces pombe|chr 3|||Manual Length = 761 Score = 27.5 bits (58), Expect = 2.7 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = +1 Query: 547 RASQKSTLKSEVAKPDRTIKIPGVSPGSSLVRSPGS-RPLPAYRIPVRLSPFGKRXAFS* 723 R + S +K A RTI + GV+P S +R P +P+P ++ VR P K+ Sbjct: 505 RLERTSPVKELPAIRPRTIPLNGVAPYESELRPPPKWKPMPDLKV-VRSRPSLKQRPLRS 563 Query: 724 LTLVRI 741 VR+ Sbjct: 564 AEYVRV 569 >SPBC23E6.07c |rfc1||DNA replication factor C complex subunit Rfc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 934 Score = 26.6 bits (56), Expect = 4.7 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 548 EHHKNRRSSQRWRNPTGL*RYQAFPLEAP 634 ++HKNR+S+ P GL Y+A L P Sbjct: 389 DYHKNRKSNFNKPGPDGLGLYKAVLLSGP 417 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,109,230 Number of Sequences: 5004 Number of extensions: 58597 Number of successful extensions: 155 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 155 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 446488370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -