BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_D05 (846 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23C4.04c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 28 1.9 SPAC1F3.06c |spo15||sporulation protein Spo15|Schizosaccharomyce... 26 7.7 >SPAC23C4.04c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 104 Score = 27.9 bits (59), Expect = 1.9 Identities = 10/34 (29%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -2 Query: 281 FRANNGTSTGTTEKNGMWKP--FVYCFHIRLCLC 186 + +++ T+ E+ W+ F+ C HIR C+C Sbjct: 29 YDSDSPTTVHHDERKESWRSHGFIVCLHIRCCIC 62 >SPAC1F3.06c |spo15||sporulation protein Spo15|Schizosaccharomyces pombe|chr 1|||Manual Length = 1957 Score = 25.8 bits (54), Expect = 7.7 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 135 NDIPDLKQKSALVTTEITKTQSDVK 209 + + D K +A++++E+TK+ DVK Sbjct: 738 SSLSDAKNTNAILSSELTKSSEDVK 762 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,393,346 Number of Sequences: 5004 Number of extensions: 67361 Number of successful extensions: 160 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 160 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 418457710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -