BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_D02 (864 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 61 1e-09 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 60 2e-09 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 60 2e-09 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 59 4e-09 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 58 1e-08 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 56 2e-08 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 56 4e-08 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 55 5e-08 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 54 9e-08 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 53 2e-07 At1g61080.1 68414.m06877 proline-rich family protein 52 5e-07 At5g46730.1 68418.m05757 glycine-rich protein 50 2e-06 At4g01985.1 68417.m00265 expressed protein 50 2e-06 At2g30560.1 68415.m03722 glycine-rich protein 50 2e-06 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 50 2e-06 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 50 3e-06 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 49 3e-06 At5g38560.1 68418.m04662 protein kinase family protein contains ... 49 5e-06 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 49 5e-06 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 49 5e-06 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 49 5e-06 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 48 6e-06 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 48 6e-06 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 48 6e-06 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 48 8e-06 At1g26150.1 68414.m03192 protein kinase family protein similar t... 48 1e-05 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 48 1e-05 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 47 1e-05 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 47 1e-05 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 47 1e-05 At2g05440.2 68415.m00575 glycine-rich protein 47 1e-05 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 47 2e-05 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 47 2e-05 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 47 2e-05 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 47 2e-05 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 46 2e-05 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 46 2e-05 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 46 3e-05 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 46 4e-05 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 46 4e-05 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 46 4e-05 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 45 6e-05 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 45 8e-05 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 45 8e-05 At1g75550.1 68414.m08780 glycine-rich protein 45 8e-05 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 45 8e-05 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 44 1e-04 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 44 1e-04 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 44 1e-04 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 44 1e-04 At1g27710.1 68414.m03387 glycine-rich protein 44 1e-04 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 44 1e-04 At4g30460.1 68417.m04325 glycine-rich protein 44 1e-04 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 44 1e-04 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 44 2e-04 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 44 2e-04 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 43 2e-04 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 43 2e-04 At2g05440.1 68415.m00574 glycine-rich protein 43 2e-04 At1g02710.1 68414.m00222 glycine-rich protein 43 2e-04 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 43 3e-04 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 43 3e-04 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 43 3e-04 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 43 3e-04 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 43 3e-04 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 43 3e-04 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 43 3e-04 At1g15840.1 68414.m01901 expressed protein 43 3e-04 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 42 4e-04 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 42 4e-04 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 42 4e-04 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 42 4e-04 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 42 4e-04 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 42 7e-04 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 42 7e-04 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 42 7e-04 At1g29380.1 68414.m03592 hypothetical protein 42 7e-04 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 41 0.001 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 41 0.001 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 41 0.001 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 41 0.001 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 41 0.001 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 41 0.001 At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 41 0.001 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 41 0.001 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 40 0.002 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 40 0.002 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 40 0.002 At4g18570.1 68417.m02749 proline-rich family protein common fami... 40 0.002 At3g49300.1 68416.m05388 proline-rich family protein contains pr... 40 0.002 At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical ... 40 0.002 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 40 0.002 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 40 0.002 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 40 0.003 At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi... 40 0.003 At2g05510.1 68415.m00583 glycine-rich protein 40 0.003 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 40 0.003 At1g24490.1 68414.m03084 60 kDa inner membrane family protein si... 40 0.003 At1g10620.1 68414.m01204 protein kinase family protein contains ... 40 0.003 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 39 0.004 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 39 0.004 At4g33660.1 68417.m04781 expressed protein 39 0.004 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 39 0.004 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 39 0.004 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 39 0.004 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 39 0.004 At5g35190.1 68418.m04170 proline-rich extensin-like family prote... 39 0.005 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 39 0.005 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 39 0.005 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 39 0.005 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 39 0.005 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 38 0.007 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 38 0.007 At4g08400.1 68417.m01388 proline-rich extensin-like family prote... 38 0.007 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 38 0.007 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 38 0.007 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 38 0.007 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 38 0.007 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 38 0.007 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 38 0.007 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 38 0.007 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 38 0.009 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 38 0.009 At3g24550.1 68416.m03083 protein kinase family protein contains ... 38 0.009 At1g04800.1 68414.m00476 glycine-rich protein 38 0.009 At4g15460.1 68417.m02363 glycine-rich protein 38 0.011 At2g04190.1 68415.m00404 meprin and TRAF homology domain-contain... 38 0.011 At1g11850.2 68414.m01364 expressed protein 38 0.011 At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear... 37 0.015 At3g24540.1 68416.m03082 protein kinase family protein contains ... 37 0.015 At2g28670.1 68415.m03485 disease resistance-responsive family pr... 37 0.015 At4g08410.1 68417.m01390 proline-rich extensin-like family prote... 37 0.020 At3g51290.1 68416.m05614 proline-rich family protein 37 0.020 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 37 0.020 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 37 0.020 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 37 0.020 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 37 0.020 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 36 0.026 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 36 0.026 At3g05220.2 68416.m00570 heavy-metal-associated domain-containin... 36 0.026 At3g05220.1 68416.m00569 heavy-metal-associated domain-containin... 36 0.026 At1g23540.1 68414.m02960 protein kinase family protein contains ... 36 0.026 At5g28480.1 68418.m03462 hypothetical protein 36 0.035 At2g12100.1 68415.m01300 Ulp1 protease family protein contains P... 36 0.035 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 36 0.035 At1g70990.1 68414.m08190 proline-rich family protein 36 0.035 At1g45090.1 68414.m05169 Ulp1 protease family protein similar to... 36 0.035 At1g15830.1 68414.m01900 expressed protein 36 0.035 At4g22740.2 68417.m03281 glycine-rich protein 36 0.046 At4g22740.1 68417.m03280 glycine-rich protein 36 0.046 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 36 0.046 At3g50180.1 68416.m05486 hypothetical protein 36 0.046 At3g32400.1 68416.m04142 formin homology 2 domain-containing pro... 36 0.046 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 36 0.046 At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi do... 36 0.046 At1g11130.1 68414.m01274 leucine-rich repeat family protein / pr... 36 0.046 At1g04660.1 68414.m00463 glycine-rich protein 36 0.046 At5g66400.1 68418.m08374 dehydrin (RAB18) nearly identical to SP... 35 0.061 At5g49080.1 68418.m06074 proline-rich extensin-like family prote... 35 0.061 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 35 0.061 At5g06640.1 68418.m00750 proline-rich extensin-like family prote... 35 0.061 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 35 0.061 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 35 0.061 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 35 0.061 At3g42130.1 68416.m04326 glycine-rich protein 35 0.061 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 35 0.061 At1g62240.1 68414.m07021 expressed protein 35 0.061 At1g55540.1 68414.m06356 proline-rich family protein contains pr... 35 0.061 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 29 0.070 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 35 0.080 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 35 0.080 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 35 0.080 At3g54580.1 68416.m06039 proline-rich extensin-like family prote... 35 0.080 At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s... 35 0.080 At3g21215.1 68416.m02681 RNA-binding protein, putative contains ... 35 0.080 At2g24980.1 68415.m02987 proline-rich extensin-like family prote... 35 0.080 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 35 0.080 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 35 0.080 At1g65440.1 68414.m07424 glycine-rich protein 35 0.080 At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly id... 34 0.11 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 34 0.11 At5g06630.1 68418.m00749 proline-rich extensin-like family prote... 34 0.11 At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar... 34 0.11 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 34 0.11 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 34 0.11 At2g10940.2 68415.m01168 protease inhibitor/seed storage/lipid t... 34 0.11 At2g10940.1 68415.m01167 protease inhibitor/seed storage/lipid t... 34 0.11 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 34 0.11 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 34 0.11 At1g21310.1 68414.m02662 proline-rich extensin-like family prote... 34 0.11 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 34 0.14 At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibri... 34 0.14 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 34 0.14 At3g07100.1 68416.m00845 protein transport protein Sec24, putati... 34 0.14 At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) 33 0.19 At5g51300.2 68418.m06360 splicing factor-related contains simila... 33 0.19 At5g51300.1 68418.m06359 splicing factor-related contains simila... 33 0.19 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 33 0.19 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 33 0.19 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 33 0.19 At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi do... 33 0.19 At5g25550.1 68418.m03040 leucine-rich repeat family protein / ex... 33 0.25 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 33 0.25 At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar... 33 0.25 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 33 0.25 At2g11005.1 68415.m01177 glycine-rich protein 33 0.25 At1g63550.1 68414.m07184 hypothetical protein low similarity to ... 33 0.25 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 33 0.25 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 33 0.32 At5g07150.1 68418.m00815 leucine-rich repeat family protein cont... 33 0.32 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 33 0.32 At4g08230.1 68417.m01358 glycine-rich protein 33 0.32 At3g07540.1 68416.m00900 formin homology 2 domain-containing pro... 33 0.32 At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family... 33 0.32 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 33 0.32 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 33 0.32 At2g05530.1 68415.m00585 glycine-rich protein 33 0.32 At1g53625.1 68414.m06096 expressed protein 33 0.32 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 33 0.32 At5g59950.3 68418.m07518 RNA and export factor-binding protein, ... 32 0.43 At5g59950.2 68418.m07519 RNA and export factor-binding protein, ... 32 0.43 At5g59950.1 68418.m07517 RNA and export factor-binding protein, ... 32 0.43 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 32 0.43 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 32 0.43 At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; g... 32 0.43 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 32 0.43 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 32 0.43 At1g11850.1 68414.m01363 expressed protein 32 0.43 At5g24316.1 68418.m02864 proline-rich family protein contains pr... 32 0.57 At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; g... 32 0.57 At5g07190.1 68418.m00819 embryo-specific protein 3, putative sim... 32 0.57 At4g16240.1 68417.m02464 hypothetical protein 32 0.57 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 32 0.57 At2g18470.1 68415.m02151 protein kinase family protein contains ... 32 0.57 At1g79480.1 68414.m09263 hypothetical protein low similarity to ... 32 0.57 At1g70250.1 68414.m08082 receptor serine/threonine kinase, putat... 32 0.57 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 32 0.57 At5g60980.2 68418.m07650 nuclear transport factor 2 (NTF2) famil... 31 0.75 At5g60980.1 68418.m07649 nuclear transport factor 2 (NTF2) famil... 31 0.75 At5g53350.1 68418.m06630 ATP-dependent Clp protease ATP-binding ... 31 0.75 At4g34440.1 68417.m04894 protein kinase family protein contains ... 31 0.75 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 31 0.75 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 31 0.75 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 31 0.75 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 31 0.75 At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family... 31 0.75 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 31 0.75 At3g29390.1 68416.m03693 hydroxyproline-rich glycoprotein family... 31 0.75 At3g07195.1 68416.m00858 proline-rich family protein 31 0.75 At2g17870.1 68415.m02070 cold-shock DNA-binding family protein c... 31 0.75 At1g49270.1 68414.m05524 protein kinase family protein contains ... 31 0.75 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 31 0.75 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 31 0.99 At4g19920.1 68417.m02918 disease resistance protein (TIR class),... 31 0.99 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 31 0.99 At4g03120.1 68417.m00425 proline-rich family protein similar to ... 31 0.99 At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar... 31 0.99 At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-conta... 31 0.99 At3g46240.1 68416.m05005 protein kinase-related similar to light... 31 0.99 At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1... 31 0.99 At3g08640.1 68416.m01003 alphavirus core protein family contains... 31 0.99 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 31 0.99 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 31 0.99 At1g63570.1 68414.m07186 receptor-like protein kinase-related co... 31 0.99 At1g54970.1 68414.m06278 proline-rich family protein similar to ... 31 0.99 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 31 0.99 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 31 0.99 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 31 1.3 At5g62440.1 68418.m07837 expressed protein 31 1.3 At5g61660.1 68418.m07736 glycine-rich protein 31 1.3 At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) ide... 31 1.3 At5g07540.2 68418.m00864 glycine-rich protein (GRP16) oleosin; g... 31 1.3 At4g32640.1 68417.m04646 sec23/sec24 transport protein-related 31 1.3 At4g23470.2 68417.m03383 hydroxyproline-rich glycoprotein family... 31 1.3 At4g23470.1 68417.m03382 hydroxyproline-rich glycoprotein family... 31 1.3 At3g13225.1 68416.m01660 WW domain-containing protein contains P... 31 1.3 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 31 1.3 At2g20850.1 68415.m02457 leucine-rich repeat protein kinase, put... 31 1.3 At1g80130.1 68414.m09379 expressed protein 31 1.3 At1g12810.1 68414.m01488 proline-rich family protein contains pr... 31 1.3 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 30 1.7 At5g25425.1 68418.m03017 glycine-rich protein 30 1.7 At4g39680.1 68417.m05614 SAP domain-containing protein contains ... 30 1.7 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 30 1.7 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 30 1.7 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 30 1.7 At2g43800.1 68415.m05445 formin homology 2 domain-containing pro... 30 1.7 At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical t... 30 1.7 At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical t... 30 1.7 At1g53260.1 68414.m06035 hypothetical protein low similarity to ... 30 1.7 At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F... 30 1.7 At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F... 30 1.7 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 30 1.7 At1g07135.1 68414.m00759 glycine-rich protein 30 1.7 At5g13760.1 68418.m01604 expressed protein similar to unknown pr... 30 2.3 At5g04290.1 68418.m00422 KOW domain-containing transcription fac... 30 2.3 At3g55950.1 68416.m06217 protein kinase family protein contains ... 30 2.3 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 30 2.3 At3g24650.1 68416.m03095 abscisic acid-insensitive protein 3 (AB... 30 2.3 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 30 2.3 At3g11402.1 68416.m01388 DC1 domain-containing protein contains ... 30 2.3 At3g02670.1 68416.m00258 proline-rich family protein contains pr... 30 2.3 At2g44790.1 68415.m05574 uclacyanin II strong similarity to ucla... 30 2.3 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 30 2.3 At1g74720.1 68414.m08658 C2 domain-containing protein contains I... 30 2.3 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 30 2.3 At1g51580.1 68414.m05806 KH domain-containing protein 30 2.3 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 30 2.3 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 29 3.0 At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 29 3.0 At4g21720.1 68417.m03145 expressed protein 29 3.0 At4g19200.1 68417.m02833 proline-rich family protein contains pr... 29 3.0 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 29 3.0 At3g62680.1 68416.m07041 proline-rich family protein contains pr... 29 3.0 At3g49305.1 68416.m05389 hypothetical protein contains proline-r... 29 3.0 At1g53040.2 68414.m06006 expressed protein contains Pfam profile... 29 3.0 At1g53040.1 68414.m06005 expressed protein contains Pfam profile... 29 3.0 At1g35880.1 68414.m04457 hypothetical protein 29 3.0 At1g30780.1 68414.m03763 F-box family protein 29 3.0 At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative si... 29 3.0 At1g13920.1 68414.m01633 remorin family protein contains Pfam do... 29 3.0 At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family... 29 3.0 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 29 4.0 At5g37720.1 68418.m04541 RNA and export factor-binding protein, ... 29 4.0 At5g02530.1 68418.m00187 RNA and export factor-binding protein, ... 29 4.0 At4g37900.1 68417.m05360 glycine-rich protein 29 4.0 At4g28300.2 68417.m04053 hydroxyproline-rich glycoprotein family... 29 4.0 At4g28300.1 68417.m04052 hydroxyproline-rich glycoprotein family... 29 4.0 At3g55790.1 68416.m06199 expressed protein predicted protein, Ar... 29 4.0 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 29 4.0 At3g43583.1 68416.m04636 hypothetical protein 29 4.0 At2g48160.1 68415.m06031 PWWP domain-containing protein 29 4.0 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 29 4.0 At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing ... 29 4.0 At5g21160.1 68418.m02528 La domain-containing protein / proline-... 27 4.5 At5g56890.1 68418.m07099 protein kinase family protein contains ... 29 5.3 At5g22790.1 68418.m02664 expressed protein 29 5.3 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 29 5.3 At5g07530.1 68418.m00862 glycine-rich protein (GRP17) olesin; gl... 29 5.3 At4g32375.1 68417.m04610 glycoside hydrolase family 28 protein /... 29 5.3 At3g56990.1 68416.m06344 glycine-rich protein conserved hypothet... 29 5.3 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 29 5.3 At3g06780.1 68416.m00805 glycine-rich protein 29 5.3 At2g35920.1 68415.m04409 helicase domain-containing protein simi... 29 5.3 At2g34870.1 68415.m04281 hydroxyproline-rich glycoprotein family... 29 5.3 At2g24450.1 68415.m02922 fasciclin-like arabinogalactan family p... 29 5.3 At1g77030.1 68414.m08970 glycine-rich protein 29 5.3 At1g76010.1 68414.m08825 expressed protein 29 5.3 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 29 5.3 At5g58540.1 68418.m07330 protein kinase family protein contains ... 28 7.0 At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing ... 28 7.0 At5g47210.1 68418.m05821 nuclear RNA-binding protein, putative s... 28 7.0 At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein si... 28 7.0 At4g21620.1 68417.m03134 glycine-rich protein 28 7.0 At4g16830.1 68417.m02540 nuclear RNA-binding protein (RGGA) iden... 28 7.0 At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid t... 28 7.0 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 28 7.0 At3g08630.1 68416.m01002 expressed protein 28 7.0 At3g02540.2 68416.m00243 ubiquitin family protein contains Pfam ... 28 7.0 At3g02540.1 68416.m00242 ubiquitin family protein contains Pfam ... 28 7.0 At2g34670.1 68415.m04259 proline-rich family protein contains pr... 28 7.0 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 28 7.0 At2g05540.1 68415.m00586 glycine-rich protein 28 7.0 At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to S... 28 7.0 At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to S... 28 7.0 At1g20220.1 68414.m02525 expressed protein 28 7.0 At1g17790.1 68414.m02202 DNA-binding bromodomain-containing prot... 28 7.0 At1g07310.1 68414.m00778 C2 domain-containing protein contains s... 28 7.0 At5g67600.1 68418.m08524 expressed protein 28 9.2 At5g66960.1 68418.m08442 prolyl oligopeptidase family protein si... 28 9.2 At5g65410.1 68418.m08226 zinc finger homeobox family protein / Z... 28 9.2 At4g38080.1 68417.m05378 hydroxyproline-rich glycoprotein family... 28 9.2 At4g23882.1 68417.m03434 heavy-metal-associated domain-containin... 28 9.2 At4g12490.1 68417.m01974 protease inhibitor/seed storage/lipid t... 28 9.2 At3g51350.1 68416.m05622 aspartyl protease family protein contai... 28 9.2 At3g24250.1 68416.m03044 glycine-rich protein 28 9.2 At3g15400.1 68416.m01954 anther development protein, putative si... 28 9.2 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 28 9.2 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 28 9.2 At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) fa... 28 9.2 At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) fa... 28 9.2 At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuc... 28 9.2 At2g21140.1 68415.m02508 hydroxyproline-rich glycoprotein family... 28 9.2 At1g32360.1 68414.m03989 zinc finger (CCCH-type) family protein ... 28 9.2 At1g27090.1 68414.m03302 glycine-rich protein 28 9.2 At1g15130.1 68414.m01807 hydroxyproline-rich glycoprotein family... 28 9.2 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 60.9 bits (141), Expect = 1e-09 Identities = 31/79 (39%), Positives = 33/79 (41%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 + PPP P P P PP P PP PPP PP P PPPP PP PPP Sbjct: 436 YSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPP-PPVYSPPPPSPP---PPP 491 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 492 PP--VYSPPPPPPPPPPPP 508 Score = 60.5 bits (140), Expect = 1e-09 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 4/81 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP----PXPPXRXP 800 PPP P P P PP P PP PPP PP P PPP P PP P Sbjct: 445 PPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPP 504 Query: 801 PPXPFLAHXXXGXXXPPSXPP 863 PP P + P PP Sbjct: 505 PPPPVYSPPPPPVYSSPPPPP 525 Score = 59.3 bits (137), Expect = 3e-09 Identities = 33/77 (42%), Positives = 34/77 (44%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P PP P PP PPP PP P PPPP PP PPP P Sbjct: 426 PPPPS---PPPPVYSPPPPPPPPPPVYSPPPPPPPPPPP-PVYSPPPPPPPP---PPPPP 478 Query: 813 FLAHXXXGXXXPPSXPP 863 + PPS PP Sbjct: 479 VYS------PPPPSPPP 489 Score = 58.4 bits (135), Expect = 6e-09 Identities = 31/79 (39%), Positives = 31/79 (39%), Gaps = 2/79 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPP--GPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P PP P PP PPP PP P PPP P PPP Sbjct: 467 PPPPPPPPPPPPVYSPPPPSPPPPP---PPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPP 523 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P A PP PP Sbjct: 524 PPSPAPTPVYCTRPPPPPP 542 Score = 55.2 bits (127), Expect = 5e-08 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPL-PXXXXPPPPXPPXRXPPPX 809 PPP P P PP P PP PPP P P PPPP PP PPP Sbjct: 410 PPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 469 Query: 810 P 812 P Sbjct: 470 P 470 Score = 54.4 bits (125), Expect = 9e-08 Identities = 31/84 (36%), Positives = 32/84 (38%), Gaps = 7/84 (8%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPX---PXXGPPGPPPXXXPPLPXXXXPPPPX----PPX 791 PPP P P P PP P PP PPP PP P PPPP PP Sbjct: 411 PPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 470 Query: 792 RXPPPXPFLAHXXXGXXXPPSXPP 863 PPP P + PP PP Sbjct: 471 PPPPPPP-PVYSPPPPSPPPPPPP 493 Score = 52.8 bits (121), Expect = 3e-07 Identities = 30/83 (36%), Positives = 31/83 (37%), Gaps = 4/83 (4%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPP--GPPPXXXPPLPXXXX--PPPPXPPXR 794 H PPP P P P PP P PP PPP PP P PPPP P Sbjct: 543 HSPPPPQFSPPPPE---PYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVS 599 Query: 795 XPPPXPFLAHXXXGXXXPPSXPP 863 PPP P + P PP Sbjct: 600 SPPPTPVYSPPPPPPCIEPPPPP 622 Score = 52.0 bits (119), Expect = 5e-07 Identities = 30/82 (36%), Positives = 32/82 (39%), Gaps = 3/82 (3%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXR-XPP 803 H PPP P P +P PP P PP P PP P PPPP P PP Sbjct: 573 HSPPPPHS--PPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPP 630 Query: 804 PXPFLAHXXXGXXXPP--SXPP 863 P P + H P S PP Sbjct: 631 PPPPVVHYSSPPPPPVYYSSPP 652 Score = 50.8 bits (116), Expect = 1e-06 Identities = 27/78 (34%), Positives = 28/78 (35%), Gaps = 1/78 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXP-PXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPX 809 PPP P P P P P P P PPP P P PPPP P PP Sbjct: 506 PPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPP 565 Query: 810 PFLAHXXXGXXXPPSXPP 863 P + P S PP Sbjct: 566 PHSSPPPHSPPPPHSPPP 583 Score = 49.6 bits (113), Expect = 3e-06 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPPP PPP P P PP P P PPP PP P Sbjct: 456 PPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPP 500 Score = 49.6 bits (113), Expect = 3e-06 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P PP P PPP P P PPP PP PPP Sbjct: 491 PPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPP 548 Score = 49.2 bits (112), Expect = 3e-06 Identities = 28/77 (36%), Positives = 28/77 (36%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P PP PPP P P PPPP PP PPP P Sbjct: 403 PPPSLPSPPPPAPIFSTPPTLTSPP---PPSPPPPVYSPPP----PPPPPPPVYSPPPPP 455 Query: 813 FLAHXXXGXXXPPSXPP 863 PP PP Sbjct: 456 PPPPPPPVYSPPPPPPP 472 Score = 49.2 bits (112), Expect = 3e-06 Identities = 26/68 (38%), Positives = 26/68 (38%), Gaps = 7/68 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXX-GPPGPPPXXXPPLPXXXXPPP------PXPPX 791 PPP P P P P PP P PP PP PP P P P P PP Sbjct: 483 PPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPP 542 Query: 792 RXPPPXPF 815 PPP F Sbjct: 543 HSPPPPQF 550 Score = 48.8 bits (111), Expect = 5e-06 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPPP PPP P P P PP P PPP PP P Sbjct: 441 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPP 485 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP PPP P P PP PP +PPP PP P Sbjct: 447 PVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPP 491 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P PPPP PPP P PP PP P PPP PP Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 46.0 bits (104), Expect = 3e-05 Identities = 21/48 (43%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPX--PPXXPPXXXRAPL-APPPXXXPPSP 756 P +PPPP PPP P P PP PP P+ +PPP PP P Sbjct: 428 PPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPP 475 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP PPP P PP PP +P PPP PP P Sbjct: 434 PVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPP 478 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPPP PP P P PP P P PPP PP P Sbjct: 471 PPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 515 Score = 45.2 bits (102), Expect = 6e-05 Identities = 30/87 (34%), Positives = 33/87 (37%), Gaps = 10/87 (11%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXP-PLPXXXXPPPPX----PPX 791 PPP P P P P PP P P PPP P P+ PPPP PP Sbjct: 490 PPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQ 549 Query: 792 -RXPPPXPFL--AHXXXGXXXPPSXPP 863 PPP P+ + PP PP Sbjct: 550 FSPPPPEPYYYSSPPPPHSSPPPHSPP 576 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPPP PPP P P PP PP PPP PP P Sbjct: 451 PPPPPPP---PPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXP---PXXXRAPLAPPPXXXPP 750 P PPPP PPP P P PP P P P PPP PP Sbjct: 502 PPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPP 547 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/79 (31%), Positives = 26/79 (32%), Gaps = 2/79 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGP--PPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P PP P P PP P PPP P PPP Sbjct: 553 PPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPP 612 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P + S PP Sbjct: 613 PPCIEPPPPPPCIEYSPPP 631 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/68 (35%), Positives = 24/68 (35%), Gaps = 4/68 (5%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXX----PPLPXXXXPPPPXPPXRXP 800 PPP P P P PP PP PPP PP P PPP P Sbjct: 601 PPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSS 660 Query: 801 PPXPFLAH 824 PP P H Sbjct: 661 PPPPPPVH 668 Score = 44.0 bits (99), Expect = 1e-04 Identities = 27/82 (32%), Positives = 27/82 (32%), Gaps = 5/82 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXX---PPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP PP P PPP PP Sbjct: 612 PPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSS 671 Query: 804 PXPFLAHXXXGXXXPP--SXPP 863 P P H P S PP Sbjct: 672 PPPPEVHYHSPPPSPVHYSSPP 693 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP PPP P PP PP +PPP PP P Sbjct: 462 PVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPP 506 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P P PP PP PPP P P Sbjct: 481 SPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPP 523 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/45 (42%), Positives = 21/45 (46%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P +PPPP PPP PP PP P +PPP PP P Sbjct: 542 PHSPPPPQFSPPPPEPYYYSSPP--PPHSSPPPHSPPPPHSPPPP 584 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPPP PPP P P P PP PPP P+P Sbjct: 487 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTP 531 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/50 (42%), Positives = 23/50 (46%), Gaps = 5/50 (10%) Frame = +1 Query: 622 PXTPPPPXXXPPP-XPXXXXPXPP----XXPPXXXRAPLAPPPXXXPPSP 756 P +PPPP PPP P P PP PP +P PPP PP P Sbjct: 572 PHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPP 621 Score = 42.7 bits (96), Expect = 3e-04 Identities = 26/83 (31%), Positives = 28/83 (33%), Gaps = 6/83 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPP---XXXPPLPXXXXPPPPXPP---XR 794 PPP P P +P PP P PP PP P PPP P Sbjct: 643 PPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEE 702 Query: 795 XPPPXPFLAHXXXGXXXPPSXPP 863 PPP P + H S PP Sbjct: 703 SPPPAPVVHHSPPPPMVHHSPPP 725 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +1 Query: 607 IYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 I+ P PP PPP P P PP PP P PPP PP Sbjct: 416 IFSTPPTLTSPPPPSPPP-PVYSPPPPPPPPPPVYSPPPPPPPPPPPP 462 Score = 41.5 bits (93), Expect = 7e-04 Identities = 25/80 (31%), Positives = 26/80 (32%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPP---XXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P P P P PP PP P PP PP PP Sbjct: 523 PPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPP 582 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + P S PP Sbjct: 583 PPIYPYLSPPPPPTPVSSPP 602 Score = 41.5 bits (93), Expect = 7e-04 Identities = 25/66 (37%), Positives = 25/66 (37%), Gaps = 6/66 (9%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXX----PPLPXXXXPPPPXPPX--R 794 PPP P P P PP P PP PPP PP P PP PP Sbjct: 593 PPPTPVSSPPPT---PVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYS 649 Query: 795 XPPPXP 812 PPP P Sbjct: 650 SPPPPP 655 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/50 (38%), Positives = 22/50 (44%) Frame = +1 Query: 607 IYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +Y P +PPP PPP P PP PP +P PP PP P Sbjct: 479 VYSPPPPSPPP----PPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPP 524 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPP---XPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 T PPP PPP P P PP P P PPP PP P Sbjct: 424 TSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 469 Score = 39.1 bits (87), Expect = 0.004 Identities = 24/79 (30%), Positives = 25/79 (31%), Gaps = 4/79 (5%) Frame = +3 Query: 627 HXPPPXXXXX--PXPXXXXPXAPXXPPXPXX--GPPGPPPXXXPPLPXXXXPPPPXPPXR 794 H PPP P P P PP P PP P PP P PPP P Sbjct: 680 HSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPPMVHHSPPPPVIHQSPPPPSPEY 739 Query: 795 XPPPXPFLAHXXXGXXXPP 851 P P + PP Sbjct: 740 EGPLPPVIGVSYASPPPPP 758 Score = 38.7 bits (86), Expect = 0.005 Identities = 24/77 (31%), Positives = 26/77 (33%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P +P PP P PPP P PPP P PP P Sbjct: 664 PPPVHYSSPPPPEVHYHSP--PPSPVHYSSPPPPPSAP----CEESPPPAPVVHHSPPPP 717 Query: 813 FLAHXXXGXXXPPSXPP 863 + H S PP Sbjct: 718 MVHHSPPPPVIHQSPPP 734 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXX--PPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P P PP PP PPP PP P Sbjct: 465 SPPPPP--PPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPP 507 Score = 35.9 bits (79), Expect = 0.035 Identities = 19/47 (40%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXX--PPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P + PPP PPP P P PP PP +P PPP SP Sbjct: 597 PVSSPPPTPVYSPPPPPPCIEPPPP--PPCIEYSPPPPPPVVHYSSP 641 Score = 35.9 bits (79), Expect = 0.035 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP PPP P PP P +P PP P P Sbjct: 609 PPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPP 653 Score = 34.7 bits (76), Expect = 0.080 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P PP PP P PPP SP Sbjct: 409 SPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSP 451 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAP--LAPPPXXXPPSP 756 P PP PPP P P PP P +PPP PP P Sbjct: 401 PLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPP 447 Score = 33.5 bits (73), Expect = 0.19 Identities = 18/48 (37%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = +1 Query: 628 TPPPPXXXPPPX--PXXXXPXPPXXP---PXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P P PP P P P++ PP SP Sbjct: 562 SPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSP 609 Score = 32.7 bits (71), Expect = 0.32 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP-PXPPXRXPPPXPFLAHXXXGXXXPPS 854 P P P P P PPP P P PP PP PPP + P Sbjct: 394 PRPPVVTPLPPPSLPSPPP----PAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVY 449 Query: 855 XPP 863 PP Sbjct: 450 SPP 452 Score = 32.7 bits (71), Expect = 0.32 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 5/47 (10%) Frame = +1 Query: 631 PPPPXXX---PPPXPXXXXPXPPXXPPXXXRAPLAPPP--XXXPPSP 756 PPPP PPP P PP PP +P PPP PP P Sbjct: 631 PPPPVVHYSSPPPPPVYYSSPPP--PPVYYSSPPPPPPVHYSSPPPP 675 Score = 32.3 bits (70), Expect = 0.43 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 10/66 (15%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLP----------XXXXPPPPXPPXRXPPPXPFLAHXXXGXXX 845 P P P PP PP P PP P PP PPP P Sbjct: 394 PRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPP 453 Query: 846 PPSXPP 863 PP PP Sbjct: 454 PPPPPP 459 Score = 32.3 bits (70), Expect = 0.43 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +1 Query: 631 PPPPX--XXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 PPPP PPP P P PP +P PP P P Sbjct: 620 PPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPP 663 Score = 32.3 bits (70), Expect = 0.43 Identities = 19/55 (34%), Positives = 23/55 (41%), Gaps = 4/55 (7%) Frame = +1 Query: 604 IIYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP----XXXPPSP 756 +++ P PP PPP P PP PP +P PPP PPSP Sbjct: 635 VVHYSSPPPPPVYYSSPPP-PPVYYSSPPPPPPVHYSSP--PPPEVHYHSPPPSP 686 Score = 32.3 bits (70), Expect = 0.43 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = +1 Query: 628 TPPPPXXX---PPPXP-XXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P P PP P P AP PP P Sbjct: 671 SPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPP 717 Score = 31.9 bits (69), Expect = 0.57 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +P PP P P P P PP P L PP PP P Sbjct: 393 SPRPPVVTPLPPPSLPSPPPPA-PIFSTPPTLTSPPPPSPPPP 434 Score = 31.9 bits (69), Expect = 0.57 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 6/48 (12%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXP------PXXPPXXXRAPLAPPPXXXPPSP 756 PPPP PP P P P P PP +P PPP PP P Sbjct: 513 PPPPVYSSPPPPPSPAPTPVYCTRPPPPPP---HSP--PPPQFSPPPP 555 Score = 31.9 bits (69), Expect = 0.57 Identities = 17/59 (28%), Positives = 18/59 (30%), Gaps = 2/59 (3%) Frame = +2 Query: 608 YXFXXPXXPPPPPXXXPPXXXXXPPGPXXXXXXXXXXXXXXXXXXXPPP--XXXGPPPP 778 Y + P PP P PP PP P PPP PPPP Sbjct: 586 YPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPP 644 Score = 31.5 bits (68), Expect = 0.75 Identities = 15/50 (30%), Positives = 17/50 (34%) Frame = +1 Query: 607 IYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +Y P PP PPP P PP P +P PP P Sbjct: 646 VYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPP 695 Score = 31.5 bits (68), Expect = 0.75 Identities = 17/53 (32%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +1 Query: 607 IYXXXPXTPPPPXXXPPPXPXXXXPXPPXXP---PXXXRAPLAPPPXXXPPSP 756 +Y P PPP PP P PP P P AP PP+P Sbjct: 656 VYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAP 708 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 7/52 (13%) Frame = +1 Query: 622 PXTPPPPXXXP-----PPXPXXXXPXPPXX--PPXXXRAPLAPPPXXXPPSP 756 P PP P P PP P P PP PP +PPP P P Sbjct: 521 PPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPP 572 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = +1 Query: 631 PPPPX--XXPPPXPXXXXPXPPXXPPXXXRAPLAPPP--XXXPPSP 756 PPPP PPP P PP PP + PPP PP P Sbjct: 611 PPPPCIE--PPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPP 654 Score = 27.9 bits (59), Expect = 9.2 Identities = 17/62 (27%), Positives = 17/62 (27%), Gaps = 5/62 (8%) Frame = +2 Query: 608 YXFXXPXXPPPPPXXXPPXXXXXPP-----GPXXXXXXXXXXXXXXXXXXXPPPXXXGPP 772 Y P PPP PP PP P PPP PP Sbjct: 560 YSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPP 619 Query: 773 PP 778 PP Sbjct: 620 PP 621 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 60.1 bits (139), Expect = 2e-09 Identities = 27/61 (44%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPP-XXXPPLPXXXXPPPPXPPXRXPPPX 809 PPP P P P P P P PP PPP PP P PPPP PP PPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPP 448 Query: 810 P 812 P Sbjct: 449 P 449 Score = 54.4 bits (125), Expect = 9e-08 Identities = 26/67 (38%), Positives = 27/67 (40%) Frame = +3 Query: 663 PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXX 842 P P P PP P PP PPP PP P P PP PP PPP + Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP-SPPPYVYPPPPPPYVY 434 Query: 843 XPPSXPP 863 PP PP Sbjct: 435 PPPPSPP 441 Score = 54.0 bits (124), Expect = 1e-07 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P PP P P PPP P P PPPP P PPP P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP-PPYVYPPPPPPYVYPPPPSP 440 Score = 51.2 bits (117), Expect = 9e-07 Identities = 25/62 (40%), Positives = 25/62 (40%), Gaps = 5/62 (8%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-----PXXXPPLPXXXXPPPPXPPXRXP 800 PP P P P P PP P PP PP P PP P PPP PP P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYP 435 Query: 801 PP 806 PP Sbjct: 436 PP 437 Score = 49.6 bits (113), Expect = 3e-06 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P PPPP PPP P P PP PP P PPP PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 49.2 bits (112), Expect = 3e-06 Identities = 24/60 (40%), Positives = 25/60 (41%) Frame = +3 Query: 684 APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 +P PP P PP PPP PP P PPPP PPP P PP PP Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP---PSPPPYVYPPPPPP 431 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/45 (44%), Positives = 22/45 (48%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P +PPPP PPP P P PP PP + P P PPSP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPPP PPP P P PP P P +PPP PP P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPP 429 Score = 48.0 bits (109), Expect = 8e-06 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP 747 P PPPP PPP P P PP PP +P PPP P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 47.2 bits (107), Expect = 1e-05 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 2/62 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXG--PPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P PP P PP PPP PP P PP PP P Sbjct: 396 PPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYM 455 Query: 807 XP 812 P Sbjct: 456 YP 457 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P PPPP PPP P P PP PP PPP PP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPPP PPP P PP P P PPP PP P Sbjct: 394 PPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPP 438 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = +1 Query: 607 IYXXXPXTPP--PPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +Y P PP PP PPP P P PP P P +P P P P Sbjct: 409 VYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPP 460 Score = 36.3 bits (80), Expect = 0.026 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = +2 Query: 605 SYXFXXPXXPPPPPXXXPPXXXXXPPGPXXXXXXXXXXXXXXXXXXXP-PPXXXGPPPP 778 S+ P PPPPP PP PP P P PP PPPP Sbjct: 371 SFGCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPP 429 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 4/61 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXA----PXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 PPP P P P P PP PP PP PP P P PP Sbjct: 405 PPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPPCNDL 464 Query: 801 P 803 P Sbjct: 465 P 465 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 PPP P P P P P PP P P P P P P Sbjct: 420 PPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPPCNDLPTP 467 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/92 (36%), Positives = 35/92 (38%), Gaps = 3/92 (3%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 P H H PPP P P P PP P PP PPP PP P PPP Sbjct: 547 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPP-PPPVHSPPPPVHSPPPP 605 Query: 777 ---PXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 P PP PPP P + PP PP Sbjct: 606 VHSPPPPVYSPPPPPPVHSPPPPVFSPP--PP 635 Score = 59.3 bits (137), Expect = 3e-09 Identities = 34/100 (34%), Positives = 36/100 (36%), Gaps = 11/100 (11%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXX-PPXPXXGPPGPPPXXXPPLPXXXXPP 773 P H + PPP P P P P PP P PP PPP PP P PP Sbjct: 575 PPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPP 634 Query: 774 P----------PXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 P P PP PPP P + PP PP Sbjct: 635 PVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPP 674 Score = 56.4 bits (130), Expect = 2e-08 Identities = 32/84 (38%), Positives = 32/84 (38%), Gaps = 5/84 (5%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP---PXPPXRX 797 H PPP P P P PP P PP PPP PP P PPP P PP Sbjct: 508 HSPPPPPVYSPPPPP--PVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHS 565 Query: 798 PPPXPFLAHXXXGXXXPP--SXPP 863 PPP PP S PP Sbjct: 566 PPPPVHSPPPPVHSPPPPVYSPPP 589 Score = 54.8 bits (126), Expect = 7e-08 Identities = 32/92 (34%), Positives = 33/92 (35%), Gaps = 3/92 (3%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 P H H PPP P P P PP P PP PP PP P PPP Sbjct: 540 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP-PPVYSPPPPPVHSPPPP 598 Query: 777 ---PXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 P PP PPP + PP PP Sbjct: 599 VHSPPPPVHSPPPPVYSPPPPPPVHSPP--PP 628 Score = 53.6 bits (123), Expect = 2e-07 Identities = 30/79 (37%), Positives = 31/79 (39%), Gaps = 2/79 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P +P PP P PP PPP PP P PPP PP PPP Sbjct: 493 PPPPPVHSPPPPSPI-HSP--PPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPV 549 Query: 813 FLAHXXXGXXXPP--SXPP 863 PP S PP Sbjct: 550 HSPPPPVHSPPPPVHSPPP 568 Score = 52.8 bits (121), Expect = 3e-07 Identities = 31/83 (37%), Positives = 32/83 (38%), Gaps = 6/83 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP---PXPPXRXPP 803 PPP P P P P P P P PPP PP P PPP P PP PP Sbjct: 530 PPPVYSPPPPPPVHSPPPPVHSPPPPVHSP-PPPVHSPPPPVHSPPPPVHSPPPPVYSPP 588 Query: 804 PXPFLAHXXXGXXXPP---SXPP 863 P P + PP S PP Sbjct: 589 PPPVHSPPPPVHSPPPPVHSPPP 611 Score = 50.0 bits (114), Expect = 2e-06 Identities = 30/83 (36%), Positives = 30/83 (36%), Gaps = 6/83 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPP----PPXPPXRXP 800 PPP P P P PP P PP PP PP P PP PP PP P Sbjct: 538 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPP--PPVHSPPPPVHSPPPPVYSPPPPPVHSP 595 Query: 801 PPXPFLAHXXXGXXXPP--SXPP 863 PP PP S PP Sbjct: 596 PPPVHSPPPPVHSPPPPVYSPPP 618 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/60 (40%), Positives = 24/60 (40%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 H PPP P P P PP P PP PPP PP P PP PP PP Sbjct: 623 HSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPP-PPPVKSPP-PPPVYSPPLLPPKMSSPP 680 Score = 48.4 bits (110), Expect = 6e-06 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPP-LPXXXXPPPPXPPXRXPPP 806 PPP P P P PP P P PPP PP LP PP P PPP Sbjct: 632 PPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSPPP 690 Score = 48.0 bits (109), Expect = 8e-06 Identities = 31/84 (36%), Positives = 31/84 (36%), Gaps = 7/84 (8%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXX--XXPPP---PXPPXRX 797 PPP P P P PP P PP PPP PP P PPP P PP Sbjct: 502 PPPSPIHSPPPP---PVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHS 558 Query: 798 PPPXPFLAHXXXGXXXPP--SXPP 863 PPP PP S PP Sbjct: 559 PPPPVHSPPPPVHSPPPPVHSPPP 582 Score = 44.8 bits (101), Expect = 8e-05 Identities = 25/80 (31%), Positives = 28/80 (35%), Gaps = 1/80 (1%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGP-PPXXXPPLPXXXXPPPPXPPXRXPP 803 H PPP P +P P P P P P P+ PPPP P PP Sbjct: 445 HSPPPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPP-PVHSPPP 503 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P + PP PP Sbjct: 504 PSPIHSPPPPPVYSPPPPPP 523 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP PPP P P P PP +P PPP PP P Sbjct: 527 PPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSP--PPPVHSPPPP 569 Score = 42.7 bits (96), Expect = 3e-04 Identities = 33/101 (32%), Positives = 35/101 (34%), Gaps = 12/101 (11%) Frame = +3 Query: 597 PINHIXXXXXHXP-PPXXXXXPX-PXXXXPX----APXXPPXPXXGPPG------PPPXX 740 P H H P PP P P P +P PP PP PPP Sbjct: 457 PPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVY 516 Query: 741 XPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PP P PPP PP PPP P + PP PP Sbjct: 517 SPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPP--PP 555 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXX---PPXXXRAPLAPPPXXXPPSP 756 PPPP PPP P P PP PP +P PPP PP P Sbjct: 520 PPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSP--PPPVHSPPPP 562 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/42 (42%), Positives = 20/42 (47%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 +PPPP PPP P P PP P PL PP PP+ Sbjct: 645 SPPPPVYSPPPPPVKSPPPPPVYSP-----PLLPPKMSSPPT 681 Score = 37.9 bits (84), Expect = 0.009 Identities = 27/94 (28%), Positives = 30/94 (31%), Gaps = 5/94 (5%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPP-GPPPXXXPPLPXXXXPP 773 P H + PPP P P P PP P PP PP PP P Sbjct: 634 PPVHSPPPPVYSPPPPVYSPPPPPVKSP-----PPPPVYSPPLLPPKMSSPPTQTPVNSP 688 Query: 774 PPXPPXR----XPPPXPFLAHXXXGXXXPPSXPP 863 PP P + PP F+ G PP Sbjct: 689 PPRTPSQTVEAPPPSEEFIIPPFIGHQYASPPPP 722 Score = 35.5 bits (78), Expect = 0.046 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP PP P P P PP +P PPP PP P Sbjct: 536 PPPPPPVH--SPPPPVHSPPPPVHSPPPPVHSP--PPPVHSPPPP 576 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/63 (28%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGP-PPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPS 854 P P P P P P P P+ PPPP P + H PP+ Sbjct: 402 PTRPVHKPQPPKESPQPNDPYNQSPVKFRRSPPPPQQPHH------HVVHSPPPASSPPT 455 Query: 855 XPP 863 PP Sbjct: 456 SPP 458 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 58.8 bits (136), Expect = 4e-09 Identities = 31/92 (33%), Positives = 34/92 (36%), Gaps = 3/92 (3%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 P H + PPP P P P P P P P PPP PP P PPP Sbjct: 665 PPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSP-PPPVHSPPPPVHSPPPP 723 Query: 777 ---PXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 P PP + PPP P + P PP Sbjct: 724 VHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPP 755 Score = 57.2 bits (132), Expect = 1e-08 Identities = 32/84 (38%), Positives = 32/84 (38%), Gaps = 5/84 (5%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP---PXPPXRX 797 H PPP P P P PP P PP PPP PP P PPP P PP Sbjct: 654 HSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPP-PPPVHSPPPPVHSPPPPVHSPPPPVHS 712 Query: 798 PPPXPFLAHXXXGXXXPP--SXPP 863 PPP PP S PP Sbjct: 713 PPPPVHSPPPPVHSPPPPVQSPPP 736 Score = 56.4 bits (130), Expect = 2e-08 Identities = 28/70 (40%), Positives = 28/70 (40%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 P H H PPP P P P PP P PP PPP PP P PP Sbjct: 694 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPP-PPPVFSPPPPAPIYSPP 752 Query: 777 PXPPXRXPPP 806 P PP PPP Sbjct: 753 P-PPVHSPPP 761 Score = 56.0 bits (129), Expect = 3e-08 Identities = 31/94 (32%), Positives = 33/94 (35%), Gaps = 5/94 (5%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPP-----GPPPXXXPPLPXX 761 P++ H PPP P P P PP P PP PPP PP P Sbjct: 680 PVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPV 739 Query: 762 XXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PPPP P PPP H P PP Sbjct: 740 FSPPPPAPIYSPPPPP---VHSPPPPVHSPPPPP 770 Score = 54.8 bits (126), Expect = 7e-08 Identities = 35/98 (35%), Positives = 35/98 (35%), Gaps = 9/98 (9%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXX 767 P H H PPP P P P P PP P PP PPP PP P Sbjct: 708 PPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPP-PPPVHSPPPPVHSP 766 Query: 768 PPP----PXPPXRXPPPXPFLAHXXXGXXXPP--SXPP 863 PPP P PP PPP PP S PP Sbjct: 767 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 804 Score = 53.2 bits (122), Expect = 2e-07 Identities = 33/97 (34%), Positives = 33/97 (34%), Gaps = 8/97 (8%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPX-APXXPPXPXXGPPGPPPXXXPPLPXXXXPP 773 P H H PPP P P P PP P PP P P PP P PP Sbjct: 701 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPP 760 Query: 774 -----PPXPPXRXPPPXPFLAHXXXGXXXPP--SXPP 863 PP PP PPP PP S PP Sbjct: 761 PPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 797 Score = 51.2 bits (117), Expect = 9e-07 Identities = 32/94 (34%), Positives = 33/94 (35%), Gaps = 6/94 (6%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXX 767 P H H PPP P P P P PP P P PPP PP P Sbjct: 715 PPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSP-PPPVHSPPPPPVHS 773 Query: 768 PPPPX---PPXRXPPPXPFLAHXXXGXXXPPSXP 860 PPPP PP PP P + PP P Sbjct: 774 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSP 807 Score = 50.8 bits (116), Expect = 1e-06 Identities = 30/82 (36%), Positives = 30/82 (36%), Gaps = 5/82 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP---PXPPXRXPP 803 PPP P P P PP P PP PP PP P PPP P PP PP Sbjct: 649 PPPPVHSPPPPVFSPPPPMHSPPPPVYSPP-PPVHSPPPPPVHSPPPPVHSPPPPVHSPP 707 Query: 804 PXPFLAHXXXGXXXPP--SXPP 863 P PP S PP Sbjct: 708 PPVHSPPPPVHSPPPPVHSPPP 729 Score = 50.8 bits (116), Expect = 1e-06 Identities = 29/80 (36%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP---PXPPXRXPP 803 PPP P P P PP P P PPP PP P PPP P PP PP Sbjct: 663 PPPPMHSPPPPVYSPPPPVHSPPPPPVHSP-PPPVHSPPPPVHSPPPPVHSPPPPVHSPP 721 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P H P PP Sbjct: 722 PP---VHSPPPPVQSPPPPP 738 Score = 50.4 bits (115), Expect = 2e-06 Identities = 27/72 (37%), Positives = 27/72 (37%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 P H H PPP P P P P P P P PPP PP P PP Sbjct: 754 PPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSP-PPPVHSPPPPSPIYSPP 812 Query: 777 PXPPXRXPPPXP 812 PP PPP P Sbjct: 813 --PPVFSPPPKP 822 Score = 50.0 bits (114), Expect = 2e-06 Identities = 22/64 (34%), Positives = 24/64 (37%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 P++ H PPP P P P PP P PP P P PP P PP Sbjct: 762 PVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPK 821 Query: 777 PXPP 788 P P Sbjct: 822 PVTP 825 Score = 48.4 bits (110), Expect = 6e-06 Identities = 27/79 (34%), Positives = 28/79 (35%), Gaps = 3/79 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP---PXPPXRXPP 803 P P P P P PP P P PPP PP P PPP P PP PP Sbjct: 745 PAPIYSPPPPPVHSPPPPVHSPPPPPVHSP-PPPVHSPPPPVHSPPPPVHSPPPPVHSPP 803 Query: 804 PXPFLAHXXXGXXXPPSXP 860 P + PP P Sbjct: 804 PPSPIYSPPPPVFSPPPKP 822 Score = 48.4 bits (110), Expect = 6e-06 Identities = 28/82 (34%), Positives = 29/82 (35%), Gaps = 5/82 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXP-----PPPXPPXRX 797 PPP P P P P P P P PPP PP P P PPP P Sbjct: 752 PPPPVHSPPPPVHSPPPPPVHSPPPPVHSP-PPPVHSPPPPVHSPPPPVHSPPPPSPIYS 810 Query: 798 PPPXPFLAHXXXGXXXPPSXPP 863 PPP F PP+ P Sbjct: 811 PPPPVFSPPPKPVTPLPPATSP 832 Score = 47.2 bits (107), Expect = 1e-05 Identities = 29/82 (35%), Positives = 29/82 (35%), Gaps = 6/82 (7%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP----PXPPXRXPP 803 PP P P P P P P P PPP PP P PPP P PP PP Sbjct: 642 PPVHSPPPPPPVHSPPPPVFSPPPPMHSP-PPPVYSPPPPVHSPPPPPVHSPPPPVHSPP 700 Query: 804 PXPFLAHXXXGXXXPP--SXPP 863 P PP S PP Sbjct: 701 PPVHSPPPPVHSPPPPVHSPPP 722 Score = 44.0 bits (99), Expect = 1e-04 Identities = 28/83 (33%), Positives = 29/83 (34%), Gaps = 6/83 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP---PXPPXRXPP 803 P P P PP P P PPP PP P PPP P PP PP Sbjct: 627 PSPSTEETKTTSPQSPPVHSPPPPPPVHSP-PPPVFSPPPPMHSPPPPVYSPPPPVHSPP 685 Query: 804 PXPFLAHXXXGXXXPP---SXPP 863 P P + PP S PP Sbjct: 686 PPPVHSPPPPVHSPPPPVHSPPP 708 Score = 42.3 bits (95), Expect = 4e-04 Identities = 24/72 (33%), Positives = 24/72 (33%), Gaps = 2/72 (2%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXA--PXXPPXPXXGPPGPPPXXXPPLPXXXXP 770 P H H PPP P P P PP P PP PP PP P P Sbjct: 769 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPP-PPVFSPPPKPVTPLP 827 Query: 771 PPPXPPXRXPPP 806 P P P P Sbjct: 828 PATSPMANAPTP 839 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/43 (44%), Positives = 21/43 (48%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P P P PP +P PPP PP P Sbjct: 655 SPPPPVFSPPP-PMHSPPPPVYSPPPPVHSP-PPPPVHSPPPP 695 Score = 41.5 bits (93), Expect = 7e-04 Identities = 18/43 (41%), Positives = 20/43 (46%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P P PP +P PPP PP P Sbjct: 669 SPPPPVYSPPPPVHSPPPPPVHSPPPPVHSP--PPPVHSPPPP 709 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P PP +P PPP PP P Sbjct: 662 SPPPPMHSPPPPVYSPPPPVHSPPPPPVHSP--PPPVHSPPPP 702 Score = 36.7 bits (81), Expect = 0.020 Identities = 22/69 (31%), Positives = 24/69 (34%), Gaps = 7/69 (10%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP----PXPPXRXPPPXPFLAHXXXGXXX 845 P +P P PP PP P PPP P PP PPP + Sbjct: 626 PPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPP 685 Query: 846 PP---SXPP 863 PP S PP Sbjct: 686 PPPVHSPPP 694 Score = 36.3 bits (80), Expect = 0.026 Identities = 18/45 (40%), Positives = 20/45 (44%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P +PP PPP P P P PP +P PPP PP P Sbjct: 639 PQSPPVHS-PPPPPPVHSPPPPVFSPPPPMHSP--PPPVYSPPPP 680 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 PPPP PP P P P PP +PPP P P Sbjct: 648 PPPPPVHSPPPPVFSPPPPMHSPPPPV---YSPPPPVHSPPP 686 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/56 (28%), Positives = 16/56 (28%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P P P P P P P P P PP Sbjct: 516 PPKPEESPKPEPPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPP 571 Score = 30.7 bits (66), Expect = 1.3 Identities = 24/75 (32%), Positives = 25/75 (33%), Gaps = 6/75 (8%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXXGPPGPPPXXX----PPLPXXXXPPPPXPPXRXPPPXPFLAH 824 P P +P P PP P P P PPPP PP PPP F Sbjct: 608 PVPNDPYDASPIKKRRPQ--PPSPSTEETKTTSPQSPPVHSPPPP-PPVHSPPPPVFSPP 664 Query: 825 XXXGXXXPP--SXPP 863 PP S PP Sbjct: 665 PPMHSPPPPVYSPPP 679 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/60 (30%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXP--PXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 P P P P P P P P PP P P P P PP + PP Sbjct: 536 PQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEES--PKPQPPKQEQPP 593 Score = 28.7 bits (61), Expect = 5.3 Identities = 19/77 (24%), Positives = 19/77 (24%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P P P P P P PP P P P P P P P Sbjct: 480 PKPESPKQESPKQEAPKPEQPKPKPE-SPKQESSKQEPPKPEESPKPEPPKPEESPKPQP 538 Query: 813 FLAHXXXGXXXPPSXPP 863 P PP Sbjct: 539 PKQETPKPEESPKPQPP 555 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 57.6 bits (133), Expect = 1e-08 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 2/81 (2%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 H PPP P P P PP P PP P P PP P PPPP P PPP Sbjct: 566 HSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPP-PPVHSPPPPPPVYSPPPP 624 Query: 807 --XPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 625 VFSPPPSQSPPVVYSPPPRPP 645 Score = 55.6 bits (128), Expect = 4e-08 Identities = 31/79 (39%), Positives = 32/79 (40%), Gaps = 2/79 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P +P PP P PP PP PP P PPPP PP PPP Sbjct: 518 PPPAPVNSPPPPVY---SPPPPPPPVHSPP--PPVHSPPPPPVYSPPPPPPPVHSPPPPV 572 Query: 813 FLAHXXXGXXXPP--SXPP 863 F PP S PP Sbjct: 573 FSPPPPVYSPPPPVHSPPP 591 Score = 53.6 bits (123), Expect = 2e-07 Identities = 30/82 (36%), Positives = 32/82 (39%), Gaps = 3/82 (3%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP---PXPPXRX 797 H PPP P P +P PP P P PPP PP P PPP P PP Sbjct: 541 HSPPPPVHSPPPPPVY---SPPPPPPPVHSP--PPPVFSPPPPVYSPPPPVHSPPPPVHS 595 Query: 798 PPPXPFLAHXXXGXXXPPSXPP 863 PPP + PP PP Sbjct: 596 PPPPAPVHSPPPPVHSPPPPPP 617 Score = 52.0 bits (119), Expect = 5e-07 Identities = 28/77 (36%), Positives = 29/77 (37%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P P P P PPP PP P PPP P PPP P Sbjct: 560 PPPPPVHSPPPPVFSPPPPVYSPPPPVHSP-PPPVHSPPPPAPVHSPPP-PVHSPPPPPP 617 Query: 813 FLAHXXXGXXXPPSXPP 863 + PPS P Sbjct: 618 VYSPPPPVFSPPPSQSP 634 Score = 50.0 bits (114), Expect = 2e-06 Identities = 28/81 (34%), Positives = 28/81 (34%), Gaps = 4/81 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPP-GPPPXXXPPLPXXXXPPPP---XPPXRXP 800 PPP P P P P P P P PPP P P PPPP PP Sbjct: 536 PPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHS 595 Query: 801 PPXPFLAHXXXGXXXPPSXPP 863 PP P H P PP Sbjct: 596 PPPPAPVHSPPPPVHSPPPPP 616 Score = 47.2 bits (107), Expect = 1e-05 Identities = 25/63 (39%), Positives = 25/63 (39%), Gaps = 3/63 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPX---PPXRXPP 803 PPP P P P PP P PP PPP P P PPPP PP P Sbjct: 535 PPPPPVHSPPPPVHSP-----PPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSP 589 Query: 804 PXP 812 P P Sbjct: 590 PPP 592 Score = 45.2 bits (102), Expect = 6e-05 Identities = 26/73 (35%), Positives = 28/73 (38%), Gaps = 11/73 (15%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXX----PPXPXXGPP----GPPPXXXPPLPXXXXPPPPX 782 H PPP P P P PP P PP PPP PP+ P PP Sbjct: 587 HSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPK 646 Query: 783 ---PPXRXPPPXP 812 PP + PPP P Sbjct: 647 INSPPVQSPPPAP 659 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPPP PPP P P P PP +P PPP PP P Sbjct: 558 PPPPPPPVHSPPP-PVFSPPPPVYSPPPPVHSP--PPPVHSPPPP 599 Score = 41.5 bits (93), Expect = 7e-04 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPL--APPPXXXPPSP 756 P PPPP PPP P P PP P P+ PPP PP P Sbjct: 533 PPPPPPPVHSPPP-PVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPP 578 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP----XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P PP PP P PPP PP P Sbjct: 525 SPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPP 571 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP PP P P P PP +P P P PP P Sbjct: 564 PVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPP 608 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP PP P P P PP PPP PP P Sbjct: 571 PVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPP 615 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +1 Query: 631 PPPPXXXPPPXP--XXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 PPPP PPP P P P PP +P PPP PP P Sbjct: 551 PPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSP--PPPVHSPPPP 592 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/46 (41%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXP---PXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P P P PP +P PPP PP P Sbjct: 542 SPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSP--PPPVYSPPPP 585 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP PP PP PP+ PP P PP Sbjct: 613 PPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPV--QSPPPAPVEKKETPP 667 Score = 36.3 bits (80), Expect = 0.026 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXX--PPXXXRAPLAPPPXXXPPSP 756 PP P PPP P PP PP +P PP PP P Sbjct: 519 PPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPP 562 Score = 35.9 bits (79), Expect = 0.035 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PP P P P P PPP PP P PP P PPP Sbjct: 496 PPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPP 553 Score = 35.1 bits (77), Expect = 0.061 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 +PPPP P P P P PP P PP PP Sbjct: 611 SPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPP 651 Score = 33.5 bits (73), Expect = 0.19 Identities = 22/81 (27%), Positives = 23/81 (28%), Gaps = 5/81 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXP-----PPPXPPXRXP 800 P P P P P P PP P P PPP PP Sbjct: 483 PSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHS 542 Query: 801 PPXPFLAHXXXGXXXPPSXPP 863 PP P + PP PP Sbjct: 543 PPPPVHSPPPPPVYSPPPPPP 563 Score = 31.5 bits (68), Expect = 0.75 Identities = 20/81 (24%), Positives = 25/81 (30%), Gaps = 2/81 (2%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXX--XPPSPXXGXXXXXXXXXXXX 801 +P PPP P P P PP +PPP PP P Sbjct: 510 SPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPP 569 Query: 802 XXXXXWPTXVXAXXPXLRNPP 864 P V + P + +PP Sbjct: 570 PPVFSPPPPVYSPPPPVHSPP 590 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/43 (30%), Positives = 15/43 (34%) Frame = +3 Query: 684 APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 +P P P P P P P P P P + P P P Sbjct: 423 SPVHKPTPVPTTPVHKPTPVPTTPVQKPSPVPTTPVQKPSPVP 465 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/62 (25%), Positives = 16/62 (25%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 H P P P P P P P P P P P P P P Sbjct: 426 HKPTPVPTTPVHKPTPVPTTPVQKPSPVPTTPVQKPSPVPTTPVHEPSPVLATPVDKPSP 485 Query: 807 XP 812 P Sbjct: 486 VP 487 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/47 (27%), Positives = 15/47 (31%) Frame = +1 Query: 607 IYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP 747 ++ P PP PPP P P PP PP P Sbjct: 625 VFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAPVEKKETPPAHAP 671 Score = 27.9 bits (59), Expect = 9.2 Identities = 20/76 (26%), Positives = 21/76 (27%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 PP P P P PP P PP PP P PP P F Sbjct: 621 PPPPVFSPPPSQSPPVVYSPPPRPPK-INSPPVQSPPPAPVEKKETPPAHAP-APSDDEF 678 Query: 816 LAHXXXGXXXPPSXPP 863 + G PP Sbjct: 679 IIPPFIGHQYASPPPP 694 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 56.4 bits (130), Expect = 2e-08 Identities = 27/73 (36%), Positives = 28/73 (38%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P PP P PP PPP PP P PPPP PPP P Sbjct: 69 PPPYIPCPPPPYTPKPPTVKPPPPPYVKPP-PPPTVKPPPPPYVKPPPPPTVKPPPPPTP 127 Query: 813 FLAHXXXGXXXPP 851 + PP Sbjct: 128 YTPPPPTPYTPPP 140 Score = 56.0 bits (129), Expect = 3e-08 Identities = 26/73 (35%), Positives = 27/73 (36%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P PP P P PPP PP P PPPP P PPP P Sbjct: 76 PPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTP 135 Query: 813 FLAHXXXGXXXPP 851 + PP Sbjct: 136 YTPPPPTVKPPPP 148 Score = 52.4 bits (120), Expect = 4e-07 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 5/67 (7%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPP-----PPXPPX 791 H P P P P P P P P PP PP PP P PP PP PP Sbjct: 59 HTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPT 118 Query: 792 RXPPPXP 812 PPP P Sbjct: 119 VKPPPPP 125 Score = 48.8 bits (111), Expect = 5e-06 Identities = 26/66 (39%), Positives = 26/66 (39%), Gaps = 7/66 (10%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXP-----PXR 794 PP P P P P PP P PP PP PP P PPPP P P Sbjct: 84 PPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTV 143 Query: 795 XPPPXP 812 PPP P Sbjct: 144 KPPPPP 149 Score = 48.4 bits (110), Expect = 6e-06 Identities = 29/85 (34%), Positives = 29/85 (34%), Gaps = 8/85 (9%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPX------PP 788 PPP P P P P PP P PP PP PP P PPPP P Sbjct: 91 PPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPV 150 Query: 789 XRXPPPXPFLAHXXXGXXXPPSXPP 863 PPP P P PP Sbjct: 151 VTPPPPTPTPEAPCPPPPPTPYPPP 175 Score = 48.0 bits (109), Expect = 8e-06 Identities = 27/82 (32%), Positives = 28/82 (34%), Gaps = 5/82 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXP-----PXRX 797 PPP P P PP P PP PP PP P PPPP P P Sbjct: 77 PPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPY 136 Query: 798 PPPXPFLAHXXXGXXXPPSXPP 863 PP P + PP P Sbjct: 137 TPPPPTVKPPPPPVVTPPPPTP 158 Score = 48.0 bits (109), Expect = 8e-06 Identities = 26/63 (41%), Positives = 26/63 (41%), Gaps = 3/63 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP---PXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P P PP P PP PP P P P PPPP P PP Sbjct: 121 PPPP----PTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPY-PPP 175 Query: 804 PXP 812 P P Sbjct: 176 PKP 178 Score = 46.0 bits (104), Expect = 3e-05 Identities = 27/79 (34%), Positives = 28/79 (35%), Gaps = 3/79 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPP---PPXPPXRXPP 803 PP P P P P P P P PP PP P PP PP PP PP Sbjct: 41 PPKHPAKPPKPPTVKP--PTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPP 98 Query: 804 PXPFLAHXXXGXXXPPSXP 860 P P + PP P Sbjct: 99 PPPTVKPPPPPYVKPPPPP 117 Score = 45.6 bits (103), Expect = 4e-05 Identities = 26/79 (32%), Positives = 28/79 (35%), Gaps = 4/79 (5%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGP-PPXXXPPLPXXXXPPP---PXPPXRXPP 803 PP P P P PP P PP PP P PPP P PP PP Sbjct: 31 PPKPSPHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPP 90 Query: 804 PXPFLAHXXXGXXXPPSXP 860 P P++ PP P Sbjct: 91 PPPYVKPPPPPTVKPPPPP 109 Score = 45.6 bits (103), Expect = 4e-05 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P P P PPP P P PP P PP P P Sbjct: 123 PPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKPETCP 182 Score = 45.2 bits (102), Expect = 6e-05 Identities = 27/92 (29%), Positives = 29/92 (31%), Gaps = 4/92 (4%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 P H H P P P P P P P PPP P PPP Sbjct: 34 PSPHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPP 93 Query: 777 ----PXPPXRXPPPXPFLAHXXXGXXXPPSXP 860 P PP PPP P++ PP P Sbjct: 94 YVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPP 125 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPP-XXPPXXXRAPLAPPPXXXPPSP 756 P TP PP PPP P P PP PP PPP PP P Sbjct: 79 PYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPP 124 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXX--XPPSP 756 PPPP PPP P P PP P P PPP PP P Sbjct: 98 PPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPP 141 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P TPPPP PPP P P PP P P PPP PP P Sbjct: 135 PYTPPPPTVKPPPPPVVTPP-PPTPTPEAPCPP--PPPTPYPPPP 176 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXX---PPXXXRAPLAPPPXXXPPSP 756 PPPP PPP P P PP PP + P PPP PP P Sbjct: 114 PPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPP--PPPVVTPPPP 156 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXX--PPXXXRAPLAPPPXXXPPSP 756 PPPP PPP P P PP PP P PP PP P Sbjct: 90 PPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPP 133 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXX--XPPSP 756 PPPP PPP P P PP P PPP PP P Sbjct: 106 PPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPP 149 Score = 36.7 bits (81), Expect = 0.020 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PP P PPP P P PP P PPP P +P Sbjct: 121 PPPPPTPYTPPPPTP--YTPPPPTVKPPPPPVVTPPPPTPTPEAP 163 Score = 36.3 bits (80), Expect = 0.026 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 PPPP PP P P P PP PPP PP P Sbjct: 68 PPPPYIPCPPPPYTPKP-PTVKPPPPPYVKPPPPPTVKPPPP 108 Score = 35.5 bits (78), Expect = 0.046 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXX--PPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP PPP P P PP P PPP P P Sbjct: 101 PTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPP 147 Score = 35.1 bits (77), Expect = 0.061 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLP 755 + PPP P P P P P PP P P PP P Sbjct: 136 YTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKP 178 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP 747 P PPP P P P P PP P P P P Sbjct: 141 PTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKPETCP 182 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/47 (31%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAP--LAPPPXXXPPSP 756 P P P PP P P PP P + PPP P P Sbjct: 31 PPKPSPHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPP 77 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 55.6 bits (128), Expect = 4e-08 Identities = 26/61 (42%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP-XPPXRXPPPX 809 PPP P P P PP P PP PPP PP P PPP PP + PPP Sbjct: 46 PPPSPSPEPEPEPAD-CPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPA 104 Query: 810 P 812 P Sbjct: 105 P 105 Score = 52.8 bits (121), Expect = 3e-07 Identities = 27/64 (42%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPP-LPXXXXPPPPXPPXRXP-PP 806 P P P P P P P P PP PPP PP LP PPP PP P PP Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPP 113 Query: 807 XPFL 818 P L Sbjct: 114 TPDL 117 Score = 49.2 bits (112), Expect = 3e-06 Identities = 26/62 (41%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP-PPX 809 PPP P P P P PP P PP PPP PP P P PP P P P Sbjct: 62 PPPPP---PPPCPPPPSPPPCPPPPSP-PPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDL 117 Query: 810 PF 815 PF Sbjct: 118 PF 119 Score = 48.8 bits (111), Expect = 5e-06 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPPP PPP P P PP PP L PPP PP+P Sbjct: 62 PPPPPPPPCPPPPSP-PPCPPPPSPPPSPPPPQLPPPPQLPPPAP 105 Score = 47.6 bits (108), Expect = 1e-05 Identities = 26/63 (41%), Positives = 26/63 (41%), Gaps = 3/63 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXP-PXPXXGPPGPPPXXXPPLPXXXX-PPPPXPPXRXPP- 803 P P P P P P P P P PP PPP PP P PPPP P PP Sbjct: 48 PSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPK 107 Query: 804 PXP 812 P P Sbjct: 108 PQP 110 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P P PP PPP P P P PP P P P PP+P Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P P PP PPP P P P PP P PPP P P Sbjct: 66 PPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQP 110 Score = 41.9 bits (94), Expect = 5e-04 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXX--RAPLAPPPXXXPPSP 756 P P P PPP P P PP PP P +PPP PP P Sbjct: 52 PEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Frame = +3 Query: 699 PXPXXGP-PGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 P P P P P P PP P PPPP PP PPP P PPS PP Sbjct: 46 PPPSPSPEPEPEPADCPPPP----PPPPCPPPPSPPPCP------PPPSPPPSPPP 91 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P P P P P P PP PP P PPP PPSP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPP-CPPPPSPPPSP 89 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 55.2 bits (127), Expect = 5e-08 Identities = 27/77 (35%), Positives = 29/77 (37%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P PP P PP PPP +P PPPP PP PP Sbjct: 573 PPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPP---PPSFG 629 Query: 813 FLAHXXXGXXXPPSXPP 863 + PP PP Sbjct: 630 STGNKRQAQPPPPPPPP 646 Score = 45.2 bits (102), Expect = 6e-05 Identities = 27/80 (33%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXR---XPP 803 PPP P P P PP P G G PP P PP P + PP Sbjct: 605 PPPSSRSIPSP---SAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPP 661 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P +H PPS PP Sbjct: 662 PPPPTSHSGSIRVGPPSTPP 681 Score = 44.8 bits (101), Expect = 8e-05 Identities = 28/80 (35%), Positives = 29/80 (36%), Gaps = 4/80 (5%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP--PXPPXRX--PP 803 PP P P P PP PPP PPLP PPP PP R PP Sbjct: 546 PPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPP--PPLPSRSIPPPLAQPPPPRPPPPP 603 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P + PP PP Sbjct: 604 PPPPSSRSIPSPSAPPPPPP 623 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/78 (33%), Positives = 27/78 (34%), Gaps = 11/78 (14%) Frame = +3 Query: 663 PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP-----------XPPXRXPPPX 809 P P P PP P PPP PP P PPPP PP PPP Sbjct: 567 PINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPP 626 Query: 810 PFLAHXXXGXXXPPSXPP 863 F + PP PP Sbjct: 627 SFGSTGNKRQAQPPPPPP 644 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 TPPPP PPP P P P PP P PPP PPS Sbjct: 571 TPPPPPPPPPPLPSRSIPPPLAQPP----PPRPPPPPPPPPS 608 Score = 41.5 bits (93), Expect = 7e-04 Identities = 28/82 (34%), Positives = 29/82 (35%), Gaps = 5/82 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXP-----XXGPPGPPPXXXPPLPXXXXPPPPXPPXRX 797 PPP P P P PP GPP PP PP P P PP Sbjct: 644 PPPPPTRIPAAKCAPPP-PPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPP--A 700 Query: 798 PPPXPFLAHXXXGXXXPPSXPP 863 PPP P + G PP PP Sbjct: 701 PPPLP-PSSTRLGAPPPPPPPP 721 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPL--APPPXXXPP 750 P TPPPP PP P PP PP + APPP PP Sbjct: 677 PSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPP 721 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/62 (35%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPP--GPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P PP P PPP PPL PPPP P + P P Sbjct: 681 PPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPP-PLSKTPVP 739 Query: 807 XP 812 P Sbjct: 740 PP 741 Score = 38.7 bits (86), Expect = 0.005 Identities = 22/51 (43%), Positives = 23/51 (45%), Gaps = 8/51 (15%) Frame = +1 Query: 622 PXTPPPPXXX---PPPX--PXXXXPXPPXXPPXXXRA---PLAPPPXXXPP 750 P PPPP PPP P P PP PP R+ P APPP PP Sbjct: 575 PPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPP 625 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAP---LAPPPXXXPPSPXXG 765 P PPPP P PP PP R P APPP PP+ G Sbjct: 620 PPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSG 670 Score = 37.5 bits (83), Expect = 0.011 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = +3 Query: 717 PPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PP PPP P P PP PPP F++ PP PP Sbjct: 482 PPPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPP 530 Score = 37.5 bits (83), Expect = 0.011 Identities = 24/83 (28%), Positives = 27/83 (32%), Gaps = 7/83 (8%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPG---PPPXXXPPLPXXXX----PPPPXPPX 791 PPP P P PP P P PPP PP PP PP Sbjct: 624 PPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPP 683 Query: 792 RXPPPXPFLAHXXXGXXXPPSXP 860 PPP +++ PP P Sbjct: 684 PPPPPKANISNAPKPPAPPPLPP 706 Score = 36.7 bits (81), Expect = 0.020 Identities = 23/71 (32%), Positives = 23/71 (32%), Gaps = 11/71 (15%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXG--------PPGPPPXXXPPLPXXXXPPPPXPP 788 PPP P P PP P PP PPP PPPP PP Sbjct: 662 PPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPP 721 Query: 789 XR---XPPPXP 812 PPP P Sbjct: 722 LSKTPAPPPPP 732 Score = 36.7 bits (81), Expect = 0.020 Identities = 27/77 (35%), Positives = 27/77 (35%), Gaps = 1/77 (1%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXG-PPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PP P P AP PP P P PPP PPL PPPP R P Sbjct: 698 PPAPPPLP-PSSTRLGAPPPPPPPPLSKTPAPPP---PPLSKTPVPPPPPGLGRGTSSGP 753 Query: 813 FLAHXXXGXXXPPSXPP 863 G PP PP Sbjct: 754 -PPLGAKGSNAPPPPPP 769 Score = 36.3 bits (80), Expect = 0.026 Identities = 24/77 (31%), Positives = 26/77 (33%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P +P PP PP PPP P P PP PPP Sbjct: 483 PPPPPPPPPLFTSTTSFSPSQPP-----PPPPPP---PLFMSTTSFSPSQPPPPPPPPPL 534 Query: 813 FLAHXXXGXXXPPSXPP 863 F + PP PP Sbjct: 535 FTSTTSFSPSQPPPPPP 551 Score = 35.9 bits (79), Expect = 0.035 Identities = 24/81 (29%), Positives = 25/81 (30%), Gaps = 4/81 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPP----XRXP 800 PPP P PP P P P+ PPPP PP P Sbjct: 529 PPPPPLFTSTTSFSPSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIP 588 Query: 801 PPXPFLAHXXXGXXXPPSXPP 863 PP LA PP PP Sbjct: 589 PP---LAQPPPPRPPPPPPPP 606 Score = 35.5 bits (78), Expect = 0.046 Identities = 30/98 (30%), Positives = 31/98 (31%), Gaps = 21/98 (21%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXX--------GPPGPPPXXXPPLPXXXXP------ 770 PPP P AP PP P GPP PP PP P Sbjct: 640 PPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPP 699 Query: 771 -PPPXPPXRX------PPPXPFLAHXXXGXXXPPSXPP 863 PPP PP PPP P L+ P S P Sbjct: 700 APPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTP 737 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXX---RAPLAPPPXXXPPSP 756 P PPPP P P P PP P + PPP PP P Sbjct: 601 PPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPP 648 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/65 (30%), Positives = 21/65 (32%) Frame = +2 Query: 584 YTSXTNKSYXFXXPXXPPPPPXXXPPXXXXXPPGPXXXXXXXXXXXXXXXXXXXPPPXXX 763 + S NK P PPPPP P PP P PPP Sbjct: 628 FGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPP--- 684 Query: 764 GPPPP 778 PPPP Sbjct: 685 -PPPP 688 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 622 PXTPPPPXXX---PPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 P PPPP PPP P P PP P PPP Sbjct: 715 PPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPP 755 Score = 33.1 bits (72), Expect = 0.25 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +1 Query: 631 PPPPXXXPPPX---PXXXXPXPPXXPPXXXRAPL-APPPXXXPPSP 756 PPPP PPP P PP PP + PP PP P Sbjct: 639 PPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPP 684 Score = 32.7 bits (71), Expect = 0.32 Identities = 30/107 (28%), Positives = 32/107 (29%), Gaps = 20/107 (18%) Frame = +3 Query: 603 NHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXX------------GPPGPPPXXXP 746 +H+ PPP P P PP P PP PPP P Sbjct: 476 DHVTLLPPPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPP---P 532 Query: 747 PL--------PXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PL P PPPP P P L H PP PP Sbjct: 533 PLFTSTTSFSPSQPPPPPPLPSFSNRDPLTTL-HQPINKTPPPPPPP 578 Score = 32.3 bits (70), Expect = 0.43 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P P PP PP P PP PP PPP P P Sbjct: 696 PKPPAPP-PLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVP 739 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPPP P PP PP + P PP P Sbjct: 639 PPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPP 683 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +1 Query: 622 PXTPPPPXXX---PPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 P PPPP PPP P PP + APPP PP+ Sbjct: 726 PAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLGAKGSNAPPP--PPPA 770 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 11/51 (21%) Frame = +1 Query: 631 PPPPXXXPPPX-------PXXXXPXPPXXPPXXXR----APLAPPPXXXPP 750 PPPP PPP P PP PP +P PPP PP Sbjct: 482 PPPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPP 532 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPPP P PP PP + + P PP P Sbjct: 485 PPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPP 529 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPPP P PP PP + + P PP P Sbjct: 506 PPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPPPPP 550 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 6/51 (11%) Frame = +1 Query: 622 PXTPPPPXXXPP------PXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPPP PP P PP PP P PP P Sbjct: 501 PSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPPPPPP 551 Score = 28.7 bits (61), Expect = 5.3 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 7/59 (11%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXX-------PPLPXXXXPPPPXPP 788 PPP P P AP PP P PPP PPL PP PP Sbjct: 714 PPPP----PPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLGAKGSNAPPPPP 768 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 54.4 bits (125), Expect = 9e-08 Identities = 27/77 (35%), Positives = 28/77 (36%), Gaps = 1/77 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP-PXPPXRXPPPX 809 PP P P P PP P P PP PP P PPP P PP PPP Sbjct: 538 PPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPP 597 Query: 810 PFLAHXXXGXXXPPSXP 860 P + PP P Sbjct: 598 PVFSPPPPVFSPPPPSP 614 Score = 52.4 bits (120), Expect = 4e-07 Identities = 26/58 (44%), Positives = 26/58 (44%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P PP P PP PPP PP P PPPP P PPP Sbjct: 567 PPPPHVYSPPPPVASPPPPSPPP-PVHSPP-PPPVFSPP-PPVFSPPPPSPVYSPPPP 621 Score = 51.2 bits (117), Expect = 9e-07 Identities = 27/79 (34%), Positives = 27/79 (34%), Gaps = 3/79 (3%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP---PXPPXRXPPP 806 PP P P P PP P PP P PP P PPP P PP PPP Sbjct: 575 PPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPP 634 Query: 807 XPFLAHXXXGXXXPPSXPP 863 F PP P Sbjct: 635 PTFSPPPTHNTNQPPMGAP 653 Score = 49.6 bits (113), Expect = 3e-06 Identities = 29/80 (36%), Positives = 30/80 (37%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P P P P PPP PP P PPPP PPP P Sbjct: 560 PPPVYSSPPPPHVYSPPPPVASPPP---PSPPPPVHSPPPPPVFSPPPPV--FSPPPPSP 614 Query: 813 FLAHXXXGXXXPP---SXPP 863 + PP S PP Sbjct: 615 VYSPPPPSHSPPPPVYSPPP 634 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P +PPPP PPP P P P PP PPP PP P Sbjct: 584 PPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPP 628 Score = 46.0 bits (104), Expect = 3e-05 Identities = 29/83 (34%), Positives = 29/83 (34%), Gaps = 6/83 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP----XPPXRXP 800 PPP P P PP P P PPP PP P PPPP PP Sbjct: 524 PPPKVEDTRVPPPQPPMPSPSPPSPIYSP--PPPVHSPPPPVYSSPPPPHVYSPPPPVAS 581 Query: 801 PPXPFLAHXXXGXXXPP--SXPP 863 PP P PP S PP Sbjct: 582 PPPPSPPPPVHSPPPPPVFSPPP 604 Score = 45.2 bits (102), Expect = 6e-05 Identities = 29/81 (35%), Positives = 29/81 (35%), Gaps = 5/81 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX-PPXPXXGPPGPPPXXXPPLPXXXXPPP----PXPPXRX 797 PPP P P P P PP P PP P P PP P PPP P PP Sbjct: 582 PPPPSP--PPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPP-PPSHSPPPPVYSPPPPTFS 638 Query: 798 PPPXPFLAHXXXGXXXPPSXP 860 PPP G P P Sbjct: 639 PPPTHNTNQPPMGAPTPTQAP 659 Score = 43.6 bits (98), Expect = 2e-04 Identities = 29/80 (36%), Positives = 29/80 (36%), Gaps = 4/80 (5%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXP--PPPXPPXRXPP 803 PP P P P P PP P P PPP PP P P PP PP PP Sbjct: 545 PPSPIYSPPPPVHSPPPPVYSSPPPPHVYSP-PPPVASPPPPSPPPPVHSPPPPPVFSPP 603 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P F PP PP Sbjct: 604 PPVFSPPPPSPVYSPP--PP 621 Score = 39.1 bits (87), Expect = 0.004 Identities = 30/91 (32%), Positives = 32/91 (35%), Gaps = 15/91 (16%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX----PPXPXXG-----PPGPP-PXXXPPLPXXXXPPP--- 776 PP P P +P PP P PP PP P PP P PPP Sbjct: 499 PPNEAQGPTPDDPYDASPVKNRRSPPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHS 558 Query: 777 PXPP--XRXPPPXPFLAHXXXGXXXPPSXPP 863 P PP PPP + PPS PP Sbjct: 559 PPPPVYSSPPPPHVYSPPPPVASPPPPSPPP 589 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = +1 Query: 607 IYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +Y P PP PPP P P PP +P P P PP P Sbjct: 572 VYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPP 621 Score = 37.9 bits (84), Expect = 0.009 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 2/62 (3%) Frame = +3 Query: 633 PPPXXXXXPX-PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP-XPPXRXPPP 806 P P P P P P PP GP P P+ PPPP R PPP Sbjct: 477 PKPEESPKPEQPQIPEPTKPVSPPNEAQGPTPDDPYDASPVKNRRSPPPPKVEDTRVPPP 536 Query: 807 XP 812 P Sbjct: 537 QP 538 Score = 37.9 bits (84), Expect = 0.009 Identities = 24/83 (28%), Positives = 28/83 (33%), Gaps = 2/83 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSPXXGXXXXXXXXXX 795 P PPP PP P P PP PP P+A PP PP P Sbjct: 548 PIYSPPPPVHSPPPPVYSSPPPPHVYSPP----PPVASPPPPSPPPPVHSPPPPPVFSPP 603 Query: 796 XXXXXXXWPTXVXAXXPXLRNPP 864 P+ V + P +PP Sbjct: 604 PPVFSPPPPSPVYSPPPPSHSPP 626 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/42 (42%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 628 TPPPPX-XXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 +PPPP PPP P P P PP +P PPP PP Sbjct: 601 SPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSP--PPPTFSPP 640 Score = 34.7 bits (76), Expect = 0.080 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP +P PPP PP P Sbjct: 522 SPPPPKVEDTRVPPPQPPMPSPSPPSPIYSP--PPPVHSPPPP 562 Score = 34.7 bits (76), Expect = 0.080 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 2/60 (3%) Frame = +3 Query: 633 PPPXXXXXPXP-XXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXP-PXRXPPP 806 PPP P P P P P P P PP PP PP P P + P P Sbjct: 602 PPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPPTHNTNQPPMGAPTPTQAPTP 661 Score = 34.7 bits (76), Expect = 0.080 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAP----LAPPPXXXPPSPXXG 765 PPP PPP P P P PP +P +PPP P G Sbjct: 603 PPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPPTHNTNQPPMG 651 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +2 Query: 623 PXXPPPPPXXXPPXXXXXPPGPXXXXXXXXXXXXXXXXXXXPPPXXXGPPPP 778 P PP P PP PP P PPP PPPP Sbjct: 534 PPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPP 585 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PP P PPP P P P P PPP PP P Sbjct: 544 SPPSPIYSPPP-PVHSPPPPVYSSPPPPHVYSPPPPVASPPPP 585 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +1 Query: 631 PPPPXXXP-PPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PP P PP P P P PP + PP PP P Sbjct: 536 PQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPP 578 Score = 31.1 bits (67), Expect = 0.99 Identities = 15/48 (31%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPP---XXXRAPLAPPPXXXPPSP 756 P PPP PP P P P PP + P+ P P+P Sbjct: 614 PVYSPPPPSHSPPPPVYSPPPPTFSPPPTHNTNQPPMGAPTPTQAPTP 661 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Frame = +2 Query: 623 PXXPPPPPXXXPPXXXX-XPPGPXXXXXXXXXXXXXXXXXXXPPPXXXGPPPP 778 P PPPP PP PP P PPP PPPP Sbjct: 578 PVASPPPPSPPPPVH--SPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPP 628 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/43 (32%), Positives = 17/43 (39%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PP P PP P +AP P+P Sbjct: 631 SPPPPTFSPP--PTHNTNQPPMGAPTPTQAPTPSSETTQVPTP 671 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 53.2 bits (122), Expect = 2e-07 Identities = 27/77 (35%), Positives = 29/77 (37%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P PP P P PP PP P PPPP PP P Sbjct: 70 PPPPQSTSPPPVATTP--PALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPP 127 Query: 813 FLAHXXXGXXXPPSXPP 863 + PP+ PP Sbjct: 128 AITPPPPLATTPPALPP 144 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P PP P PP P P LP PPP PP PPP P Sbjct: 105 PPPPAITPPPPPAITP--PLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPPP 162 Score = 51.2 bits (117), Expect = 9e-07 Identities = 28/80 (35%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPP-LPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PP LP PPP PP PP Sbjct: 46 PPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPP 105 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P + PP PP Sbjct: 106 PPPAITPPPPPAITPPLSPP 125 Score = 46.0 bits (104), Expect = 3e-05 Identities = 26/65 (40%), Positives = 26/65 (40%), Gaps = 6/65 (9%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPL---PXXXXPPPPX---PPXRX 797 PP P P P PP P PP PPP PPL P PPPP PP Sbjct: 85 PPALPPKPLPPPLSPPQTTPPPPPAITPP-PPPAITPPLSPPPPAITPPPPLATTPPALP 143 Query: 798 PPPXP 812 P P P Sbjct: 144 PKPLP 148 Score = 43.2 bits (97), Expect = 2e-04 Identities = 28/81 (34%), Positives = 28/81 (34%), Gaps = 4/81 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPP--GPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 P P P P A PP P PP PPP PP P PP PP PPP Sbjct: 92 PLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPP-PPLATTPPALPPKPLPPP 150 Query: 807 --XPFLAHXXXGXXXPPSXPP 863 P PP PP Sbjct: 151 LSPPQTTPPPPPAITPPLSPP 171 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/45 (42%), Positives = 21/45 (46%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P +PPPP PPP PP PP PL+PP PP P Sbjct: 121 PLSPPPPAITPPP---PLATTPPALPPKPLPPPLSPPQTTPPPPP 162 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPP--PPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PP PP PPP P P PP P PL+PPP P P Sbjct: 92 PLPPPLSPPQTTPPPPPAITPPPPPAITP-----PLSPPPPAITPPP 133 Score = 38.7 bits (86), Expect = 0.005 Identities = 29/94 (30%), Positives = 30/94 (31%) Frame = +3 Query: 582 IIXLXPINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXX 761 II L I + PPP P P P PP P PP PP P P Sbjct: 14 IIPLLTIVRADNHSVYCPPPP----PCICICNPGPP--PPQPDPQPPTPPTFQ--PAPPA 65 Query: 762 XXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PPP P PPP PP P Sbjct: 66 NDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSP 99 Score = 37.1 bits (82), Expect = 0.015 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 634 PPPXXXPPPXPXXXXPXP-----PXXPPXXXRAPLAPPPXXXPPSP 756 PP PPP P P P P PP PL+PP PP P Sbjct: 63 PPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPP 108 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPX---XXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 TPPPP PPP P P P P PLA P PP P Sbjct: 103 TPPPPPAIT--PPPPPAITPPLSPPPPAITPPPPLATTPPALPPKP 146 Score = 33.5 bits (73), Expect = 0.19 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPP PP P P PP PP + PPP PP P Sbjct: 77 SPPPVATTPPALPPKPLP-PPLSPP---QTTPPPPPAITPPPP 115 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +3 Query: 720 PGPPPXXXPP-LPXXXXPPPPXPPXRXPPPXP 812 PGP P PP LP PP PP PPP P Sbjct: 254 PGPSPTISPPPLPPQTLKPP--PPQTTPPPPP 283 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 699 PXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P PP PP P P PPPP P PP P Sbjct: 256 PSPTISPPPLPPQTLKPPPPQTTPPPP--PAITPPLSP 291 Score = 31.5 bits (68), Expect = 0.75 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PP P P P P PP P PP P SP Sbjct: 80 PVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSP 124 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 747 PLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 P P PPP PP PP P PP PP Sbjct: 254 PGPSPTISPPPLPPQTLKPPPPQTTPPPPPAITPPLSPP 292 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 2/44 (4%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXX--PPXXXRAPLAPPPXXXPPSP 756 PPP PPP PP PP PPP P P Sbjct: 71 PPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPP 114 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPP 732 P PP PP P P PP P PL+PP Sbjct: 264 PLPPQTLKPPPPQTTPPPPPAITP-----PLSPP 292 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 52.0 bits (119), Expect = 5e-07 Identities = 30/79 (37%), Positives = 31/79 (39%), Gaps = 2/79 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPP--XRXPPP 806 PPP P P AP PP P PPP PP PPPP PP R P P Sbjct: 523 PPP-----PPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSP 577 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P + G PP PP Sbjct: 578 PP-MPMGNSGSGGPPPPPP 595 Score = 50.8 bits (116), Expect = 1e-06 Identities = 29/84 (34%), Positives = 30/84 (35%), Gaps = 7/84 (8%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX---APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRX-- 797 PPP P P P AP PP P PPP PP+ PPP P Sbjct: 528 PPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGS 587 Query: 798 --PPPXPFLAHXXXGXXXPPSXPP 863 PPP P G PP PP Sbjct: 588 GGPPPPPPPMPLANGATPPPPPPP 611 Score = 47.6 bits (108), Expect = 1e-05 Identities = 25/62 (40%), Positives = 25/62 (40%), Gaps = 2/62 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPP--XRXPPP 806 PPP P P AP PP P PPP PP PPPP PP PPP Sbjct: 508 PPPPP---PPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPP 564 Query: 807 XP 812 P Sbjct: 565 PP 566 Score = 46.4 bits (105), Expect = 2e-05 Identities = 31/93 (33%), Positives = 32/93 (34%), Gaps = 4/93 (4%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLP-XXXXPP 773 P+ H PP P P P PP PPP PPLP PP Sbjct: 468 PLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPP---PPLPTTIAAPP 524 Query: 774 PPXPPXR---XPPPXPFLAHXXXGXXXPPSXPP 863 PP PP R PPP P PP PP Sbjct: 525 PPPPPPRAAVAPPPPP--PPPGTAAAPPPPPPP 555 Score = 45.6 bits (103), Expect = 4e-05 Identities = 28/86 (32%), Positives = 29/86 (33%), Gaps = 9/86 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXX----PPPPXPPX--- 791 PPP P P P PP P P PP+P PPPP PP Sbjct: 541 PPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLA 600 Query: 792 --RXPPPXPFLAHXXXGXXXPPSXPP 863 PPP P G PP PP Sbjct: 601 NGATPPPPPPPMAMANGAAGPPPPPP 626 Score = 45.6 bits (103), Expect = 4e-05 Identities = 32/89 (35%), Positives = 32/89 (35%), Gaps = 13/89 (14%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXP----XAPXXPPXP--XXGPPGPPPXXXP-PLPXXXXPPPPXPP- 788 PPP P P AP PP P G GPPP P PL PPPP PP Sbjct: 553 PPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPPM 612 Query: 789 -----XRXPPPXPFLAHXXXGXXXPPSXP 860 PPP P G PP P Sbjct: 613 AMANGAAGPPPPPPRMGMANGAAGPPPPP 641 Score = 40.7 bits (91), Expect = 0.001 Identities = 26/82 (31%), Positives = 27/82 (32%), Gaps = 5/82 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXP-----PPPXPPXRX 797 PPP P P PP PPP PP P P PPP PP Sbjct: 423 PPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPP--L 480 Query: 798 PPPXPFLAHXXXGXXXPPSXPP 863 PP L H PP+ P Sbjct: 481 PPAVMPLKHFAPPPPTPPAFKP 502 Score = 40.7 bits (91), Expect = 0.001 Identities = 29/90 (32%), Positives = 29/90 (32%), Gaps = 15/90 (16%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPP--------GPPPXXXP---PLPXXXXPPPPX 782 PP P P P PP P PP PPP P PL PPPP Sbjct: 454 PPPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPP 513 Query: 783 PP----XRXPPPXPFLAHXXXGXXXPPSXP 860 PP PPP P PP P Sbjct: 514 PPLPTTIAAPPPPPPPPRAAVAPPPPPPPP 543 Score = 40.7 bits (91), Expect = 0.001 Identities = 26/80 (32%), Positives = 26/80 (32%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPP---XRXPP 803 PPP P P PP P PPP PP P PPP PP P Sbjct: 493 PPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPP---PPPPRAAVAPPPPPPPPGTAAAP 549 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P PP PP Sbjct: 550 PPPPPPPGTQAAPPPPPPPP 569 Score = 39.5 bits (88), Expect = 0.003 Identities = 28/85 (32%), Positives = 28/85 (32%), Gaps = 8/85 (9%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPP--------GPPPXXXPPLPXXXXPPPPXPP 788 PPP P P P PP P PP PPP PP PPPP PP Sbjct: 492 PPP-----PTPPAFKPLKGSAPPPP---PPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPP 543 Query: 789 XRXPPPXPFLAHXXXGXXXPPSXPP 863 P P PP PP Sbjct: 544 GTAAAPPPPPPPPGTQAAPPPPPPP 568 Score = 37.5 bits (83), Expect = 0.011 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +3 Query: 717 PPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PP PPP PPL P P PPP P +A PP PP Sbjct: 416 PPPPPPPPPPPLSFIKTASLPLP---SPPPTPPIADIAISMPPPPPPPP 461 Score = 37.5 bits (83), Expect = 0.011 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = +1 Query: 622 PXTPPPPXXX-----PPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P PPPP PPP P PP PP +A APPP PP Sbjct: 524 PPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQA--APPPPPPPP 569 Score = 37.5 bits (83), Expect = 0.011 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPP 732 PPPP PPP P PP PP RAP PP Sbjct: 549 PPPP---PPPPGTQAAPPPPPPPPMQNRAPSPPP 579 Score = 36.3 bits (80), Expect = 0.026 Identities = 27/84 (32%), Positives = 27/84 (32%), Gaps = 7/84 (8%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPP-------X 791 PPP P P PP P PPP P PPPP PP Sbjct: 440 PPPTP---PIADIAISMPPPPPPPP------PPPAVMPLKHFAPPPPPPLPPAVMPLKHF 490 Query: 792 RXPPPXPFLAHXXXGXXXPPSXPP 863 PPP P G PP PP Sbjct: 491 APPPPTPPAFKPLKGSAPPPPPPP 514 Score = 35.9 bits (79), Expect = 0.035 Identities = 30/103 (29%), Positives = 33/103 (32%), Gaps = 14/103 (13%) Frame = +3 Query: 597 PINHIXXXXXHXP-PPXXXXXPXPXXXXPXAPXXPPXP-------XXGPPGPPPXXXPPL 752 P++ I P PP P P PP P PP PPP + Sbjct: 426 PLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPPLPPAVM 485 Query: 753 P-XXXXPPPPXPPXRXP-----PPXPFLAHXXXGXXXPPSXPP 863 P PPPP PP P PP P PP PP Sbjct: 486 PLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPP 528 Score = 35.9 bits (79), Expect = 0.035 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 6/49 (12%) Frame = +1 Query: 622 PXTPPPPXXX------PPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P PPPP PPP P PP PP A APPP PP Sbjct: 509 PPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAA-APPPPPPPP 556 Score = 35.1 bits (77), Expect = 0.061 Identities = 26/85 (30%), Positives = 26/85 (30%), Gaps = 8/85 (9%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP--------XPP 788 PPP P P A P P PP P P PPPP PP Sbjct: 416 PPPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPP 475 Query: 789 XRXPPPXPFLAHXXXGXXXPPSXPP 863 PPP P PP PP Sbjct: 476 --PPPPLPPAVMPLKHFAPPPPTPP 498 Score = 33.1 bits (72), Expect = 0.25 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 8/49 (16%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXX-----PXPPXXPPXXXRA---PLAPPPXXXPPS 753 PPPP PPP P PP PP A P PPP PP+ Sbjct: 417 PPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPA 465 Score = 33.1 bits (72), Expect = 0.25 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 P PPPP P P PP PP PP PP+ Sbjct: 456 PPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPA 499 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P T P PPP P PP P + PPP PP P Sbjct: 556 PGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPP--PPPMP 598 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +1 Query: 622 PXTPPPPXXX---PPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 P TPP PPP P P PP P AP PPP PP+ Sbjct: 441 PPTPPIADIAISMPPPPPP--PPPPPAVMPLKHFAP--PPPPPLPPA 483 Score = 29.5 bits (63), Expect = 3.0 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 4/62 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPP----LPXXXXPPPPXPPXRXP 800 PPP P P P P G GPPP PP PPPP R Sbjct: 590 PPPPPPPMPLANGATPPPPPPPMAMANGAAGPPPP--PPRMGMANGAAGPPPPPGAARSL 647 Query: 801 PP 806 P Sbjct: 648 RP 649 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 50.4 bits (115), Expect = 2e-06 Identities = 30/77 (38%), Positives = 30/77 (38%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG A G G G GG GGG G GG GGG G G GG G Sbjct: 169 GGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGS---GGGGAYGG 225 Query: 682 XGXXXXGXGXXXXXGGG 632 G G G GGG Sbjct: 226 GGAHGGGYGSGGGEGGG 242 Score = 50.0 bits (114), Expect = 2e-06 Identities = 30/77 (38%), Positives = 31/77 (40%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 G EGG + GGG GG GGGG GG GGG GG G G GA Sbjct: 148 GAGEGGGAGASG-YGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGA 206 Query: 682 XGXXXXGXGXXXXXGGG 632 G G G GGG Sbjct: 207 GG--YGGGGGGGSGGGG 221 Score = 48.4 bits (110), Expect = 6e-06 Identities = 29/77 (37%), Positives = 29/77 (37%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG G GGG GG G GG G GG GG GG G GG Sbjct: 207 GGYGGGGGGGSGGGGAYG-GGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSY 265 Query: 682 XGXXXXGXGXXXXXGGG 632 G G G GGG Sbjct: 266 GGEHGGGSGGGHGGGGG 282 Score = 48.0 bits (109), Expect = 8e-06 Identities = 25/58 (43%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXG-GXXXGGGGGXXGXXXIY 607 GGGG GGG GG GG GG G GG G G GGGGG G Y Sbjct: 166 GGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAY 223 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/58 (41%), Positives = 24/58 (41%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 GGG GG G GG G GG GG GG G GG G G G GGG Sbjct: 35 GGGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGG 92 Score = 46.0 bits (104), Expect = 3e-05 Identities = 28/78 (35%), Positives = 28/78 (35%), Gaps = 1/78 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRX-GGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 GG GG G GG GG GGGG G GG GGG G G GG G Sbjct: 181 GGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEG 240 Query: 685 AXGXXXXGXGXXXXXGGG 632 G GGG Sbjct: 241 GGYGGGAAGGYGGGGGGG 258 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/57 (40%), Positives = 23/57 (40%) Frame = -3 Query: 802 GGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 GG G GGG G G GGG GG G G GA G G G GGG Sbjct: 98 GGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGG 154 Score = 44.8 bits (101), Expect = 8e-05 Identities = 25/76 (32%), Positives = 26/76 (34%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG G + G GG GG GG G GG GG GG G G G Sbjct: 152 GGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGG 211 Query: 682 XGXXXXGXGXXXXXGG 635 G G G GG Sbjct: 212 GGGGGSGGGGAYGGGG 227 Score = 43.6 bits (98), Expect = 2e-04 Identities = 27/77 (35%), Positives = 27/77 (35%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG G G G GG G G G GGG GG G G GA Sbjct: 125 GGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGG-GGGGGSAGGA 183 Query: 682 XGXXXXGXGXXXXXGGG 632 G G G GGG Sbjct: 184 HGGSGYGGGEGGGAGGG 200 Score = 43.2 bits (97), Expect = 2e-04 Identities = 29/81 (35%), Positives = 29/81 (35%), Gaps = 4/81 (4%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGR--GGXXXGGGPGGPXXG--XGG 695 GG GG G GGG G GGG G GG GGG GG G GG Sbjct: 191 GGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGG 250 Query: 694 XXGAXGXXXXGXGXXXXXGGG 632 G G G G GG Sbjct: 251 YGGGGGGGEGGGGSYGGEHGG 271 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG GGG GG GG GG G G GG GGGGG G Sbjct: 211 GGGGGGSGGGGAYGGGGAHGGGYGSGGGEGG-GYGGGAAGGYGGGGGGGEGG 261 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/52 (40%), Positives = 22/52 (42%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG G GGG+GG GG G GG GG GGG G Sbjct: 175 GGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGG 226 Score = 42.7 bits (96), Expect = 3e-04 Identities = 27/77 (35%), Positives = 27/77 (35%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG EGG G GG GG GG G GG GGG G GG G Sbjct: 190 GGGEGGGAGGG---GSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGG 246 Query: 682 XGXXXXGXGXXXXXGGG 632 G G GGG Sbjct: 247 AAGGYGGGGGGGEGGGG 263 Score = 42.3 bits (95), Expect = 4e-04 Identities = 26/77 (33%), Positives = 28/77 (36%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG +G G G G GG G G GG GGG G GG G+ Sbjct: 177 GGSAGGAHGGSGYGGGEGGGAGG-GGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGS 235 Query: 682 XGXXXXGXGXXXXXGGG 632 G G G G G Sbjct: 236 GGGEGGGYGGGAAGGYG 252 Score = 41.9 bits (94), Expect = 5e-04 Identities = 27/79 (34%), Positives = 27/79 (34%), Gaps = 2/79 (2%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGG--PGGPXXGXGGXX 689 GG GG G GG GGG G GG GG G G GG Sbjct: 54 GGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYG 113 Query: 688 GAXGXXXXGXGXXXXXGGG 632 GA G G G GGG Sbjct: 114 GAAGGHAGGGGGGSGGGGG 132 Score = 41.9 bits (94), Expect = 5e-04 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = -1 Query: 783 EXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 E GG G GGG GGG GG GG G G GG G GGG Sbjct: 151 EGGGAGASGYGGGAYGGGGGHGG-GGGGGSAGGAHGGSGYGGGEGGGAGGG 200 Score = 41.5 bits (93), Expect = 7e-04 Identities = 29/79 (36%), Positives = 29/79 (36%), Gaps = 3/79 (3%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGX--GGGGXXXXGRG-GXXXGGGPGGPXXGXGGX 692 GG GG G GGG GG GGGG G G G GGG GG G G Sbjct: 194 GGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGG 253 Query: 691 XGAXGXXXXGXGXXXXXGG 635 G G G GG Sbjct: 254 GGGGGEGGGGSYGGEHGGG 272 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG GGG GG+ G G G GG GGGGG G Sbjct: 122 GGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGG 173 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GG GGG GG GG GG GG GG GG GG G Sbjct: 205 GAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGG 256 Score = 41.1 bits (92), Expect = 0.001 Identities = 26/77 (33%), Positives = 26/77 (33%), Gaps = 1/77 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPG-GPXXGXGGXXG 686 GG GG GGG GG GGG GG GGG G G GG G Sbjct: 211 GGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHG 270 Query: 685 AXGXXXXGXGXXXXXGG 635 G G GG Sbjct: 271 GGSGGGHGGGGGHGGGG 287 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGGG GG G G G G G GG GG GGGGG Sbjct: 129 GGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGG 177 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 GGG GG GGG G GG GG GG G G G G GG Sbjct: 82 GGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGG 139 Score = 39.1 bits (87), Expect = 0.004 Identities = 26/77 (33%), Positives = 26/77 (33%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 G EGG A G GG G GGGG G G G G G G G Sbjct: 103 GAGEGGGGG--YGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGY 160 Query: 682 XGXXXXGXGXXXXXGGG 632 G G G GGG Sbjct: 161 GGGAYGGGGGHGGGGGG 177 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GG GGG GG G GG G G GG GGGG G Sbjct: 216 GSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGG 267 Score = 38.7 bits (86), Expect = 0.005 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = -1 Query: 783 EXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 E GGGG GG GGG GG GG G GG G G GGG Sbjct: 106 EGGGGGYGGAAGG--HAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGG 154 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 5/56 (8%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGP-----GGXXXXXGGXXXGGGGGXXG 622 GG GG GGG GG GG G GG GG GGGGG G Sbjct: 74 GGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGG 129 Score = 38.3 bits (85), Expect = 0.007 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 3/57 (5%) Frame = -1 Query: 783 EXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXG---PGGXXXXXGGXXXGGGGGXXG 622 E GG G GG GGG GG GG G GG GG G GGG G Sbjct: 193 EGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAG 249 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGGG G G G+GG GG G G GG GGGGG Sbjct: 88 GGGGGGAASSGGYASGAGEGG----GGGYGGAAGGHAGGGGGGSGGGGG 132 Score = 37.1 bits (82), Expect = 0.015 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGP-XXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG G GG GG GG GG G GG GG GGG G G Sbjct: 185 GGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGG 237 Score = 36.7 bits (81), Expect = 0.020 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGP---XXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG GG GG GG GG G GG G GGG G G Sbjct: 35 GGGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGG 89 Score = 36.7 bits (81), Expect = 0.020 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGP--GGXXXXXGGXXXGGGGG 631 GG G GG GGG GG GG G GG GG GGGG Sbjct: 237 GGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGGG 287 Score = 36.7 bits (81), Expect = 0.020 Identities = 22/54 (40%), Positives = 23/54 (42%) Frame = -1 Query: 783 EXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 E GG G GG GGG+GG GG G G GG GGG G G Sbjct: 239 EGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSG-----GGHGGGGGHGGGG 287 Score = 36.3 bits (80), Expect = 0.026 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG G G GG GG GG G GG G GGG G G Sbjct: 230 GGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGG 281 Score = 35.9 bits (79), Expect = 0.035 Identities = 25/80 (31%), Positives = 26/80 (32%), Gaps = 3/80 (3%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXX-XGRGGXXXGGGP--GGPXXGXGGX 692 GG GG G G G G G G GGG GG G GG Sbjct: 117 GGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGG 176 Query: 691 XGAXGXXXXGXGXXXXXGGG 632 G+ G G G GGG Sbjct: 177 GGSAGGAHGGSGYGGGEGGG 196 Score = 35.9 bits (79), Expect = 0.035 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGP-GGXXXXXGGXXXGGG-GGXXG 622 GG G GGG GG GG G G GG GG GGG GG G Sbjct: 191 GGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYG 244 Score = 35.5 bits (78), Expect = 0.046 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GG G GGG GG G GG G GG GGGG Sbjct: 83 GGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGG 131 Score = 35.5 bits (78), Expect = 0.046 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Frame = -1 Query: 777 GGGGPXXXG-GGXXXXGGGQGG--PXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG G G GGG GG GG G G GG GG GG G Sbjct: 224 GGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHG 278 Score = 35.1 bits (77), Expect = 0.061 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXG----GGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG G GG GG GG G GG G G GGG G Sbjct: 190 GGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGG 245 Score = 34.7 bits (76), Expect = 0.080 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXG-GXXXGPGGXXXXXGGXXXGGGGG 631 GG G GG GGG GG G G G GG GGGGG Sbjct: 43 GGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGG 92 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG G GG G GG GG G G GGGGG G Sbjct: 63 GGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGG 114 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGP 713 GG GG G GGG GG GGG GG GGG P Sbjct: 241 GGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGGGYAP 290 Score = 33.9 bits (74), Expect = 0.14 Identities = 27/80 (33%), Positives = 27/80 (33%), Gaps = 5/80 (6%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGXGG----GGXXXXGRG-GXXXGGGPGGPXXGXGG 695 G GG G GGG GG G GG G G G GGG G G GG Sbjct: 105 GEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGA--SGYGG 162 Query: 694 XXGAXGXXXXGXGXXXXXGG 635 G G G GG Sbjct: 163 GAYGGGGGHGGGGGGGSAGG 182 Score = 32.3 bits (70), Expect = 0.43 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GG GG GG G G GG GG GG G Sbjct: 236 GGGEGGGYGGGA---AGGYGG--GGGGGEGGGGSYGGEHGGGSGGGHGGGGG 282 Score = 31.5 bits (68), Expect = 0.75 Identities = 23/77 (29%), Positives = 26/77 (33%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG G + + GG G G GG G G GGG G G GG + Sbjct: 40 GGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGY-GGAEGYASGGGSG--HGGGGGGAAS 96 Query: 682 XGXXXXGXGXXXXXGGG 632 G G G G G Sbjct: 97 SGGYASGAGEGGGGGYG 113 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -1 Query: 783 EXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 E GGG GG GG G GG GG G GG GG G Sbjct: 67 EGAGGG---YGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAG 117 Score = 28.7 bits (61), Expect = 5.3 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = -2 Query: 791 GGWXXGGGXPXXGEGGXXXXXXXXXXXXXXXGXXGGXGXXXX--GXGGGXXXGGGGVXGX 618 GG GG GEGG G GG G G G G GGGG G Sbjct: 226 GGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGG 285 Query: 617 XXY 609 Y Sbjct: 286 GGY 288 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 747 GXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GGG GG GG GG GG GG G G Sbjct: 31 GQASGGGGHGGGGGSGG--VSSGGYGGESGGGYGGGSGEGAG 70 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GG GGG GGG G GG G G G GGGGG Sbjct: 51 GGYGGESGGG---YGGGSG--EGAGGGYGGAEGYASGGGSGHGGGGGG 93 Score = 27.9 bits (59), Expect = 9.2 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 5/57 (8%) Frame = -1 Query: 777 GGGGPXXXGGGXX-XXGGGQGG----PXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG GGG GGG GG G G GG GG G G G G Sbjct: 54 GGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGG 110 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 50.4 bits (115), Expect = 2e-06 Identities = 28/77 (36%), Positives = 29/77 (37%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG A G GGG + G GGG G GG GG G G GG G Sbjct: 83 GGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGG 142 Query: 682 XGXXXXGXGXXXXXGGG 632 G G GGG Sbjct: 143 GAGGAIGGGASGGVGGG 159 Score = 49.6 bits (113), Expect = 3e-06 Identities = 25/60 (41%), Positives = 26/60 (43%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G GG GG GGGG G GG GGG GG G G + G G G GGG Sbjct: 56 GASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGG 115 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/77 (35%), Positives = 27/77 (35%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG G GG G G G G G GG GG G GG GA Sbjct: 359 GGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGA 418 Query: 682 XGXXXXGXGXXXXXGGG 632 G G G GGG Sbjct: 419 GGSVGAGGGVGGGVGGG 435 Score = 47.2 bits (107), Expect = 1e-05 Identities = 29/77 (37%), Positives = 30/77 (38%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG + G GG G GGGG G GG GG GG G G GA Sbjct: 275 GGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASG--GA 332 Query: 682 XGXXXXGXGXXXXXGGG 632 G G G GGG Sbjct: 333 GGSVGAGGGVGGGVGGG 349 Score = 46.4 bits (105), Expect = 2e-05 Identities = 29/76 (38%), Positives = 31/76 (40%), Gaps = 1/76 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXR-XGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 GG GG A G GGG + GG GGG GG GGG GG G GG G Sbjct: 138 GGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGG-SVGAGGGIG 196 Query: 685 AXGXXXXGXGXXXXXG 638 + G G G G Sbjct: 197 SGGGGTVGAGGRGSGG 212 Score = 46.4 bits (105), Expect = 2e-05 Identities = 26/59 (44%), Positives = 26/59 (44%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 G GG GG GGGG GRGG GG GG G G GA G G G GG Sbjct: 146 GAIGGGASGGVGGGGK---GRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGG 201 Score = 46.4 bits (105), Expect = 2e-05 Identities = 29/79 (36%), Positives = 29/79 (36%), Gaps = 2/79 (2%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGP--XXGXGGXX 689 GG GG G GG G GGGG G GG GG GG G GG Sbjct: 425 GGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGV 484 Query: 688 GAXGXXXXGXGXXXXXGGG 632 G G G G GGG Sbjct: 485 GVGGGGGIGGGAGGGVGGG 503 Score = 46.0 bits (104), Expect = 3e-05 Identities = 30/78 (38%), Positives = 30/78 (38%), Gaps = 1/78 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGG-GPGGPXXGXGGXXG 686 GG GG A G GGG G GGG G GG G G GG G GG G Sbjct: 67 GGGGGGIGGSGGVGAGGGVGGGA-GGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVG 125 Query: 685 AXGXXXXGXGXXXXXGGG 632 A G G GGG Sbjct: 126 AGGGAGGSVGAGGGIGGG 143 Score = 46.0 bits (104), Expect = 3e-05 Identities = 30/78 (38%), Positives = 31/78 (39%), Gaps = 1/78 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXX-GGGPGGPXXGXGGXXG 686 GG GG RKG GG GG GGG G GG GGG GG G G Sbjct: 95 GGASGGAGGGGKGRGRKGGGGAG--GGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGA 152 Query: 685 AXGXXXXGXGXXXXXGGG 632 + G G G GGG Sbjct: 153 SGGVGGGGKGRGGKSGGG 170 Score = 46.0 bits (104), Expect = 3e-05 Identities = 31/78 (39%), Positives = 31/78 (39%), Gaps = 1/78 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRG-GXXXGGGPGGPXXGXGGXXG 686 GG GG A G GG GG GGG GRG G GG GG G GG G Sbjct: 279 GGGVGGGVGGSVGGAVGGAVGGAVGGG-GGGSVGGGGRGSGGASGGASGGASGGAGGSVG 337 Query: 685 AXGXXXXGXGXXXXXGGG 632 A G G G G G Sbjct: 338 AGGGVGGGVGGGVGGGVG 355 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/76 (34%), Positives = 26/76 (34%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG G G GG G GG G GRG GG GG G G GA Sbjct: 71 GGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGA 130 Query: 682 XGXXXXGXGXXXXXGG 635 G G G GG Sbjct: 131 GGSVGAGGGIGGGAGG 146 Score = 44.8 bits (101), Expect = 8e-05 Identities = 28/78 (35%), Positives = 28/78 (35%), Gaps = 1/78 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXG-XGGXXG 686 GG GG A G GG GG G G G G GGG GG G GG G Sbjct: 394 GGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVG 453 Query: 685 AXGXXXXGXGXXXXXGGG 632 G G G G G Sbjct: 454 GGGGGSVGGGGRGSGGAG 471 Score = 44.4 bits (100), Expect = 1e-04 Identities = 28/77 (36%), Positives = 28/77 (36%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG A G GGG GG G G G GG G GG G GG G Sbjct: 437 GGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAG--GGVGVGGGGGIGG 494 Query: 682 XGXXXXGXGXXXXXGGG 632 G G GGG Sbjct: 495 GAGGGVGGGVGGGVGGG 511 Score = 43.6 bits (98), Expect = 2e-04 Identities = 28/78 (35%), Positives = 28/78 (35%), Gaps = 2/78 (2%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXG--XGGXX 689 GG GG G GG G GGGG G GG GG GG G G Sbjct: 343 GGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASG 402 Query: 688 GAXGXXXXGXGXXXXXGG 635 GA G G G GG Sbjct: 403 GASGGASGGVGGAGGAGG 420 Score = 43.6 bits (98), Expect = 2e-04 Identities = 26/77 (33%), Positives = 26/77 (33%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG A G GG G GGGG G G GG GG G G Sbjct: 351 GGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASG 410 Query: 682 XGXXXXGXGXXXXXGGG 632 G G GGG Sbjct: 411 GVGGAGGAGGSVGAGGG 427 Score = 43.6 bits (98), Expect = 2e-04 Identities = 28/77 (36%), Positives = 28/77 (36%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG A G GG G GG G G GGG GG G G GA Sbjct: 390 GGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVG--GA 447 Query: 682 XGXXXXGXGXXXXXGGG 632 G G G GGG Sbjct: 448 VGGAVGGGGGGSVGGGG 464 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG GGG GG GG GG G GG GG G GGG G Sbjct: 303 GGGGGGSVGGGGRGSGGASGG--ASGGASGGAGGSVGAGGGVGGGVGGGVGG 352 Score = 42.7 bits (96), Expect = 3e-04 Identities = 23/57 (40%), Positives = 23/57 (40%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 GGG GG GGG G GG GG GG G GG G G G GG Sbjct: 462 GGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGG 518 Score = 42.7 bits (96), Expect = 3e-04 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G GGG G GG G G G GGG GG G GG G G G G GGG Sbjct: 495 GAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAG---AGGGAGGGVGGG 551 Score = 41.9 bits (94), Expect = 5e-04 Identities = 25/60 (41%), Positives = 26/60 (43%), Gaps = 3/60 (5%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPG---GPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 GGG G GGGG G+ G GGG G G G GG GA G G G GG Sbjct: 149 GGGASG-GVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGG 207 Score = 41.9 bits (94), Expect = 5e-04 Identities = 27/76 (35%), Positives = 27/76 (35%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG G GGG G GGG GRG GG G G G GA Sbjct: 173 GGVGGGVGAGGGAGGSVGAGGGI--GSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGA 230 Query: 682 XGXXXXGXGXXXXXGG 635 G G G GG Sbjct: 231 SGGVGVGGGAGGSGGG 246 Score = 41.9 bits (94), Expect = 5e-04 Identities = 31/81 (38%), Positives = 32/81 (39%), Gaps = 4/81 (4%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGG----GGXXXXGRGGXXXGGGPGGPXXGXGG 695 GG GG +G GG GG GG GG G GG GGG GG G G Sbjct: 237 GGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGV-GGGVGGSVGGAVG 295 Query: 694 XXGAXGXXXXGXGXXXXXGGG 632 GA G G G GGG Sbjct: 296 --GAVGGAVGGGGGGSVGGGG 314 Score = 41.9 bits (94), Expect = 5e-04 Identities = 22/50 (44%), Positives = 23/50 (46%) Frame = -1 Query: 771 GGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG GGG GGG+G GG G GG GG GGGGG G Sbjct: 449 GGAVGGGGGGSVGGGGRGS----GGAGGGTGGSVGAGGGVGVGGGGGIGG 494 Score = 41.9 bits (94), Expect = 5e-04 Identities = 26/76 (34%), Positives = 26/76 (34%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG G G GGG GG GG G G G GGG GG G G Sbjct: 462 GGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVG 521 Query: 682 XGXXXXGXGXXXXXGG 635 G G G GG Sbjct: 522 GGVGGAGRGSGGASGG 537 Score = 41.9 bits (94), Expect = 5e-04 Identities = 30/81 (37%), Positives = 30/81 (37%), Gaps = 4/81 (4%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRX---GGXGGG-GXXXXGRGGXXXGGGPGGPXXGXGG 695 GG GG G GGG R G GGG G G GG G G GG G GG Sbjct: 490 GGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGG---GAGG 546 Query: 694 XXGAXGXXXXGXGXXXXXGGG 632 G G G GGG Sbjct: 547 GVGGGANVGVGVGAGGSTGGG 567 Score = 41.5 bits (93), Expect = 7e-04 Identities = 28/78 (35%), Positives = 28/78 (35%), Gaps = 1/78 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGG-GPGGPXXGXGGXXG 686 GG G A G GGG G GGG G GG GG GG G GG G Sbjct: 122 GGVGAGGGAGGSVGAGGGIGGGA-GGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVG 180 Query: 685 AXGXXXXGXGXXXXXGGG 632 A G G G G Sbjct: 181 AGGGAGGSVGAGGGIGSG 198 Score = 41.5 bits (93), Expect = 7e-04 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPG-GPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 G GGG G G GG G GG GG G G G GG GA G G GG Sbjct: 180 GAGGGA-GGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGG 238 Query: 634 G 632 G Sbjct: 239 G 239 Score = 41.5 bits (93), Expect = 7e-04 Identities = 28/81 (34%), Positives = 28/81 (34%), Gaps = 4/81 (4%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPG----GPXXGXGG 695 G GG G G G GG G GG GG GGG G G G GG Sbjct: 207 GRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGG 266 Query: 694 XXGAXGXXXXGXGXXXXXGGG 632 GA G G G G G Sbjct: 267 NVGAGGGLGGGVGGGVGGGVG 287 Score = 41.5 bits (93), Expect = 7e-04 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 1/78 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXG-XGGXXG 686 GG GG G GGG G GG G G G GG GG G GG Sbjct: 406 GGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGR 465 Query: 685 AXGXXXXGXGXXXXXGGG 632 G G G GGG Sbjct: 466 GSGGAGGGTGGSVGAGGG 483 Score = 41.5 bits (93), Expect = 7e-04 Identities = 25/56 (44%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = -1 Query: 786 VEXGGGGPXXXGG-GXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 V GGGG GG G GGG GG GG G GG GG G GGG G Sbjct: 452 VGGGGGGSVGGGGRGSGGAGGGTGGSVGAGG-GVGVGGGGGIGGGAGGGVGGGVGG 506 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 2/78 (2%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXG--GXX 689 GG GG G GG G GG G G G GG GG G G G Sbjct: 55 GGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGG 114 Query: 688 GAXGXXXXGXGXXXXXGG 635 GA G G G GG Sbjct: 115 GAGGGVGGGVGAGGGAGG 132 Score = 40.3 bits (90), Expect = 0.002 Identities = 26/77 (33%), Positives = 26/77 (33%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG G A G GGG GG GG G G GG GG G G G Sbjct: 102 GGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGK 161 Query: 682 XGXXXXGXGXXXXXGGG 632 G G GGG Sbjct: 162 GRGGKSGGGAGGGVGGG 178 Score = 40.3 bits (90), Expect = 0.002 Identities = 29/79 (36%), Positives = 30/79 (37%), Gaps = 3/79 (3%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGG---GPGGPXXGXGGXX 689 G +GG G GGG G G GG G GG GG G GG G GG Sbjct: 109 GRKGGGGAGGGVGGGVGAGGGA-GGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKS 167 Query: 688 GAXGXXXXGXGXXXXXGGG 632 G G G G GGG Sbjct: 168 G--GGAGGGVGGGVGAGGG 184 Score = 40.3 bits (90), Expect = 0.002 Identities = 28/81 (34%), Positives = 28/81 (34%), Gaps = 4/81 (4%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXG----G 695 GG G A G GGG G GG G G G GGG GG G G G Sbjct: 410 GGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGG 469 Query: 694 XXGAXGXXXXGXGXXXXXGGG 632 G G G GGG Sbjct: 470 AGGGTGGSVGAGGGVGVGGGG 490 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG GG GGG GG GG G G GG G GGG G Sbjct: 112 GGGGAGGGVGGGVGAGGGAGGSVGAGGGIGG-GAGGAIGGGASGGVGGGGKG 162 Score = 39.9 bits (89), Expect = 0.002 Identities = 29/78 (37%), Positives = 29/78 (37%), Gaps = 1/78 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG R G GG GG GGG G GG G GG G GG GA Sbjct: 150 GGASGGVGGGGK--GRGGKSGGGAGGGVGGGVGAGGGAGGSVGAG--GGIGSGGGGTVGA 205 Query: 682 XGXXXXG-XGXXXXXGGG 632 G G G G G Sbjct: 206 GGRGSGGASGGGGTVGAG 223 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GG GGG GG GG GG GG GG G G Sbjct: 168 GGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGG 218 Score = 39.5 bits (88), Expect = 0.003 Identities = 26/76 (34%), Positives = 26/76 (34%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG G A G GG GG GGG GG G G GG G GA Sbjct: 112 GGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGA 171 Query: 682 XGXXXXGXGXXXXXGG 635 G G G GG Sbjct: 172 GGGVGGGVGAGGGAGG 187 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GG GGG GGG GG GG G GG GG GG GG G Sbjct: 129 GAGGSVGAGGGI---GGGAGG-AIGGGASGGVGGGGKGRGGKSGGGAGGGVG 176 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G G R G GG G GG GG GG G GG G G G G G G Sbjct: 204 GAGGRGSGGASGGGGTVGAGGRGSGGASGG--VGVGGGAGGSGGGSVGGGGRGSGGVG 259 Score = 39.1 bits (87), Expect = 0.004 Identities = 31/84 (36%), Positives = 32/84 (38%), Gaps = 7/84 (8%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGG---GXRXGGXGG-GGXXXXGRG-GXXXGGGPGGPXXG-- 704 GG GG +G GG G G GG GG G G G GGG GG G Sbjct: 299 GGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGV 358 Query: 703 XGGXXGAXGXXXXGXGXXXXXGGG 632 G GA G G G GGG Sbjct: 359 GGAVGGAVGGAVGGGGGGSVGGGG 382 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQG---GPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG G G GGG G G GG G GG G GG GG G Sbjct: 67 GGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVG 121 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGG 634 GGGG G GGG GG GG G GG GG GGGG Sbjct: 157 GGGGKGRGGKSGGGAGGGVGGGVGAGG---GAGGSVGAGGGIGSGGGG 201 Score = 38.3 bits (85), Expect = 0.007 Identities = 24/76 (31%), Positives = 24/76 (31%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 G GG G GGG G GG G G G GG GG G GG Sbjct: 252 GRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVG 311 Query: 682 XGXXXXGXGXXXXXGG 635 G G GG Sbjct: 312 GGGRGSGGASGGASGG 327 Score = 38.3 bits (85), Expect = 0.007 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 1/70 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRX-GGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 GG GG G GG R GG GG G GG GG G G GG G Sbjct: 506 GGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGAGGSTG 565 Query: 685 AXGXXXXGXG 656 G G Sbjct: 566 GGAAGGGGVG 575 Score = 37.9 bits (84), Expect = 0.009 Identities = 28/82 (34%), Positives = 29/82 (35%), Gaps = 1/82 (1%) Frame = -1 Query: 864 GGVXKXGXXGXHXXXXXXXXXXXXGXVEXGG-GGPXXXGGGXXXXGGGQGGPXXXGGXXX 688 GGV G G G V GG G GGG GG+G GG Sbjct: 177 GGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGV 236 Query: 687 GPGGXXXXXGGXXXGGGGGXXG 622 G GG GG GGG G G Sbjct: 237 G-GGAGGSGGGSVGGGGRGSGG 257 Score = 37.9 bits (84), Expect = 0.009 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGG-GQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GG G GG GG G GG G GGG G Sbjct: 237 GGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGG 288 Score = 37.9 bits (84), Expect = 0.009 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXX-GGXXXGGGGGXXG 622 GG G GG GGG GG GG G GG GG GGGGG G Sbjct: 410 GGVGGAGGAGGSVGAGGGVGG-GVGGGVGGGVGGAVGGAVGGAVGGGGGGSVG 461 Score = 37.5 bits (83), Expect = 0.011 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -1 Query: 786 VEXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 V GG G GGG G GG GG G G GG G GGG G Sbjct: 460 VGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRG 514 Score = 37.1 bits (82), Expect = 0.015 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = -1 Query: 786 VEXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 V G GG G G GGG GG GG G GG GG GG G G Sbjct: 49 VGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAG-GGVGGGAGGAIGGGASGGAG 102 Score = 37.1 bits (82), Expect = 0.015 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = -1 Query: 771 GGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG GGG GGG+G GG G G G G GGG G Sbjct: 299 GGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGG 348 Score = 37.1 bits (82), Expect = 0.015 Identities = 27/76 (35%), Positives = 27/76 (35%), Gaps = 1/76 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXG-XGGXXG 686 G GG A G GG GG GGG G G GGG GG G GG G Sbjct: 314 GRGSGGASGGASGGASGGAGGSVGAGGGVGGG--VGGGVGGGVGGGVGGAVGGAVGGAVG 371 Query: 685 AXGXXXXGXGXXXXXG 638 G G G G Sbjct: 372 GGGGGSVGGGGRGSGG 387 Score = 37.1 bits (82), Expect = 0.015 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 2/78 (2%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXG-GGXRXGGXGGG-GXXXXGRGGXXXGGGPGGPXXGXGGXX 689 GG GG A G GG GG GGG G G G GG GG G GG Sbjct: 318 GGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGS 377 Query: 688 GAXGXXXXGXGXXXXXGG 635 G G GG Sbjct: 378 VGGGGRGSGGASGGASGG 395 Score = 37.1 bits (82), Expect = 0.015 Identities = 24/53 (45%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGG-XXXXXGGXXXGGGGGXXG 622 G GG GGG GGG GG GG G GG GG GGGGG G Sbjct: 331 GAGGSVGAGGG---VGGGVGG-GVGGGVGGGVGGAVGGAVGGAVGGGGGGSVG 379 Score = 37.1 bits (82), Expect = 0.015 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG GGG GG GG GG G G GG GG G Sbjct: 371 GGGGGGSVGGGGRGSGGASGG--ASGGASGGASGGASGGASGGVGGAGGAGG 420 Score = 37.1 bits (82), Expect = 0.015 Identities = 23/77 (29%), Positives = 23/77 (29%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG G G G GG GG G GG GG G G G G Sbjct: 381 GGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGV 440 Query: 682 XGXXXXGXGXXXXXGGG 632 G G GGG Sbjct: 441 GGAVGGAVGGAVGGGGG 457 Score = 37.1 bits (82), Expect = 0.015 Identities = 25/79 (31%), Positives = 26/79 (32%), Gaps = 2/79 (2%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXG--XGGXX 689 GG GG G G G GG G G G GG GG G GG Sbjct: 398 GGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGG 457 Query: 688 GAXGXXXXGXGXXXXXGGG 632 G+ G G G GG Sbjct: 458 GSVGGGGRGSGGAGGGTGG 476 Score = 36.7 bits (81), Expect = 0.020 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -1 Query: 771 GGPXXXGGGXXXXG-GGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG GGG G GG GG GG G GG GG G GGG G Sbjct: 59 GGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIG--GGASGGAGGGGKG 107 Score = 36.7 bits (81), Expect = 0.020 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG G GGG GG G GG G G GG GG GG G Sbjct: 74 GGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVG 125 Score = 36.7 bits (81), Expect = 0.020 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG G GGG GG GG G GG GG G GG G Sbjct: 102 GGGGKGRGRKGGGGAGGGVGGGVGAGG---GAGGSVGAGGGIGGGAGGAIGG 150 Score = 36.7 bits (81), Expect = 0.020 Identities = 26/80 (32%), Positives = 27/80 (33%), Gaps = 4/80 (5%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGG--GXRXGGXGGG--GXXXXGRGGXXXGGGPGGPXXGXGG 695 GG GG +G GG G GG GG G G G G G G G GG Sbjct: 367 GGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGG 426 Query: 694 XXGAXGXXXXGXGXXXXXGG 635 G G G GG Sbjct: 427 GVGGGVGGGVGGGVGGAVGG 446 Score = 36.7 bits (81), Expect = 0.020 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG GG GG GG GG GG GG GG GG G Sbjct: 394 GGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVG 445 Score = 36.7 bits (81), Expect = 0.020 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 2/57 (3%) Frame = -1 Query: 786 VEXGGGGPXXXGGGXXXXGGGQGGP--XXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 V GGG GGG GGG GG GG G GG GG GG GG G Sbjct: 422 VGAGGGVGGGVGGG---VGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTG 475 Score = 36.3 bits (80), Expect = 0.026 Identities = 22/64 (34%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = -3 Query: 817 RKGXGGGXRXGGXGGGGXXXXGRGGXXXGGG--PGGPXXGXGGXXGAXGXXXXGXGXXXX 644 + G G G GGG G GG GGG G G GG G G G Sbjct: 41 KHGRGSVGVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGG 100 Query: 643 XGGG 632 GGG Sbjct: 101 AGGG 104 Score = 36.3 bits (80), Expect = 0.026 Identities = 24/61 (39%), Positives = 24/61 (39%), Gaps = 1/61 (1%) Frame = -3 Query: 811 GXGGGXRXG-GXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 G GGG G G GGGG G GG GG G GG GA G G G Sbjct: 52 GAGGGASGGIGVGGGGG---GGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGR 108 Query: 634 G 632 G Sbjct: 109 G 109 Score = 36.3 bits (80), Expect = 0.026 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -1 Query: 771 GGPXXXGGGXXXXGGGQGGPXXXGGXXXG-PGGXXXXXGGXXXGGGGGXXG 622 GG GGG GGG+G GG G GG G GG GG G Sbjct: 367 GGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGG 417 Score = 36.3 bits (80), Expect = 0.026 Identities = 27/79 (34%), Positives = 28/79 (35%), Gaps = 3/79 (3%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGG--GXRXGGXGGGGXXXXGRGGXXXGGGP-GGPXXGXGGX 692 GG GG +G GG G G G GG G GG GGG GG G GG Sbjct: 449 GGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVG-GGGGIGGGAGGGVGGGVGGG 507 Query: 691 XGAXGXXXXGXGXXXXXGG 635 G G GG Sbjct: 508 VGGGVRGAVGGAVGGGVGG 526 Score = 35.9 bits (79), Expect = 0.035 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GG GGG GG GG GG G GG G GGG G G Sbjct: 479 GAGGGVGVGGGGGIGGGAGGG--VGGGVGGGVGGGVRGAVGGAVGGGVGGAG 528 Score = 35.5 bits (78), Expect = 0.046 Identities = 24/78 (30%), Positives = 25/78 (32%), Gaps = 1/78 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXG-GGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 G GG + GGG G G G G G G GG GG G GG Sbjct: 196 GSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGS 255 Query: 685 AXGXXXXGXGXXXXXGGG 632 G G GGG Sbjct: 256 GGVGASGGAGGNVGAGGG 273 Score = 35.1 bits (77), Expect = 0.061 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -1 Query: 771 GGPXXXGGGXXXXGGGQGGPXXXGGXXXGPG-GXXXXXGGXXXGGGGGXXG 622 GG G G GGG G GG G G G GG GG GG G Sbjct: 99 GGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIG 149 Score = 35.1 bits (77), Expect = 0.061 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GG G G GG GG GG G GG G GGG G G Sbjct: 135 GAGGGIGGGAGGAIGGGASGG---VGGGGKGRGGKSGGGAGGGVGGGVGAGG 183 Score = 35.1 bits (77), Expect = 0.061 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GG GG GG G G G GGG G G Sbjct: 149 GGGASGGVGGGGKGRGGKSGG-GAGGGVGGGVGAGGGAGGSVGAGGGIGSGG 199 Score = 35.1 bits (77), Expect = 0.061 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG G GGG GG G GG GG GG GG GG G Sbjct: 241 GGSGGGSVGGG-GRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVG 291 Score = 35.1 bits (77), Expect = 0.061 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 5/57 (8%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGG-----XXXXXGGXXXGGGGGXXG 622 GG G GG GGG GG GG G GG GG GGGGG G Sbjct: 256 GGVGASGGAGGNVGAGGGLGG-GVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVG 311 Score = 35.1 bits (77), Expect = 0.061 Identities = 28/83 (33%), Positives = 28/83 (33%), Gaps = 7/83 (8%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGXGGG--GXXXXGRGGXXXGGGPGGPXXG-----X 701 G GG G G G GG GG G G G GGG GG G Sbjct: 259 GASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSG 318 Query: 700 GGXXGAXGXXXXGXGXXXXXGGG 632 G GA G G G GGG Sbjct: 319 GASGGASGGASGGAGGSVGAGGG 341 Score = 35.1 bits (77), Expect = 0.061 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG G GG GG GG GG GG GG GG G Sbjct: 311 GGGGRGSGGASGGASGGASGG---AGGSVGAGGGVGGGVGGGVGGGVGGGVG 359 Score = 34.7 bits (76), Expect = 0.080 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 3/80 (3%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGG---XGGGGXXXXGRGGXXXGGGPGGPXXGXGGX 692 G GG G G G GG G GG G GG GG G GG Sbjct: 464 GRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGG 523 Query: 691 XGAXGXXXXGXGXXXXXGGG 632 G G G GGG Sbjct: 524 VGGAGRGSGGASGGAGAGGG 543 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXG----GXXXGPGGXXXXXGGXXXGGGGGXXG 622 G G GGG GGG G G G G GG GG G GGG G Sbjct: 229 GASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGG 284 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GG G GG GG GG G GG G Sbjct: 347 GGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASG 398 Score = 34.3 bits (75), Expect = 0.11 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 1/77 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGG-GGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 GG G A G GG G GG G G GG GG G G GG G Sbjct: 374 GGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVG 433 Query: 685 AXGXXXXGXGXXXXXGG 635 G GG Sbjct: 434 GGVGGGVGGAVGGAVGG 450 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G G G GG GG G G GG GG G GGG G Sbjct: 387 GASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGG 438 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GG GGG GGG G GG G GG GG G GG G Sbjct: 473 GTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGG---GVGGGVRGAVGGAVG 521 Score = 33.9 bits (74), Expect = 0.14 Identities = 25/83 (30%), Positives = 27/83 (32%), Gaps = 2/83 (2%) Frame = -1 Query: 864 GGVXKXGXXGXHXXXXXXXXXXXXGXVEXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXG 685 GG+ G G G V G GG G GGG+G GG G Sbjct: 59 GGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGG 118 Query: 684 PGGXXXXXGGXXXG--GGGGXXG 622 G GG G G GG G Sbjct: 119 GVGGGVGAGGGAGGSVGAGGGIG 141 Score = 33.9 bits (74), Expect = 0.14 Identities = 28/83 (33%), Positives = 29/83 (34%), Gaps = 6/83 (7%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXG---GGGXXXXGRGG-XXXGGGPGGPXXG--X 701 G GG G GG GG G GG G GG GGG GG G Sbjct: 224 GRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVG 283 Query: 700 GGXXGAXGXXXXGXGXXXXXGGG 632 GG G+ G G GGG Sbjct: 284 GGVGGSVGGAVGGAVGGAVGGGG 306 Score = 33.5 bits (73), Expect = 0.19 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G G GG GGG G GG GG GG GG G G Sbjct: 162 GRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGG 212 Score = 33.5 bits (73), Expect = 0.19 Identities = 22/75 (29%), Positives = 22/75 (29%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAX 680 G GG G GGG G G G GG GGG G GG G Sbjct: 337 GAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGA 396 Query: 679 GXXXXGXGXXXXXGG 635 G GG Sbjct: 397 SGGASGGASGGASGG 411 Score = 33.5 bits (73), Expect = 0.19 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXG--GGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG GGG G GG G G GG GG GG GG G Sbjct: 372 GGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGG--AGGAGGSVG 423 Score = 33.5 bits (73), Expect = 0.19 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGG--GGGXXG 622 GG GG GG GG GG G GG G GG GGG G Sbjct: 517 GGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGAGGSTGGGAAG 570 Score = 33.1 bits (72), Expect = 0.25 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = -3 Query: 817 RKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXG 638 R G G G G GG G G GGG GG G G GA G G G G Sbjct: 39 RHKHGRGSVGVGAGAGGGASGGIGVGGGGGGGGG--IGGSGGVGAGG--GVGGGAGGAIG 94 Query: 637 GG 632 GG Sbjct: 95 GG 96 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G G GG G G GG GG G GG GG GG GG G Sbjct: 45 GSVGVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGA--GGGVGGGAGGAIG 94 Score = 33.1 bits (72), Expect = 0.25 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGG-GGXXG 622 GGG GG G +GG GG G G G GGG GG G Sbjct: 94 GGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAG 145 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GG GG GG G G G GG GG G Sbjct: 141 GGGAGGAIGGG--ASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVG 190 Score = 33.1 bits (72), Expect = 0.25 Identities = 27/81 (33%), Positives = 28/81 (34%), Gaps = 5/81 (6%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXG-GXGGGGXXXXGRGGXXXGGGPGGP----XXGXGG 695 G GG + G GGG G G GGG G GG G G GG G GG Sbjct: 154 GGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGI-GSGGGGTVGAGGRGSGG 212 Query: 694 XXGAXGXXXXGXGXXXXXGGG 632 G G G GG Sbjct: 213 ASGGGGTVGAGGRGSGGASGG 233 Score = 33.1 bits (72), Expect = 0.25 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Frame = -1 Query: 786 VEXGGGGPXXXGGG-XXXXGGGQGGP--XXXGGXXXGPGGXXXXXGGXXXGGGGG 631 V GGG GGG GGG GG GG G GG GG GG G Sbjct: 336 VGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASG 390 Score = 33.1 bits (72), Expect = 0.25 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXX--GGXXXGPGGXXXXXGGXXXGG--GGGXXG 622 GGGG G GG GG GG G GG G GG GGG G Sbjct: 379 GGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGG 434 Score = 32.7 bits (71), Expect = 0.32 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GG GG GG GG G GG G GG G Sbjct: 355 GGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASG 406 Score = 32.7 bits (71), Expect = 0.32 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GG GGG GG G G GG G GG G Sbjct: 487 GGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGG 537 Score = 32.3 bits (70), Expect = 0.43 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 3/58 (5%) Frame = -1 Query: 786 VEXGGGGPXXXGGGXXXXGG--GQGGPXXXGGXXXGPGGXXXXXG-GXXXGGGGGXXG 622 V GG G GG GG G GG GG G GG G G G GGG G Sbjct: 220 VGAGGRGSGGASGGVGVGGGAGGSGGG-SVGGGGRGSGGVGASGGAGGNVGAGGGLGG 276 Score = 32.3 bits (70), Expect = 0.43 Identities = 27/84 (32%), Positives = 28/84 (33%), Gaps = 3/84 (3%) Frame = -1 Query: 864 GGVXKXGXXGXHXXXXXXXXXXXXGXVEXGGGGPXXXGGGXXXXG---GGQGGPXXXGGX 694 GGV G G + G V G GG G G GG GG GG Sbjct: 256 GGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGG--SVGGG 313 Query: 693 XXGPGGXXXXXGGXXXGGGGGXXG 622 G GG G GG GG G Sbjct: 314 GRGSGGASGGASGGASGGAGGSVG 337 Score = 32.3 bits (70), Expect = 0.43 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQ--GGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG GG GGG GG GG G G G G GGG G Sbjct: 291 GGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGG 344 Score = 32.3 bits (70), Expect = 0.43 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G G G GG GG GG G GG G GGG G Sbjct: 391 GASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGG 442 Score = 31.9 bits (69), Expect = 0.57 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXG--GGGGXXG 622 G GG G GGG+G GG G G GG G G GG G Sbjct: 143 GAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIG 196 Score = 31.1 bits (67), Expect = 0.99 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GG G G GG GG G GG G GGGG G Sbjct: 176 GGGVGAGGGAGGSVGAG-GGIGSGGGGTVGAGG----RGSGGASGGGGTVG 221 Score = 31.1 bits (67), Expect = 0.99 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = -1 Query: 777 GGGGPXXXGG-GXXXXGGGQGGPXXXGGXXXGP--GGXXXXXGGXXXGGGGGXXG 622 GGGG GG G GG G GG G GG G GG GG G Sbjct: 215 GGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVG 269 Score = 31.1 bits (67), Expect = 0.99 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGP--GGXXXXXGGXXXGGGGGXXG 622 G G GG GG GG GG G GG GG G GG G Sbjct: 314 GRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVG 367 Score = 31.1 bits (67), Expect = 0.99 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGP--GGXXXXXGGXXXGGGGGXXG 622 GG G GG GGG GG GG G GG GG G GG G Sbjct: 340 GGVGGGVGGGVGGGVGGGVGGAV--GGAVGGAVGGGGGGSVGGGGRGSGGASGG 391 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = -1 Query: 786 VEXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGG-GGXXG 622 V GG G GG G GG G GG G GGG GG G Sbjct: 378 VGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVG 433 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG GG GG G G G G GG GG GG G Sbjct: 386 GGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVG 437 Score = 30.3 bits (65), Expect = 1.7 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -1 Query: 768 GPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGG-GGXXG 622 G G G GG GG GG G GG GG GGG GG G Sbjct: 43 GRGSVGVGAGAGGGASGGIGVGGG--GGGGGGIGGSGGVGAGGGVGGGAG 90 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GG G GG GGG G G G GG GG G G G Sbjct: 494 GGAGGGVGGGVGGGVGGGVRG-AVGGAVGGGVGGAGRGSGGASGGAGAG 541 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXG-PGGXXXXXGGXXXGGGGGXXG 622 GG GG GG G GG G GG GG G GG G Sbjct: 402 GGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVG 453 Score = 29.9 bits (64), Expect = 2.3 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGP-XXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG G GG GG GG GG G GG G GG G G Sbjct: 430 GGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGG 482 Score = 29.9 bits (64), Expect = 2.3 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GG G GG G GG G GGG G Sbjct: 501 GGGVGGGVGGGVRGAVGGAVG-GGVGGAGRGSGGASGGAGAGGGAGGGVGGG 551 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 G GG G GGG GG G G G GG GGG G Sbjct: 530 GSGGASGGAGAGGGAGGGVGGGANVG---VGVGAGGSTGGGAAGGGGVG 575 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXX--GGXXXGGGGG 631 G GG GGG G GG GG G GG GG G GG Sbjct: 174 GVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGG 224 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GG GGG GG G GG GG G G GG G Sbjct: 485 GVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASG 536 Score = 29.5 bits (63), Expect = 3.0 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG G G GGG GG G G G GG GG G Sbjct: 506 GGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGGGANVGVG 557 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = -1 Query: 774 GGGPXXXGGGXXXXG-GGQGGPXXXGGXXXGPG-GXXXXXGGXXXGGGG 634 GG GG G GG G GG G G G GG GGGG Sbjct: 525 GGAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGAGGSTGGGAAGGGG 573 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 G G G G G G GG G GG G GGG G Sbjct: 43 GRGSVGVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAG 90 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG GG GGG G G G GG G GG G Sbjct: 359 GGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASG 410 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 50.4 bits (115), Expect = 2e-06 Identities = 24/51 (47%), Positives = 24/51 (47%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GGG GG GG G GG GG GGGGG G Sbjct: 78 GGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGG 128 Score = 45.6 bits (103), Expect = 4e-05 Identities = 25/62 (40%), Positives = 25/62 (40%), Gaps = 1/62 (1%) Frame = -3 Query: 814 KGXGGGXRXGGXGGGGXXXXGRGG-XXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXG 638 KG GG GG GGGG G GG GGG G G G G G G G G Sbjct: 74 KGGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGG 133 Query: 637 GG 632 G Sbjct: 134 SG 135 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GG GGG GGG GG GG GG GG GGGGG G Sbjct: 3 GKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGG---CGGGGKSGGGGGGGG 51 Score = 42.7 bits (96), Expect = 3e-04 Identities = 25/59 (42%), Positives = 26/59 (44%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 GG GG + G GGG GG GGGG G GG GGG GG G G G Sbjct: 83 GGGGGGGISGGGAGGKSGCGGGKSGGG-GGGGKNGGGCGG--GGGGKGGKSGGGSGGGG 138 Score = 41.5 bits (93), Expect = 7e-04 Identities = 25/61 (40%), Positives = 25/61 (40%) Frame = -3 Query: 814 KGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 KG GGG G G GG G GG GGG GG GG G G G GG Sbjct: 82 KGGGGGGGISGGGAGGKSGCG-GGKSGGGGGGGK---NGGGCGGGGGGKGGKSGGGSGGG 137 Query: 634 G 632 G Sbjct: 138 G 138 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/58 (41%), Positives = 24/58 (41%) Frame = -3 Query: 850 GGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXG 677 GG KG GGG GG GGGG G G GGG G G GG A G Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGG--GGGAKGGCGGGGKSGGGGGGGGYMVAPG 57 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 G GGG G GGG G GG GGG GG G GG G G G GG Sbjct: 81 GKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNG-GGCGGGGGGKGGKSGGGSGGGG 138 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/52 (42%), Positives = 23/52 (44%) Frame = -3 Query: 787 GGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 GG GG G G+GG GGG G G GG GA G G GGG Sbjct: 2 GGKGGSGSGGGGKGG---GGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGG 50 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/56 (42%), Positives = 24/56 (42%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXG 638 G G GG GGGG G GG GGG GG G GG G G G G G Sbjct: 6 GSGSGGGGKGGGG---GGSGGGRGGGGGGGAKGGCGG-GGKSGGGGGGGGYMVAPG 57 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGG 716 GG G G GG R GG GGG G GG GGG GG Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGG 50 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/60 (38%), Positives = 26/60 (43%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG + G GGG GG GGGG G+GG GG GG G G+ Sbjct: 92 GGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGG---GKGGKSGGGSGGGGYMVAPGSNGS 148 Score = 38.3 bits (85), Expect = 0.007 Identities = 25/77 (32%), Positives = 26/77 (33%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG +GG R G GGG GG GGGG G GG PG Sbjct: 11 GGGKGGGGGGSGG-GRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRSSYISRDNF 69 Query: 682 XGXXXXGXGXXXXXGGG 632 G G GGG Sbjct: 70 ESDPKGGSGGGGKGGGG 86 Score = 37.5 bits (83), Expect = 0.011 Identities = 22/51 (43%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = -1 Query: 777 GGGGPXXXG-GGXXXXGGGQGGPXXXGGXXXGP-GGXXXXXGGXXXGGGGG 631 GGGG G GG GGG+ G GG G GG GG GG GG Sbjct: 86 GGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGG 136 Score = 37.1 bits (82), Expect = 0.015 Identities = 22/62 (35%), Positives = 24/62 (38%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG +GG G G G GGGG G+ G GGG GG GG G Sbjct: 79 GGGKGGGGGGGISGGGAGGKSGCGGGKSGGGG--GGGKNGGGCGGGGGGKGGKSGGGSGG 136 Query: 682 XG 677 G Sbjct: 137 GG 138 Score = 31.1 bits (67), Expect = 0.99 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = -2 Query: 800 GXAGGWXXGGGXPXXGEGGXXXXXXXXXXXXXXXGXXGGXGXXXXGXGGGXXXGGGGVXG 621 G GG GGG GG G G G G GGG GG G Sbjct: 76 GSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSG 135 Query: 620 XXXYMI 603 YM+ Sbjct: 136 GGGYMV 141 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXG 658 GGGG GGG GGG GG G G GG G Sbjct: 108 GGGGGGKNGGGC---GGGGGGKGGKSGGGSGGGGYMVAPG 144 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 50.0 bits (114), Expect = 2e-06 Identities = 27/77 (35%), Positives = 27/77 (35%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P PP PP PP PP P PPP P PPP P Sbjct: 99 PPPPVNLSPPPPPVNLSPP--PPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPP 156 Query: 813 FLAHXXXGXXXPPSXPP 863 L P PP Sbjct: 157 VLFSPPPPTVTRPPPPP 173 Score = 46.4 bits (105), Expect = 2e-05 Identities = 23/58 (39%), Positives = 23/58 (39%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P PP PP PP PP P PPPP R PPP Sbjct: 126 PPPPVLLSPPPPPVNLSPP--PPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPP 181 Score = 45.6 bits (103), Expect = 4e-05 Identities = 24/77 (31%), Positives = 26/77 (33%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P +P PP PP P PP P PPPP PPP Sbjct: 62 PPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPV 121 Query: 813 FLAHXXXGXXXPPSXPP 863 L+ P PP Sbjct: 122 LLSPPPPPVLLSPPPPP 138 Score = 45.2 bits (102), Expect = 6e-05 Identities = 24/77 (31%), Positives = 26/77 (33%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P +P PP PP P PP P PPPP PPP Sbjct: 71 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPV 130 Query: 813 FLAHXXXGXXXPPSXPP 863 L+ P PP Sbjct: 131 LLSPPPPPVNLSPPPPP 147 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/77 (33%), Positives = 27/77 (35%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P PP PP PP PP P PPP PP PP P Sbjct: 108 PPPPVNLSPPPPPVLLSPP--PPPVLLSPPPPPVNLSPPPPPVLLSPPP-PPVLFSPPPP 164 Query: 813 FLAHXXXGXXXPPSXPP 863 + S PP Sbjct: 165 TVTRPPPPPTITRSPPP 181 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/77 (31%), Positives = 26/77 (33%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P +P PP PP P PP P PPPP PPP Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPV 103 Query: 813 FLAHXXXGXXXPPSXPP 863 L+ P PP Sbjct: 104 NLSPPPPPVNLSPPPPP 120 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/77 (32%), Positives = 27/77 (35%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P +P PP PP P PP P PPPP PPP Sbjct: 54 PPPPVNLSPPPPPVN-LSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPV 112 Query: 813 FLAHXXXGXXXPPSXPP 863 L+ P PP Sbjct: 113 NLSPPPPPVLLSPPPPP 129 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/62 (37%), Positives = 24/62 (38%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P +P PP PP P PP P PPPP P PPP P Sbjct: 89 PPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPP-PVNLSPPPPP 147 Query: 813 FL 818 L Sbjct: 148 VL 149 Score = 44.0 bits (99), Expect = 1e-04 Identities = 25/77 (32%), Positives = 27/77 (35%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P +P PP PP P PP P PPPP PPP Sbjct: 81 PPPPVNLSPPPPPVL-LSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPV 139 Query: 813 FLAHXXXGXXXPPSXPP 863 L+ P PP Sbjct: 140 NLSPPPPPVLLSPPPPP 156 Score = 42.7 bits (96), Expect = 3e-04 Identities = 22/69 (31%), Positives = 24/69 (34%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXG 836 P P +P PP PP P PP P PPPP PPP L+ Sbjct: 34 PEPAPLVDLSPPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 93 Query: 837 XXXPPSXPP 863 P PP Sbjct: 94 VLLSPPPPP 102 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/61 (34%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +3 Query: 684 APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF-LAHXXXGXXXPPSXP 860 AP P PP PP P P PPP P PPP P L+ P P Sbjct: 33 APEPAPLVDLSPPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPP 92 Query: 861 P 863 P Sbjct: 93 P 93 Score = 36.7 bits (81), Expect = 0.020 Identities = 25/79 (31%), Positives = 27/79 (34%), Gaps = 2/79 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXX--XXPPPPXPPXRXPPP 806 P P P P +P PP PP PP PP P PPPP PPP Sbjct: 36 PAPLVDLSPPPPPVNISSP--PPPVNLSPPPPPVNLSPPPPPVNLSPPPPPV-NLSPPPP 92 Query: 807 XPFLAHXXXGXXXPPSXPP 863 L+ P PP Sbjct: 93 PVLLSPPPPPVNLSPPPPP 111 Score = 35.9 bits (79), Expect = 0.035 Identities = 19/49 (38%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = +1 Query: 628 TPPPPX-XXPPPXPXXXXPXPP-----XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P P PP PP +P PP PP P Sbjct: 53 SPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPP 101 Score = 35.1 bits (77), Expect = 0.061 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 7/50 (14%) Frame = +1 Query: 628 TPPPPX--XXPPPXPXXXXPXPP-----XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P P PP PP +P PP PP P Sbjct: 79 SPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPP 128 Score = 35.1 bits (77), Expect = 0.061 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 7/50 (14%) Frame = +1 Query: 628 TPPPPX--XXPPPXPXXXXPXPP-----XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P P PP PP +P PP PP P Sbjct: 106 SPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPP 155 Score = 34.7 bits (76), Expect = 0.080 Identities = 23/77 (29%), Positives = 23/77 (29%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P PP PP P P PPP PPP P Sbjct: 153 PPPPVLFSPPPPTVT--RPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPP 210 Query: 813 FLAHXXXGXXXPPSXPP 863 PP PP Sbjct: 211 PPQAARSYKRSPPPPPP 227 Score = 33.5 bits (73), Expect = 0.19 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 7/50 (14%) Frame = +1 Query: 628 TPPPPX--XXPPPXPXXXXPXPP-----XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P P PP PP R P P PP P Sbjct: 133 SPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPP 182 Score = 33.1 bits (72), Expect = 0.25 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXX--PPXXXRAPLAPPPXXXPPSP 756 PPP PPP P P PP P L+PPP SP Sbjct: 73 PPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSP 116 Score = 32.7 bits (71), Expect = 0.32 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXX--PPXXXRAPLAPPPXXXPPSP 756 PPP PPP P P PP P L+PPP SP Sbjct: 64 PPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSP 107 Score = 32.7 bits (71), Expect = 0.32 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXX--PPXXXRAPLAPPPXXXPPSP 756 PPP PPP P P PP P L+PPP SP Sbjct: 100 PPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSP 143 Score = 32.3 bits (70), Expect = 0.43 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXX--PPXXXRAPLAPPPXXXPPSP 756 PPP PPP P P PP P L+PPP SP Sbjct: 91 PPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSP 134 Score = 32.3 bits (70), Expect = 0.43 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXX--PPXXXRAPLAPPPXX---XPPSP 756 PPP PPP P P PP P L+PPP PP P Sbjct: 118 PPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPP 164 Score = 31.9 bits (69), Expect = 0.57 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 6/48 (12%) Frame = +1 Query: 631 PPPPX--XXPPPXPXXXXPXPP----XXPPXXXRAPLAPPPXXXPPSP 756 PPPP PPP P PP PP +P PP PP P Sbjct: 45 PPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPP 92 Score = 31.9 bits (69), Expect = 0.57 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 6/48 (12%) Frame = +1 Query: 631 PPPPX--XXPPPXPXXXXPXPP----XXPPXXXRAPLAPPPXXXPPSP 756 PPPP PPP P PP PP +P PP PP P Sbjct: 63 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPP 110 Score = 31.9 bits (69), Expect = 0.57 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 6/48 (12%) Frame = +1 Query: 631 PPPPX--XXPPPXPXXXXPXPP----XXPPXXXRAPLAPPPXXXPPSP 756 PPPP PPP P PP PP +P PP PP P Sbjct: 72 PPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPP 119 Score = 31.9 bits (69), Expect = 0.57 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 6/48 (12%) Frame = +1 Query: 631 PPPPX--XXPPPXPXXXXPXPP----XXPPXXXRAPLAPPPXXXPPSP 756 PPPP PPP P PP PP +P PP PP P Sbjct: 90 PPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPP 137 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 628 TPPPPX-XXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 +PPPP PPP P PP P PPP Sbjct: 160 SPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPP 196 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P PP PPP PPPP R P P Sbjct: 179 PPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPPSKYGRVYSPPP 238 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 6/48 (12%) Frame = +1 Query: 631 PPPPXXXPPPXP--XXXXPXP----PXXPPXXXRAPLAPPPXXXPPSP 756 PPP PPP P P P P PP P PP PP P Sbjct: 127 PPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPP--PPTVTRPPPP 172 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 49.6 bits (113), Expect = 3e-06 Identities = 29/84 (34%), Positives = 31/84 (36%), Gaps = 8/84 (9%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPP-----PXPP 788 PPP P P P P PP P PP P PP P PPP P PP Sbjct: 53 PPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPP 112 Query: 789 XRXPPPXPFLAHXXXGXXXPPSXP 860 + PPP P+ H P P Sbjct: 113 VKSPPP-PYYYHSPPPPVKSPPPP 135 Score = 49.2 bits (112), Expect = 3e-06 Identities = 29/84 (34%), Positives = 31/84 (36%), Gaps = 8/84 (9%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAP---XXPPXPXXGPPGPPPXXXPPLPXXXXPPP-----PXPP 788 PPP P P P P PP P PP P PP P PPP P PP Sbjct: 37 PPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPP 96 Query: 789 XRXPPPXPFLAHXXXGXXXPPSXP 860 + PPP P+ H P P Sbjct: 97 VKSPPP-PYYYHSPPPPVKSPPPP 119 Score = 49.2 bits (112), Expect = 3e-06 Identities = 29/84 (34%), Positives = 31/84 (36%), Gaps = 8/84 (9%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAP---XXPPXPXXGPPGPPPXXXPPLPXXXXPPP-----PXPP 788 PPP P P P P PP P PP P PP P PPP P PP Sbjct: 69 PPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPP 128 Query: 789 XRXPPPXPFLAHXXXGXXXPPSXP 860 + PPP P+ H P P Sbjct: 129 VKSPPP-PYYYHSPPPPVKSPPPP 151 Score = 49.2 bits (112), Expect = 3e-06 Identities = 29/84 (34%), Positives = 31/84 (36%), Gaps = 8/84 (9%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPP-----PXPP 788 PPP P P P P PP P PP P PP P PPP P PP Sbjct: 85 PPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPP 144 Query: 789 XRXPPPXPFLAHXXXGXXXPPSXP 860 + PPP P+ H P P Sbjct: 145 VKSPPP-PYYYHSPPPPVKSPPPP 167 Score = 49.2 bits (112), Expect = 3e-06 Identities = 29/84 (34%), Positives = 31/84 (36%), Gaps = 8/84 (9%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPP-----PXPP 788 PPP P P P P PP P PP P PP P PPP P PP Sbjct: 101 PPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPP 160 Query: 789 XRXPPPXPFLAHXXXGXXXPPSXP 860 + PPP P+ H P P Sbjct: 161 VKSPPP-PYYYHSPPPPVKSPPPP 183 Score = 47.2 bits (107), Expect = 1e-05 Identities = 25/70 (35%), Positives = 28/70 (40%), Gaps = 8/70 (11%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPP-----PXPP 788 PPP P P P P PP P PP P PP P PPP P PP Sbjct: 133 PPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPP 192 Query: 789 XRXPPPXPFL 818 + PPP ++ Sbjct: 193 VKSPPPPVYI 202 Score = 42.7 bits (96), Expect = 3e-04 Identities = 25/77 (32%), Positives = 27/77 (35%), Gaps = 2/77 (2%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 H PPP P P P PP P PPP PP P PPP P P Sbjct: 123 HSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP-PVKSPP 181 Query: 801 PPXPFLAHXXXGXXXPP 851 PP + + PP Sbjct: 182 PPYLYSSPPPPVKSPPP 198 Score = 42.3 bits (95), Expect = 4e-04 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 H PPP P P P PP P PPP PP P PPP P P Sbjct: 75 HSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP-PVKSPP 133 Query: 801 PP 806 PP Sbjct: 134 PP 135 Score = 42.3 bits (95), Expect = 4e-04 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 H PPP P P P PP P PPP PP P PPP P P Sbjct: 107 HSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP-PVKSPP 165 Query: 801 PP 806 PP Sbjct: 166 PP 167 Score = 42.3 bits (95), Expect = 4e-04 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 H PPP P P P PP P PPP PP P PPP P P Sbjct: 139 HSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPP-PVKSPP 197 Query: 801 PP 806 PP Sbjct: 198 PP 199 Score = 41.9 bits (94), Expect = 5e-04 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 3/61 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P P PP P PP PP P P PPPP PP Sbjct: 149 PPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPP-PPYLYSSPPPPVKSPPPPVYIYASPP 207 Query: 804 P 806 P Sbjct: 208 P 208 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP-XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P PP PP PPP PP P Sbjct: 44 SPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPP 87 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP-XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P PP PP PPP PP P Sbjct: 60 SPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPP 103 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/55 (36%), Positives = 22/55 (40%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXP 860 PP P PPP PP P PP PP + PPP P+ H P P Sbjct: 36 PPPPYEYKSPPPPVKSPPPPYEYKSPP--PPVKSPPP-PYYYHSPPPPVKSPPPP 87 Score = 37.1 bits (82), Expect = 0.015 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXP 785 H PPP P P P PP P PPP PP P PP P Sbjct: 155 HSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPPVKSPPPPVYIYASPPPP 209 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX---PPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP ++P P PP P Sbjct: 51 SPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPP 96 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX---PPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP ++P P PP P Sbjct: 35 SPPPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPP 80 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX---PPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP ++P P PP P Sbjct: 83 SPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPP 128 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPP--XXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P P PP PPP PP P Sbjct: 156 SPPPPVK-SPPPPYYYHSPPPPVKSPPPPYLYSSPPPPVKSPPPP 199 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 T P PPP P PP P +PPP P P Sbjct: 28 TEPYYYSSPPPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPP 70 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 49.2 bits (112), Expect = 3e-06 Identities = 28/81 (34%), Positives = 30/81 (37%), Gaps = 5/81 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXX----GPPGPPPXXXPPLPXXXXPPPPXPPXR-X 797 PPP P P P P PP G P PPP + PPPP PP R Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQ 101 Query: 798 PPPXPFLAHXXXGXXXPPSXP 860 PPP P + PP P Sbjct: 102 PPPKPPQKNLPRRHPPPPRSP 122 Score = 42.7 bits (96), Expect = 3e-04 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 7/63 (11%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXR-------XPPPXPFLAHXXXGXXXPPS 854 PP PP PPP PP P PPPP P PPP P PP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPP 94 Query: 855 XPP 863 PP Sbjct: 95 QPP 97 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P +PPPP PPP P P PP P PP PP P Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPP---PPPP 80 Score = 36.3 bits (80), Expect = 0.026 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXP----XPPXXPPXXXR-APLAPPPXXXPP 750 P PPPP PPP P PP PP PL+ PP PP Sbjct: 50 PPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPP 97 Score = 35.9 bits (79), Expect = 0.035 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +1 Query: 607 IYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 ++ P PPPP PPP P P PP PPP Sbjct: 37 LFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 Score = 31.1 bits (67), Expect = 0.99 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 6/51 (11%) Frame = +1 Query: 622 PXTPPP------PXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP P PPP PP PP PPP P P Sbjct: 75 PPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPPQKNLPRRHPPPPRSPEKP 125 Score = 29.1 bits (62), Expect = 4.0 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXR 794 PPP P P P PP P PP PP P PPPP P + Sbjct: 77 PPPPVTDMIKPLSSPP--PPQPP-PRSQPPPKPPQKNLP---RRHPPPPRSPEK 124 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Frame = +3 Query: 663 PXXXXPXAPXXPPXPXXGPPGPPP-XXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P P PP PPP PP P P PP P P Sbjct: 75 PPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPPQKNLPRRHPPPPRSPEKP 125 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 48.8 bits (111), Expect = 5e-06 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P P PP PP PP P P PP P PPP P Sbjct: 80 PPPTVASSPPPPVVIASPP--PSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKP 137 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/77 (29%), Positives = 24/77 (31%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P PP P P PP PP P PPP PPP Sbjct: 35 PPPVTPPPSPPQSPPPVVSSSPPPPVVSSP-PPSSSPPPSPPVITSPPPTVASSPPPPVV 93 Query: 813 FLAHXXXGXXXPPSXPP 863 + P PP Sbjct: 94 IASPPPSTPATTPPAPP 110 Score = 42.3 bits (95), Expect = 4e-04 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 3/61 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP---PXPPXRXPP 803 PPP P P PP PP P PP P PPP P PP P Sbjct: 88 PPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPS 147 Query: 804 P 806 P Sbjct: 148 P 148 Score = 41.9 bits (94), Expect = 5e-04 Identities = 24/79 (30%), Positives = 26/79 (32%), Gaps = 2/79 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXP-PPPXPPXRXP-PP 806 PPP P +P PP PP P PP P P P PP P PP Sbjct: 97 PPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPP 156 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P + P PP Sbjct: 157 KPSPSTPTPTTTTSPPPPP 175 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/80 (30%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP PP PP PP PPPP PP Sbjct: 40 PPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPP 99 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P PP Sbjct: 100 STPATTPPAPPQTVSPPPPP 119 Score = 39.5 bits (88), Expect = 0.003 Identities = 26/81 (32%), Positives = 26/81 (32%), Gaps = 5/81 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPP---GPPPXXX--PPLPXXXXPPPPXPPXRX 797 PPP P P P P P PP PPP PP P PPP P Sbjct: 48 PPPVVSSSPPPPVVSSPPPSSSPPP--SPPVITSPPPTVASSPPPPVVIASPPPSTPATT 105 Query: 798 PPPXPFLAHXXXGXXXPPSXP 860 PP P PS P Sbjct: 106 PPAPPQTVSPPPPPDASPSPP 126 Score = 37.5 bits (83), Expect = 0.011 Identities = 22/75 (29%), Positives = 24/75 (32%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 PP P AP P PPP PP P P P P PP P Sbjct: 5 PPLPILSPPSSNSSTTAPPPLQTQPTTPSAPPPVTPPPSP----PQSPPPVVSSSPPPPV 60 Query: 816 LAHXXXGXXXPPSXP 860 ++ PPS P Sbjct: 61 VSSPPPSSSPPPSPP 75 Score = 37.5 bits (83), Expect = 0.011 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPXRXPPP 806 PP P P P P P P PP P P P PPP P PP Sbjct: 125 PPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPP 182 Score = 35.9 bits (79), Expect = 0.035 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP--XXXPPSP 756 P +PPP PP P P P PP +PPP PP P Sbjct: 45 PQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPP 91 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P P P PP PP P P P PPPP P P Sbjct: 128 PTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNP 186 Score = 34.7 bits (76), Expect = 0.080 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPP 750 P TPPP PP P PP PP P +PP PP Sbjct: 37 PVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPP 81 Score = 33.1 bits (72), Expect = 0.25 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P TP P PP P PP P + LAPPP P P Sbjct: 160 PSTPTPTTTTSPPPPPATSASPPSSNPTDP-STLAPPPTPLPVVP 203 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPP PP P PP P P APP PP P Sbjct: 79 SPPPTVASSPPPPVVIASPPPSTP---ATTPPAPPQTVSPPPP 118 Score = 32.3 bits (70), Expect = 0.43 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 5/65 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP-----XPPXRX 797 PP P P PP P P P PP P PP P Sbjct: 134 PPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLA 193 Query: 798 PPPXP 812 PPP P Sbjct: 194 PPPTP 198 Score = 31.9 bits (69), Expect = 0.57 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 P P P PPP P P PP +P P P P+ Sbjct: 123 PSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPT 166 Score = 31.5 bits (68), Expect = 0.75 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +1 Query: 622 PXTP--PPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P TP PPP PP P P PP + +PPP PP Sbjct: 29 PTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVS--SPPPSSSPP 71 Score = 31.5 bits (68), Expect = 0.75 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PP P PP +PPP SP Sbjct: 55 SPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASP 97 Score = 31.1 bits (67), Expect = 0.99 Identities = 15/45 (33%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPX--XXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PP P P P P P P PP P Sbjct: 114 SPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKP 158 Score = 31.1 bits (67), Expect = 0.99 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +1 Query: 631 PPPPXXXP-PPXPXXXXPXP--PXXPPXXXRAPLAPPPXXXPPSP 756 PPPP P PP P P P PP +P P PSP Sbjct: 116 PPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSP 160 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = +1 Query: 628 TPPP--PXXXPPPXPXXXXPXPPXXPPXXXRAPLA--PPPXXXPPSP 756 +PPP P PP P P PP AP PPP P P Sbjct: 96 SPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPP 142 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 5/46 (10%) Frame = +1 Query: 628 TPPPPXXXPP-----PXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 T PPP P P P P PP PP + PP PP Sbjct: 20 TAPPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPP 65 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 6/49 (12%) Frame = +1 Query: 628 TPPPPXXX---PPPXPXXXXPXPPXX---PPXXXRAPLAPPPXXXPPSP 756 +PPPP PP P P PP PP +P P P P P Sbjct: 87 SPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPP 135 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/47 (31%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXP----PXXPPXXXRAPLAPPPXXXPPSP 756 +PPP PP P P P PP +P P PP+P Sbjct: 63 SPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAP 109 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXR-APLAPPP--XXXPPSP 756 T PPP P P P P PP P + +P P P PP P Sbjct: 131 TNPPPK--PSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPP 174 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 48.8 bits (111), Expect = 5e-06 Identities = 28/70 (40%), Positives = 29/70 (41%), Gaps = 1/70 (1%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXX-GPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXX 833 P P P P PP P PP PP PP P PP P PP + PPP P Sbjct: 1063 PLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQ-PPPPPL------ 1115 Query: 834 GXXXPPSXPP 863 PPS PP Sbjct: 1116 --SPPPSPPP 1123 Score = 48.4 bits (110), Expect = 6e-06 Identities = 26/64 (40%), Positives = 27/64 (42%), Gaps = 5/64 (7%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXP--PXPXXG-PPGPPPXXXPPLPXXXXPPPPXP--PXRXP 800 PP P P P +P P P P PP PP PPLP PPP P P P Sbjct: 1062 PPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSP 1121 Query: 801 PPXP 812 PP P Sbjct: 1122 PPPP 1125 Score = 48.0 bits (109), Expect = 8e-06 Identities = 26/62 (41%), Positives = 26/62 (41%), Gaps = 4/62 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXG--PPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 PPP P P P P PP P PP PPP PP P PP P PP P Sbjct: 1069 PPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPP--PP 1126 Query: 801 PP 806 PP Sbjct: 1127 PP 1128 Score = 45.2 bits (102), Expect = 6e-05 Identities = 20/46 (43%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPP-PPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P +PP PP PPP P P P P PL+PPP PP P Sbjct: 1081 PPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPP 1126 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PP P PPP P P PP PL PPP PP P Sbjct: 1070 PPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPP 1114 Score = 36.7 bits (81), Expect = 0.020 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRA-PLAPPPXXXPPSP 756 +PP P PPP P PP PP + P PP PP P Sbjct: 1061 SPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLP 1104 Score = 34.7 bits (76), Expect = 0.080 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +1 Query: 631 PPPPXXXPP-PXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 PPP PP P P P PP PP +PPP PPS Sbjct: 1094 PPPAALFPPLPPPPSQPPPPPLSPPP------SPPPPPPPPS 1129 Score = 31.9 bits (69), Expect = 0.57 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPP 702 P PPP PPP P PP PP Sbjct: 1102 PLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 48.8 bits (111), Expect = 5e-06 Identities = 27/82 (32%), Positives = 29/82 (35%), Gaps = 5/82 (6%) Frame = +3 Query: 633 PPPXXXXXPX----PXXXXPXAPXXPPXPXXGPPG-PPPXXXPPLPXXXXPPPPXPPXRX 797 PPP P P P P P P PP PPP PP P PP PP Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVAT 110 Query: 798 PPPXPFLAHXXXGXXXPPSXPP 863 PPP P + P+ P Sbjct: 111 PPPAPLASPPAQVPAPAPTTKP 132 Score = 43.2 bits (97), Expect = 2e-04 Identities = 26/79 (32%), Positives = 28/79 (35%), Gaps = 2/79 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPP--GPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 P P P P P PP PP PP PP P PPP PP PP Sbjct: 31 PAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPP-PPVSSPPPASPPPATPP- 88 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P + PP+ PP Sbjct: 89 -PVASPPPPVASPPPATPP 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 25/66 (37%), Positives = 26/66 (39%), Gaps = 4/66 (6%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPG--PPPXXXPPLPXXXXPPP--PXPPXRXPPPXPFLAHXXXGXXX 845 P A PP P PP PPP PP P PPP PP PPP Sbjct: 27 PTATPAPPTPTTPPPAATPPPVSAPP-PVTTSPPPVTTAPPPANPPPP---VSSPPPASP 82 Query: 846 PPSXPP 863 PP+ PP Sbjct: 83 PPATPP 88 Score = 39.9 bits (89), Expect = 0.002 Identities = 26/79 (32%), Positives = 28/79 (35%), Gaps = 2/79 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPP--GPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P PP PP PPP P P PP PP PPP Sbjct: 39 PPPAAT--PPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSP-PPASPPPATPPPVASPPP 95 Query: 807 XPFLAHXXXGXXXPPSXPP 863 +A P + PP Sbjct: 96 P--VASPPPATPPPVATPP 112 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = +1 Query: 622 PXTPPPPXXXPPP-XPXXXXPXPPXXPPXXXRA--PLAPPPXXXPP 750 P PPPP PPP P P P PP + P PPP PP Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPP 112 Score = 36.7 bits (81), Expect = 0.020 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P PPP PPP P PP P++ PP PP Sbjct: 41 PAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPP 83 Score = 36.7 bits (81), Expect = 0.020 Identities = 27/83 (32%), Positives = 28/83 (33%), Gaps = 6/83 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPP--LPXXXXPPPP----XPPXR 794 PPP P P P A P P PPP PP P PPP PP + Sbjct: 65 PPPANP--PPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQ 122 Query: 795 XPPPXPFLAHXXXGXXXPPSXPP 863 P P P P S PP Sbjct: 123 VPAPAP-TTKPDSPSPSPSSSPP 144 Score = 36.3 bits (80), Expect = 0.026 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P + PPP PP P P P PP P A PP PP Sbjct: 47 PVSAPPPVTTSPP-PVTTAPPPANPPPPVSSPPPASPPPATPP 88 Score = 35.9 bits (79), Expect = 0.035 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP-PSP 756 P PPP PPP P P APLA PP P P+P Sbjct: 83 PPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAP 128 Score = 35.5 bits (78), Expect = 0.046 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P T PP P P P P PP P PPP PP P Sbjct: 53 PVTTSPPPVTTAP-PPANPPPPVSSPPPASPPPATPPPVASPPPP 96 Score = 35.1 bits (77), Expect = 0.061 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX-APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPX 809 PPP P P P P P P P P PPLP P P P P Sbjct: 105 PPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPLPSSDAPGPSTDSI-SPAPS 163 Query: 810 P 812 P Sbjct: 164 P 164 Score = 34.7 bits (76), Expect = 0.080 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 T PPP PPP PP P +P PPP PP Sbjct: 63 TAPPPANPPPPVSSPPPASPPPATPPPVASP--PPPVASPP 101 Score = 33.5 bits (73), Expect = 0.19 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P P PP P P P P PP P Sbjct: 87 PPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPLP 146 Score = 33.1 bits (72), Expect = 0.25 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPP-SXPP 863 P P P PP PP P PP PP P P PP S PP Sbjct: 23 PTSPPTATPAPPTPTTPP-PAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPP 78 Score = 32.7 bits (71), Expect = 0.32 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXP--XPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP PPP P P P P +P +P P PP P Sbjct: 101 PPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSP-SPSPSSSPPLP 146 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAP---LAPPPXXXPP 750 TP PP PP P P PP P APPP PP Sbjct: 30 TPAPPTPTTPP-PAATPPPVSAPPPVTTSPPPVTTAPPPANPPP 72 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAP---LAPPPXXXPPSP 756 T PP PP P P P PP P +PPP P P Sbjct: 24 TSPPTATPAPPTPTT--PPPAATPPPVSAPPPVTTSPPPVTTAPPP 67 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 48.8 bits (111), Expect = 5e-06 Identities = 27/82 (32%), Positives = 29/82 (35%), Gaps = 5/82 (6%) Frame = +3 Query: 633 PPPXXXXXPX----PXXXXPXAPXXPPXPXXGPPG-PPPXXXPPLPXXXXPPPPXPPXRX 797 PPP P P P P P P PP PPP PP P PP PP Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVAT 110 Query: 798 PPPXPFLAHXXXGXXXPPSXPP 863 PPP P + P+ P Sbjct: 111 PPPAPLASPPAQVPAPAPTTKP 132 Score = 43.2 bits (97), Expect = 2e-04 Identities = 26/79 (32%), Positives = 28/79 (35%), Gaps = 2/79 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPP--GPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 P P P P P PP PP PP PP P PPP PP PP Sbjct: 31 PAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPP-PPVSSPPPASPPPATPP- 88 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P + PP+ PP Sbjct: 89 -PVASPPPPVASPPPATPP 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 25/66 (37%), Positives = 26/66 (39%), Gaps = 4/66 (6%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPG--PPPXXXPPLPXXXXPPP--PXPPXRXPPPXPFLAHXXXGXXX 845 P A PP P PP PPP PP P PPP PP PPP Sbjct: 27 PTATPAPPTPTTPPPAATPPPVSAPP-PVTTSPPPVTTAPPPANPPPP---VSSPPPASP 82 Query: 846 PPSXPP 863 PP+ PP Sbjct: 83 PPATPP 88 Score = 39.9 bits (89), Expect = 0.002 Identities = 26/79 (32%), Positives = 28/79 (35%), Gaps = 2/79 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPP--GPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P PP PP PPP P P PP PP PPP Sbjct: 39 PPPAAT--PPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSP-PPASPPPATPPPVASPPP 95 Query: 807 XPFLAHXXXGXXXPPSXPP 863 +A P + PP Sbjct: 96 P--VASPPPATPPPVATPP 112 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = +1 Query: 622 PXTPPPPXXXPPP-XPXXXXPXPPXXPPXXXRA--PLAPPPXXXPP 750 P PPPP PPP P P P PP + P PPP PP Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPP 112 Score = 36.7 bits (81), Expect = 0.020 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P PPP PPP P PP P++ PP PP Sbjct: 41 PAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPP 83 Score = 36.7 bits (81), Expect = 0.020 Identities = 27/83 (32%), Positives = 28/83 (33%), Gaps = 6/83 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPP--LPXXXXPPPP----XPPXR 794 PPP P P P A P P PPP PP P PPP PP + Sbjct: 65 PPPANP--PPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQ 122 Query: 795 XPPPXPFLAHXXXGXXXPPSXPP 863 P P P P S PP Sbjct: 123 VPAPAP-TTKPDSPSPSPSSSPP 144 Score = 36.3 bits (80), Expect = 0.026 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P + PPP PP P P P PP P A PP PP Sbjct: 47 PVSAPPPVTTSPP-PVTTAPPPANPPPPVSSPPPASPPPATPP 88 Score = 35.9 bits (79), Expect = 0.035 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP-PSP 756 P PPP PPP P P APLA PP P P+P Sbjct: 83 PPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAP 128 Score = 35.5 bits (78), Expect = 0.046 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P T PP P P P P PP P PPP PP P Sbjct: 53 PVTTSPPPVTTAP-PPANPPPPVSSPPPASPPPATPPPVASPPPP 96 Score = 35.1 bits (77), Expect = 0.061 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX-APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPX 809 PPP P P P P P P P P PPLP P P P P Sbjct: 105 PPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPLPSSDAPGPSTDSI-SPAPS 163 Query: 810 P 812 P Sbjct: 164 P 164 Score = 34.7 bits (76), Expect = 0.080 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 T PPP PPP PP P +P PPP PP Sbjct: 63 TAPPPANPPPPVSSPPPASPPPATPPPVASP--PPPVASPP 101 Score = 33.5 bits (73), Expect = 0.19 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P P PP P P P P PP P Sbjct: 87 PPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPLP 146 Score = 33.1 bits (72), Expect = 0.25 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPP-SXPP 863 P P P PP PP P PP PP P P PP S PP Sbjct: 23 PTSPPTATPAPPTPTTPP-PAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPP 78 Score = 32.7 bits (71), Expect = 0.32 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXP--XPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP PPP P P P P +P +P P PP P Sbjct: 101 PPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSP-SPSPSSSPPLP 146 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAP---LAPPPXXXPP 750 TP PP PP P P PP P APPP PP Sbjct: 30 TPAPPTPTTPP-PAATPPPVSAPPPVTTSPPPVTTAPPPANPPP 72 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAP---LAPPPXXXPPSP 756 T PP PP P P P PP P +PPP P P Sbjct: 24 TSPPTATPAPPTPTT--PPPAATPPPVSAPPPVTTSPPPVTTAPPP 67 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 48.4 bits (110), Expect = 6e-06 Identities = 28/78 (35%), Positives = 32/78 (41%), Gaps = 1/78 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXG-GXXG 686 GG +GG + GGG + GG GGGG G+ G GGGP G G G G Sbjct: 320 GGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMG-GGGGGPNGNKGGGGVQMNG 378 Query: 685 AXGXXXXGXGXXXXXGGG 632 G G GGG Sbjct: 379 GPNGGKKGGGGGGGGGGG 396 Score = 41.9 bits (94), Expect = 5e-04 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGP-XXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGGP GG GG G GG G GG G GGGGG G Sbjct: 315 GGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNG 367 Score = 40.3 bits (90), Expect = 0.002 Identities = 28/78 (35%), Positives = 30/78 (38%), Gaps = 2/78 (2%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXG--RGGXXXGGGPGGPXXGXGGXXG 686 G +GG P + G GGG G GGGG G GG GGG GG G G G Sbjct: 345 GGKGGGGHPLD--GKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGG--GGGGPMSG 400 Query: 685 AXGXXXXGXGXXXXXGGG 632 G GGG Sbjct: 401 GLPPGFRPMGGGGGGGGG 418 Score = 38.7 bits (86), Expect = 0.005 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 5/57 (8%) Frame = -1 Query: 777 GGGGPXXX--GGGXXXXGGGQGGPXXXGGXXXGPGGXXXXX---GGXXXGGGGGXXG 622 GGGGP GGG GG GG GG G GG G GGGGG G Sbjct: 361 GGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGGG 417 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = -3 Query: 799 GXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 G + GG GGGG +G GGG GG G GG G Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 36.7 bits (81), Expect = 0.020 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 8/59 (13%) Frame = -1 Query: 774 GGGPXXXGGGXXXXG--------GGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGP GG G GG GGP GG GPGG G GGGG G Sbjct: 291 GGGPGPAGGKIEGKGMPFPVQMGGGGGGP---GGKKGGPGGGGGNMGNQNQGGGGKNGG 346 Score = 36.3 bits (80), Expect = 0.026 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGG 695 GG G G GG + GG GGGG GG G P G G GG Sbjct: 362 GGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGGG 417 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGG G GGG G GG G GG GGGGG Sbjct: 348 GGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGG 395 Score = 33.5 bits (73), Expect = 0.19 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGP 682 GGGGP G GGG GG GG GP Sbjct: 109 GGGGPANNNKGQKIGGGGGGGGGGGGGGGGGP 140 Score = 33.5 bits (73), Expect = 0.19 Identities = 24/77 (31%), Positives = 25/77 (32%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG G P + G GGG G GG G G GGG G GG Sbjct: 298 GGKIEGKGMPFP--VQMGGGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLD 355 Query: 682 XGXXXXGXGXXXXXGGG 632 G G GGG Sbjct: 356 GKMGGGGGGPNGNKGGG 372 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -1 Query: 783 EXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXG--GXXXGGGGGXXG 622 + GGG GGG G GG G GG G G GGGGG G Sbjct: 338 QGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGG 393 Score = 31.9 bits (69), Expect = 0.57 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -1 Query: 729 GGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG+GG GG G GG GGGGG G Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 Score = 31.1 bits (67), Expect = 0.99 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = -1 Query: 777 GGG--GPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG G GGG G G GG G G GG GG GG G Sbjct: 329 GGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNG 382 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 750 GGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG GGG G G G GG GG GGGGG G Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGG-----GGGGGGGGGGGGG 139 Score = 29.9 bits (64), Expect = 2.3 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 4/53 (7%) Frame = -1 Query: 777 GGGGPXXX----GGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGG P GGG G GG GG G G GG GGGGG Sbjct: 349 GGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKG-----GGGGGGGGGG 396 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGG 767 GG GG + G GGG GG GGGG Sbjct: 106 GGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 814 KGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGG 716 KG GGG G G GG GGG GG Sbjct: 104 KGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGG 136 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = -3 Query: 754 GRGGXXXGGGPG----GPXXGXGGXXGAXGXXXXGXG 656 G+GG GGGP G G GG G G G G Sbjct: 103 GKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGG 767 GG GG +K GGG GG GGGG Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGG 136 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGP 713 G GGG G G GG GGG GGP Sbjct: 108 GGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGP 140 Score = 27.9 bits (59), Expect = 9.2 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG P G G R G GGGG GG GGP G Sbjct: 388 GGGGGGGGGPMSG----GLPPGFRPMGGGGGGGGGPQSMSMPMGGAMGGPMGSLPQMGGG 443 Query: 682 XG 677 G Sbjct: 444 PG 445 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 48.4 bits (110), Expect = 6e-06 Identities = 23/59 (38%), Positives = 24/59 (40%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P P AP PP P GP PPP PP PPPP P + PP P Sbjct: 378 PANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPP-PPGKKGAGPPPPPPMSKKGPPKP 435 Score = 45.2 bits (102), Expect = 6e-05 Identities = 24/68 (35%), Positives = 26/68 (38%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXG 836 P P P PP PP PPP P P PPPP PPP P ++ G Sbjct: 376 PGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAP--PPPPPPGKKGAGPPPPPPMS--KKG 431 Query: 837 XXXPPSXP 860 PP P Sbjct: 432 PPKPPGNP 439 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSX 857 P AP P PP PPP P P PPP P PPP P G PP Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPP---PPPKKGPAAPPPPPP---PGKKGAGPPPPP 425 Query: 858 P 860 P Sbjct: 426 P 426 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXX--PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPP 788 PPP P P P AP PP P GPPP PP+ P PP P Sbjct: 388 PPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPP--PPPMSKKGPPKPPGNP 439 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P PP P PPG PP P PP PP P Sbjct: 387 PPPPSAAAPPPPPPPKKGPAAPPPPP--PPGKKGAGPPPPPPMSKKGPPKPPGNPKGP 442 Score = 37.1 bits (82), Expect = 0.015 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = +1 Query: 622 PXTPPPPX--XXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSPXXG 765 P PPPP PPP P P P PP + PPP PP G Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPP--PPPMSKKG 431 Score = 36.7 bits (81), Expect = 0.020 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXX--PPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PP P PPP P PP PP + P APPP PP P Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPPPK-KGPAAPPP---PPPP 414 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 729 PPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PP P PPPP P PPP P G PP PP Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPP---PPKKGPAAPPPPPP 413 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = +1 Query: 622 PXTPPPPXXXP-----PPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 P PPPP P PP P PP PP + P PP P+ Sbjct: 395 PPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKGPT 443 Score = 31.5 bits (68), Expect = 0.75 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP--XXXPPSP 756 P PP PPP P PP P P PPP PP P Sbjct: 390 PSAAAPP-PPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKP 435 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/51 (27%), Positives = 15/51 (29%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXP 785 PPP P P + PP P P GP L P P Sbjct: 411 PPPPGKKGAGPPPPPPMSKKGPPKPPGNPKGPTKSGETSLAVGKTEDPTQP 461 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 48.4 bits (110), Expect = 6e-06 Identities = 24/65 (36%), Positives = 28/65 (43%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PPP PP + PP Sbjct: 122 PPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPP 181 Query: 804 PXPFL 818 P P++ Sbjct: 182 PPPYV 186 Score = 46.0 bits (104), Expect = 3e-05 Identities = 26/80 (32%), Positives = 30/80 (37%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP + PP Sbjct: 222 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 281 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ S PP Sbjct: 282 PPPYVYSSPPPPPYVYSSPP 301 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/62 (37%), Positives = 24/62 (38%), Gaps = 2/62 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP--PXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P +P PP PP PP PP P PPP P PPP Sbjct: 112 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPP 171 Query: 807 XP 812 P Sbjct: 172 PP 173 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/65 (35%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP + PP Sbjct: 162 PPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 221 Query: 804 PXPFL 818 P P++ Sbjct: 222 PPPYV 226 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/65 (35%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP + PP Sbjct: 182 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 241 Query: 804 PXPFL 818 P P++ Sbjct: 242 PPPYV 246 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/65 (35%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP + PP Sbjct: 202 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 261 Query: 804 PXPFL 818 P P++ Sbjct: 262 PPPYV 266 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/65 (35%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P +P PP PP PP PP P PP PP + PP Sbjct: 262 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPP 321 Query: 804 PXPFL 818 P P++ Sbjct: 322 PPPYV 326 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/65 (35%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P +P PP PP PP PP P PP PP + PP Sbjct: 282 PPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPP 341 Query: 804 PXPFL 818 P P++ Sbjct: 342 PPPYV 346 Score = 45.2 bits (102), Expect = 6e-05 Identities = 26/82 (31%), Positives = 30/82 (36%), Gaps = 3/82 (3%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRX 797 + PPP P P +P PP PP PP PP P PP PP Sbjct: 60 YKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSS 119 Query: 798 PPPXPFLAHXXXGXXXPPSXPP 863 PPP P++ S PP Sbjct: 120 PPPPPYVYKSPPPPPYVYSSPP 141 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/80 (32%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 92 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPP 151 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ S PP Sbjct: 152 PPPYVYKSPPPPPYVYSPPP 171 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/80 (32%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 132 PPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPP 191 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ S PP Sbjct: 192 PPPYVYKSPPPPPYVYSSPP 211 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/80 (32%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 172 PPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 231 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ S PP Sbjct: 232 PPPYVYKSPPPPPYVYSSPP 251 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/80 (32%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 192 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 251 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ S PP Sbjct: 252 PPPYVYKSPPPPPYVYSSPP 271 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/80 (32%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 212 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 271 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ S PP Sbjct: 272 PPPYVYKSPPPPPYVYSSPP 291 Score = 44.8 bits (101), Expect = 8e-05 Identities = 24/77 (31%), Positives = 27/77 (35%), Gaps = 4/77 (5%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP----PXXXPPLPXXXXPPPPXPPXRXP 800 PPP P P +P PP PP PP PP PPPP P Sbjct: 292 PPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSP 351 Query: 801 PPXPFLAHXXXGXXXPP 851 PP P++ PP Sbjct: 352 PPAPYVYKPPPYVYKPP 368 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/65 (35%), Positives = 26/65 (40%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 82 PPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 141 Query: 804 PXPFL 818 P P++ Sbjct: 142 PPPYV 146 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/65 (35%), Positives = 26/65 (40%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 242 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPP 301 Query: 804 PXPFL 818 P P++ Sbjct: 302 PPPYV 306 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/65 (35%), Positives = 26/65 (40%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 252 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPP 311 Query: 804 PXPFL 818 P P++ Sbjct: 312 PPPYV 316 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/65 (35%), Positives = 26/65 (40%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 272 PPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPP 331 Query: 804 PXPFL 818 P P++ Sbjct: 332 PPPYV 336 Score = 44.0 bits (99), Expect = 1e-04 Identities = 26/80 (32%), Positives = 28/80 (35%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P P PP PP PP PP P PP PP PP Sbjct: 152 PPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 211 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ S PP Sbjct: 212 PPPYVYKSPPPPPYVYSSPP 231 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/79 (30%), Positives = 26/79 (32%), Gaps = 3/79 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXP---PPPXPPXRXPP 803 PPP P P +P PP PP PP P P PPP P PP Sbjct: 302 PPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPP 361 Query: 804 PXPFLAHXXXGXXXPPSXP 860 P + PP P Sbjct: 362 PYVYKPPPYVYNYSPPPAP 380 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/71 (33%), Positives = 27/71 (38%), Gaps = 9/71 (12%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP---PXXXPPLPXXXXPPP---PXPP-- 788 PPP P P +P PP PP PP PP P PPP PP Sbjct: 312 PPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKPPPYV 371 Query: 789 -XRXPPPXPFL 818 PPP P++ Sbjct: 372 YNYSPPPAPYV 382 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/64 (34%), Positives = 26/64 (40%), Gaps = 3/64 (4%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPPP 806 PP P P +P PP PP PP PP P PP PP + PPP Sbjct: 55 PPPYVYKPPPYIYS--SPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPP 112 Query: 807 XPFL 818 P++ Sbjct: 113 PPYV 116 Score = 38.7 bits (86), Expect = 0.005 Identities = 23/73 (31%), Positives = 26/73 (35%), Gaps = 4/73 (5%) Frame = +3 Query: 657 PXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXP-PXRXPPPXPFLAH 824 P P P P PP P PPP P P PPP P PPP P++ + Sbjct: 29 PTPTPYSPLPPYVYNSPPPYVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYN 88 Query: 825 XXXGXXXPPSXPP 863 S PP Sbjct: 89 SPPPPPYVYSSPP 101 Score = 35.5 bits (78), Expect = 0.046 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +1 Query: 631 PPPPXX--XPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 PPPP PPP P P PP PP ++P PP P P Sbjct: 151 PPPPYVYKSPPPPPYVYSPPPP--PPYVYQSPPPPPYVYSSPPP 192 Score = 34.7 bits (76), Expect = 0.080 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP PP P Sbjct: 125 YVYKSPPPPPYVYSSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYSPPPP 172 Score = 34.7 bits (76), Expect = 0.080 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y P PPP PP P PP PP ++P PP P P Sbjct: 165 YVYSPPPPPPYVYQSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYSSPPP 212 Score = 33.5 bits (73), Expect = 0.19 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PPP P PP PP +P PP P P Sbjct: 155 YVYKSPPPPPYVYSPPPPPPYVYQSPP-PPPYVYSSPPPPPYVYKSPPP 202 Score = 32.7 bits (71), Expect = 0.32 Identities = 22/76 (28%), Positives = 25/76 (32%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 PP P P +P P PP PP P PPP PPP P+ Sbjct: 360 PPPYVYKPPPYVYN-YSPPPAPYVYKPPPYVYSYSPPPAPYVYKPPPYVYSYS-PPPAPY 417 Query: 816 LAHXXXGXXXPPSXPP 863 + PS PP Sbjct: 418 VYKPPPYVYSSPSPPP 433 Score = 31.9 bits (69), Expect = 0.57 Identities = 17/60 (28%), Positives = 19/60 (31%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 + PPP P +P P PP PP P PPP PPP Sbjct: 374 YSPPPAPYVYKPPPYVYSYSPPPAPYVYKPPPYVYSYSPPPAPYVYKPPPYVYSSPSPPP 433 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 75 YVYSSPPPPPYVYNSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYSSPPP 122 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 95 YVYSSPPPPPYVYKSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYSSPPP 142 Score = 31.5 bits (68), Expect = 0.75 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP--XXXPPSP 756 Y PPP PP P PP PP +P PPP PP P Sbjct: 135 YVYSSPPPPPYVYSSPPPPPYVYKSPP--PPPYVYSPPPPPPYVYQSPPPP 183 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 185 YVYSSPPPPPYVYKSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYSSPPP 232 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 205 YVYSSPPPPPYVYKSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYSSPPP 252 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 225 YVYSSPPPPPYVYKSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYSSPPP 272 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 245 YVYSSPPPPPYVYKSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYSSPPP 292 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 285 YVYSSPPPPPYVYSSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYTSPPP 332 Score = 31.5 bits (68), Expect = 0.75 Identities = 21/78 (26%), Positives = 24/78 (30%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 + PPP P P P PP P PP PPP P PPP Sbjct: 365 YKPPPYVYNYSPPPAPYVYKPP-PYVYSYSPPPAPYVYKPPPYVYSYSPPPAPYVYKPPP 423 Query: 807 XPFLAHXXXGXXXPPSXP 860 + + PS P Sbjct: 424 YVYSSPSPPPYYSSPSPP 441 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +1 Query: 607 IYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 IY P PPP PP P PP PP +P PP P P Sbjct: 66 IYSSPP--PPPYVYSSPPPPPYVYNSPP-PPPYVYSSPPPPPYVYKSPPP 112 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 85 YVYNSPPPPPYVYSSPPPPPYVYKSPP-PPPYVYSSPPPPPYVYKSPPP 132 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 105 YVYKSPPPPPYVYSSPPPPPYVYKSPP-PPPYVYSSPPPPPYVYSSPPP 152 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 115 YVYSSPPPPPYVYKSPPPPPYVYSSPP-PPPYVYSSPPPPPYVYKSPPP 162 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 175 YVYQSPPPPPYVYSSPPPPPYVYKSPP-PPPYVYSSPPPPPYVYKSPPP 222 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 195 YVYKSPPPPPYVYSSPPPPPYVYKSPP-PPPYVYSSPPPPPYVYKSPPP 242 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 215 YVYKSPPPPPYVYSSPPPPPYVYKSPP-PPPYVYSSPPPPPYVYKSPPP 262 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 235 YVYKSPPPPPYVYSSPPPPPYVYKSPP-PPPYVYSSPPPPPYVYKSPPP 282 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 255 YVYKSPPPPPYVYSSPPPPPYVYKSPP-PPPYVYSSPPPPPYVYSSPPP 302 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 265 YVYSSPPPPPYVYKSPPPPPYVYSSPP-PPPYVYSSPPPPPYVYSSPPP 312 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 275 YVYKSPPPPPYVYSSPPPPPYVYSSPP-PPPYVYSSPPPPPYVYKSPPP 322 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 295 YVYSSPPPPPYVYSSPPPPPYVYKSPP-PPPYVYTSPPPPPYVYKSPPP 342 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PPP SP Sbjct: 305 YVYSSPPPPPYVYKSPPPPPYVYTSPP-PPPYVYKSP-PPPPYVDSYSP 351 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P + PP P P P PP PPP P PPP Sbjct: 331 PPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKPPPYVYN-YSPPPAPYVYKPPP 387 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/62 (29%), Positives = 20/62 (32%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P PP PP PP P PPP PPP P Sbjct: 340 PPPPPYVDSYSPPPAPYVYKPPPYVYKPPPYVYNYSPPPAPYV-YKPPPYVYSYSPPPAP 398 Query: 813 FL 818 ++ Sbjct: 399 YV 400 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/70 (28%), Positives = 22/70 (31%), Gaps = 5/70 (7%) Frame = +2 Query: 584 YTSXTNKSYXFXXPXXPP-----PPPXXXPPXXXXXPPGPXXXXXXXXXXXXXXXXXXXP 748 Y+S Y + P PP PPP PP PP P P Sbjct: 137 YSSPPPPPYVYSSPPPPPYVYKSPPP---PPYVYSPPPPPPYVYQSPPPPPYVYSSPPPP 193 Query: 749 PPXXXGPPPP 778 P PPPP Sbjct: 194 PYVYKSPPPP 203 Score = 29.5 bits (63), Expect = 3.0 Identities = 17/55 (30%), Positives = 19/55 (34%), Gaps = 6/55 (10%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXP------PXXPPXXXRAPLAPPPXXXPPSP 756 Y +PPP PPP P P P PP +P PP P P Sbjct: 48 YVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPP 102 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +1 Query: 631 PPPPX--XXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 PPPP PPP P PP PP P P P P Sbjct: 321 PPPPYVYTSPPPPPYVYKSPPP--PPYVDSYSPPPAPYVYKPPP 362 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 48.0 bits (109), Expect = 8e-06 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P PP P PP PPP PP PPP PP PPP P Sbjct: 405 PPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPP 449 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/63 (36%), Positives = 25/63 (39%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 PP P P P +P PP PP PP PP P PPPP PP P Sbjct: 405 PPIVALPPPP----PPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPP 460 Query: 816 LAH 824 + H Sbjct: 461 VHH 463 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P P PPP PPLP PPP PP PPP P Sbjct: 403 PSPPIVALP-PPPPPSPPLPPPVYSPPPSPPVFSPPPSP 440 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/80 (31%), Positives = 27/80 (33%), Gaps = 7/80 (8%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXX----PPLPXXXXPPPPXPPX 791 PPP P P P +P PP P P PPP PP P PPP P Sbjct: 413 PPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSPE 472 Query: 792 RXPPPXPFLAHXXXGXXXPP 851 P P + PP Sbjct: 473 FEGPLPPVIGVSYASPPPPP 492 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 3/63 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXR---XPP 803 PPP P P +P P PP PP PP P PP PP PP Sbjct: 411 PPPPPPSPPLPPPVY--SPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPP 468 Query: 804 PXP 812 P P Sbjct: 469 PSP 471 Score = 36.3 bits (80), Expect = 0.026 Identities = 22/69 (31%), Positives = 24/69 (34%), Gaps = 6/69 (8%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPP----XXXPPLPXXXXPPPP--XPP 788 + PPP P +P PP P PPP PP P P PP Sbjct: 425 YSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSPEFEGPLPPVIGVS 484 Query: 789 XRXPPPXPF 815 PPP PF Sbjct: 485 YASPPPPPF 493 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +3 Query: 720 PGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 P PP PP P PP P P PP P + P PP Sbjct: 403 PSPPIVALPP-PPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPP 449 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PP PP P P PP P +PP PPSP Sbjct: 403 PSPPIVALPPPPPP----SPPLPPPVYSPPPSPPVFSPPPSP 440 Score = 31.1 bits (67), Expect = 0.99 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 P PPP PPP P PP P +PPP PPS Sbjct: 411 PPPPPPSPPLPPPV-YSPPPSPPVFSPPPSPPVYSPPP---PPS 450 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 PP P PP P P PP +P P P P P Sbjct: 437 PPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSPEFEGPLP 478 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/66 (30%), Positives = 22/66 (33%), Gaps = 4/66 (6%) Frame = +1 Query: 571 CGSXLYXSXQ*IIYXXXPXTP----PPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPX 738 CG + I+ P P PPP PPP P P P PP P Sbjct: 396 CGRSVVKPSPPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPS--PPVYSPPPPPSIHY 453 Query: 739 XXPPSP 756 PP P Sbjct: 454 SSPPPP 459 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPX--XXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPP PPP P P PP P +P PP P P Sbjct: 426 SPPPSPPVFSPPPSPPVYSPPPP--PSIHYSSPPPPPVHHSSPPP 468 Score = 28.7 bits (61), Expect = 5.3 Identities = 21/57 (36%), Positives = 23/57 (40%), Gaps = 12/57 (21%) Frame = +1 Query: 622 PXTPP-PPX-XXPPPXPXXXXPXP------PXXPPXXXRAPLAPPP----XXXPPSP 756 P +PP PP PPP P P P P PP + PPP PPSP Sbjct: 415 PPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSP 471 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 47.6 bits (108), Expect = 1e-05 Identities = 29/85 (34%), Positives = 29/85 (34%), Gaps = 8/85 (9%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXA-PXXPPXPXXGPPGPPPXXXPPL-------PXXXXPPPPXPP 788 PP P P P A P P P PP PPP PP P PPPP P Sbjct: 95 PPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESP 154 Query: 789 XRXPPPXPFLAHXXXGXXXPPSXPP 863 P P P PPS P Sbjct: 155 PSLPAPDPPSNPLPPPKLVPPSHSP 179 Score = 45.6 bits (103), Expect = 4e-05 Identities = 25/80 (31%), Positives = 27/80 (33%), Gaps = 5/80 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPP-----GPPPXXXPPLPXXXXPPPPXPPXRXP 800 PP P P P P P PP GPPP P P PPP P P Sbjct: 50 PPETTNTPAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAP 109 Query: 801 PPXPFLAHXXXGXXXPPSXP 860 PP ++ PP P Sbjct: 110 PPANPVSSPPPESSPPPPPP 129 Score = 45.6 bits (103), Expect = 4e-05 Identities = 22/59 (37%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXP-PXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P +P P P P PPP PP P PPP P PPP Sbjct: 62 PPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPP 120 Score = 43.6 bits (98), Expect = 2e-04 Identities = 27/85 (31%), Positives = 28/85 (32%), Gaps = 9/85 (10%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXP--PXPXXGPPGPPPXXXPP------LPXXXXPPPPXPPX 791 PP P P P P P P PP P P PP P PPP PP Sbjct: 71 PPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPT 130 Query: 792 RXPPPXPFLA-HXXXGXXXPPSXPP 863 PP P + PP PP Sbjct: 131 EAPPTTPITSPSPPTNPPPPPESPP 155 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/77 (29%), Positives = 24/77 (31%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P PP P P PP P P PPP P PP Sbjct: 126 PPPPTEAPPTTPITSPSPPTNPPPP---PESPPSLPAPDPPSNPLPPPKLVPPSHSPPRH 182 Query: 813 FLAHXXXGXXXPPSXPP 863 + PP P Sbjct: 183 LPSPPASEIPPPPRHLP 199 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXP-PXXPPXXXRAPLAPPPXXXPPS 753 P +PPP PPP P P P P +P PPP PP+ Sbjct: 91 PVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPT 135 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPP P P P P P P++PPP PP P Sbjct: 61 SPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPP 103 Score = 37.1 bits (82), Expect = 0.015 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +3 Query: 699 PXPXXGPPGPPPXXXPPLPXXXXPPP---PXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 P P PPP PP P PPP P P P P P L P S PP Sbjct: 62 PPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPP 119 Score = 36.7 bits (81), Expect = 0.020 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 +PPP PPP P P P P P PPP PPS Sbjct: 117 SPPPESSPPPPPPTEAPPTTPITSPSPPTNP--PPPPESPPS 156 Score = 36.3 bits (80), Expect = 0.026 Identities = 22/78 (28%), Positives = 23/78 (29%), Gaps = 1/78 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXR-XPPPX 809 PP P P PP P P P P P PP PP PPP Sbjct: 210 PPSDSEHPSPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPPSPPEETLPPPK 269 Query: 810 PFLAHXXXGXXXPPSXPP 863 P PP+ P Sbjct: 270 PSPDPLPSNSSSPPTLLP 287 Score = 35.9 bits (79), Expect = 0.035 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPPP PP P P P PP P PP P P Sbjct: 144 PTNPPPPPESPPSLPAPDPPSNPLPPPKLV-PPSHSPPRHLPSPP 187 Score = 35.5 bits (78), Expect = 0.046 Identities = 22/78 (28%), Positives = 23/78 (29%), Gaps = 2/78 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PP P P P P PP P PP PP P P PP PP Sbjct: 110 PPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPP 169 Query: 807 XPFLAHXXXGXXXPPSXP 860 + PS P Sbjct: 170 PKLVPPSHSPPRHLPSPP 187 Score = 35.5 bits (78), Expect = 0.046 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 P T P P PPP P P PP PL PPP PPS Sbjct: 137 PITSPSPPTNPPPPPESPPSLPAPDPPSN---PL-PPPKLVPPS 176 Score = 34.3 bits (75), Expect = 0.11 Identities = 25/82 (30%), Positives = 26/82 (31%), Gaps = 6/82 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXA-PXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP--- 800 PP P P P P P P PPP PP P PP P P Sbjct: 86 PPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPP-PPPPTEAPPTTPITSPSPP 144 Query: 801 --PPXPFLAHXXXGXXXPPSXP 860 PP P + PPS P Sbjct: 145 TNPPPPPESPPSLPAPDPPSNP 166 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPL---APPPXXXPPSP 756 PPPP PP P PP PP +P AP P P P Sbjct: 125 PPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPP 169 Score = 33.5 bits (73), Expect = 0.19 Identities = 20/74 (27%), Positives = 22/74 (29%), Gaps = 2/74 (2%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPX--PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXP 770 P + I H P P P P +P P P PPP P P P Sbjct: 187 PASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKRPTPSPPSP 246 Query: 771 PPPXPPXRXPPPXP 812 P PP P Sbjct: 247 SDSKRPVHPSPPSP 260 Score = 33.1 bits (72), Expect = 0.25 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 8/53 (15%) Frame = +1 Query: 622 PXTPPPPXXXPPP--XPXXXXPXPPXXPPXXXRAP------LAPPPXXXPPSP 756 P P P PPP P P P PP AP +PPP PP P Sbjct: 75 PSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPP 127 Score = 33.1 bits (72), Expect = 0.25 Identities = 24/79 (30%), Positives = 24/79 (30%), Gaps = 3/79 (3%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPP--LPXXXXPPPPXPPXRXP-PP 806 PP P AP P P P PP PP LP P PP P PP Sbjct: 143 PPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPP 202 Query: 807 XPFLAHXXXGXXXPPSXPP 863 PS PP Sbjct: 203 ASERPSTPPSDSEHPSPPP 221 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 3/60 (5%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP---PXPPXRXPP 803 PPP P P P P P PP PP PP P P PP PP Sbjct: 231 PPPPGSKRPTPSPPSPSDSKRPVHP--SPPSPPEETLPPPKPSPDPLPSNSSSPPTLLPP 288 Score = 31.9 bits (69), Expect = 0.57 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 H PP P P P P PP P P PPP P R PP Sbjct: 177 HSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSP----PPPGHPKRREQPP 232 Query: 807 XP 812 P Sbjct: 233 PP 234 Score = 31.9 bits (69), Expect = 0.57 Identities = 24/83 (28%), Positives = 25/83 (30%), Gaps = 4/83 (4%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXX--PPXPXXGP--PGPPPXXXPPLPXXXXPPPPXPPXR 794 H P P P P P P P P P PPP P P PPP R Sbjct: 182 HLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPP---PGHPKRREQPPPPGSKR 238 Query: 795 XPPPXPFLAHXXXGXXXPPSXPP 863 P P + P PP Sbjct: 239 PTPSPPSPSDSKRPVHPSPPSPP 261 Score = 31.5 bits (68), Expect = 0.75 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 7/65 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPX---PXXGPP----GPPPXXXPPLPXXXXPPPPXPPX 791 PPP P P P PP P PP PP PP P P PP Sbjct: 148 PPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPP-PPRHLPSPPASER 206 Query: 792 RXPPP 806 PP Sbjct: 207 PSTPP 211 Score = 31.1 bits (67), Expect = 0.99 Identities = 15/45 (33%), Positives = 18/45 (40%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP PP P PP PP +P + P P +P Sbjct: 124 PPPPPP--TEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNP 166 Score = 31.1 bits (67), Expect = 0.99 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PP PPP PP P + + PPP P P Sbjct: 158 PAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPP 202 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 2/62 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 P P P P P P P P PPP P P P P P P Sbjct: 160 PDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSP 219 Query: 807 XP 812 P Sbjct: 220 PP 221 Score = 30.7 bits (66), Expect = 1.3 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 5/65 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXP-PXPXXGPPGPPPXXXPPLPXXXX----PPPPXPPXRX 797 PP P P P P P P PP P P PPPP P R Sbjct: 169 PPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRR 228 Query: 798 PPPXP 812 P P Sbjct: 229 EQPPP 233 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPP 732 T PPP P P P P PP +P +PP Sbjct: 264 TLPPPKPSPDPLPSNSSSPPTLLPPSSVVSPPSPP 298 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/70 (28%), Positives = 21/70 (30%), Gaps = 4/70 (5%) Frame = +3 Query: 663 PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXP----PPPXPPXRXPPPXPFLAHXX 830 P P P PP P PP P P PPP PPP P Sbjct: 45 PTNGNPPETTNTPAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPL 104 Query: 831 XGXXXPPSXP 860 PP+ P Sbjct: 105 PTEAPPPANP 114 Score = 29.9 bits (64), Expect = 2.3 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 10/53 (18%) Frame = +1 Query: 628 TPPPPX--XXPPPXPXXXXPXP---PXXPPXXXRAPLAP-----PPXXXPPSP 756 +PPPP PPP P P P PP P P PP PP P Sbjct: 99 SPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPP 151 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/53 (33%), Positives = 20/53 (37%), Gaps = 8/53 (15%) Frame = +1 Query: 622 PXTPPP-PXXXPPPX------PXXXXPXPPXXPPXXXRAPL-APPPXXXPPSP 756 P PPP P PPP P P PP P+ +P P PP P Sbjct: 98 PSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPP 150 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/46 (32%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXP-PXXXRAPLAPPPXXXPPSP 756 P + PP P P P P P P P PP PSP Sbjct: 174 PPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSP 219 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/44 (31%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 628 TPPPPXXXP----PPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP 747 +PPPP PP P P P P + P+ P P P Sbjct: 218 SPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPPSPP 261 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 47.6 bits (108), Expect = 1e-05 Identities = 23/60 (38%), Positives = 24/60 (40%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P +P PP PP P PP P PPP PP PPP P Sbjct: 476 PPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPP-SPPPPCP 534 Score = 46.4 bits (105), Expect = 2e-05 Identities = 26/79 (32%), Positives = 29/79 (36%), Gaps = 3/79 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP---XPPXRXPP 803 PPP P P P PP PP PPP PP P PPP P + PP Sbjct: 496 PPPYVYSSPPPPYVYSSPP--PPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPP 553 Query: 804 PXPFLAHXXXGXXXPPSXP 860 P + + PP P Sbjct: 554 PPSPVYYPPVTQSPPPPSP 572 Score = 45.2 bits (102), Expect = 6e-05 Identities = 24/79 (30%), Positives = 27/79 (34%), Gaps = 2/79 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP--XPPXRXPPP 806 PPP P P +P P PP P P PP+ PP P PP PP Sbjct: 539 PPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPP 598 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P + PP P Sbjct: 599 PPSPVYYPQVTPSPPPPSP 617 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/63 (36%), Positives = 25/63 (39%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P +P PP PP P PP P PPPP P PPP Sbjct: 486 PPPYVYSSPPPPPYVYSSPP-PPYVYSSPPPPYVYSSPP-PPPPSPPPPCPESSPPPPVV 543 Query: 813 FLA 821 + A Sbjct: 544 YYA 546 Score = 42.7 bits (96), Expect = 3e-04 Identities = 25/80 (31%), Positives = 27/80 (33%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXP---PXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P P PP PPP PP P PPP PP Sbjct: 426 PPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPP 485 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ S PP Sbjct: 486 PPPYVYSSPPPPPYVYSSPP 505 Score = 41.9 bits (94), Expect = 5e-04 Identities = 26/80 (32%), Positives = 29/80 (36%), Gaps = 1/80 (1%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPXRXPP 803 + PPP P P P PP PP PP PP P PP P P Sbjct: 456 YPPPPPPSPSPPPPYVYSSPP--PPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSP 513 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ PPS PP Sbjct: 514 PPPYV--YSSPPPPPPSPPP 531 Score = 41.9 bits (94), Expect = 5e-04 Identities = 26/83 (31%), Positives = 27/83 (32%), Gaps = 6/83 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPP--GPPPXXXPPLPXXXXPPPP----XPPXR 794 PPP P P P PP P P PPP P PPPP PP Sbjct: 505 PPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVT 564 Query: 795 XPPPXPFLAHXXXGXXXPPSXPP 863 PP P + PP P Sbjct: 565 QSPPPPSPVYYPPVTNSPPPPSP 587 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/79 (29%), Positives = 25/79 (31%), Gaps = 2/79 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP--XPPXRXPPP 806 PPP P P P PP P P PP+ PP P PP PP Sbjct: 524 PPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPP 583 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P + PP P Sbjct: 584 PPSPVYYPPVTYSPPPPSP 602 Score = 39.1 bits (87), Expect = 0.004 Identities = 24/81 (29%), Positives = 27/81 (33%), Gaps = 4/81 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP----XPPXRXP 800 PP P P +P P PP P P PP+ PPPP PP Sbjct: 584 PPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPS--PPPPSPVYYPPVTPS 641 Query: 801 PPXPFLAHXXXGXXXPPSXPP 863 PP P + PP P Sbjct: 642 PPPPSPVYYPPVTPSPPPPSP 662 Score = 37.5 bits (83), Expect = 0.011 Identities = 24/92 (26%), Positives = 29/92 (31%), Gaps = 3/92 (3%) Frame = +3 Query: 597 PINHIXXXXXHXPPPX-XXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPP 773 P+ + PPP P P +P P PP P P PP+ PP Sbjct: 541 PVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPP 600 Query: 774 PP--XPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 P P PP P + PP P Sbjct: 601 SPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSP 632 Score = 37.1 bits (82), Expect = 0.015 Identities = 26/82 (31%), Positives = 29/82 (35%), Gaps = 5/82 (6%) Frame = +3 Query: 633 PPPXXXXXPX-PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP----XPPXRX 797 PPP P P +P P PP P P PP+ PPPP PP Sbjct: 598 PPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPS--PPPPSPVYYPPVTP 655 Query: 798 PPPXPFLAHXXXGXXXPPSXPP 863 PP P + PP PP Sbjct: 656 SPPPPSPVYYPSETQSPP--PP 675 Score = 35.9 bits (79), Expect = 0.035 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 PPPP PPP P P P ++P P P PP Sbjct: 523 PPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPP 562 Score = 35.1 bits (77), Expect = 0.061 Identities = 23/78 (29%), Positives = 26/78 (33%), Gaps = 4/78 (5%) Frame = +3 Query: 633 PPPXXXXXPX--PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP--XPPXRXP 800 PPP P P P PP PP P P PP+ PP P P Sbjct: 613 PPPSPLYYPPVTPSPPPPSPVYYPPVT-PSPPPPSPVYYPPVTPSPPPPSPVYYPSETQS 671 Query: 801 PPXPFLAHXXXGXXXPPS 854 PP P + PP+ Sbjct: 672 PPPPTEYYYSPSQSPPPT 689 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 8/50 (16%) Frame = +1 Query: 631 PPPPXXX--PPPXP-XXXXPXPP-----XXPPXXXRAPLAPPPXXXPPSP 756 PPPP PPP P P PP PP +P PPP PP P Sbjct: 485 PPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCP 534 Score = 33.9 bits (74), Expect = 0.14 Identities = 26/83 (31%), Positives = 28/83 (33%), Gaps = 6/83 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXP--PXPXXGPPGPPPXXX---PPLPXXXXPPPPXP-PXR 794 PPP P P P P P P PPP PP P PPP P Sbjct: 443 PPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYS 502 Query: 795 XPPPXPFLAHXXXGXXXPPSXPP 863 PPP P++ S PP Sbjct: 503 SPPP-PYVYSSPPPPYVYSSPPP 524 Score = 33.5 bits (73), Expect = 0.19 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 5/82 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPP---GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P PP P PP PPP P PPP P PP Sbjct: 568 PPPSPVYYPPVTNSPP-----PPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPP 622 Query: 804 --PXPFLAHXXXGXXXPPSXPP 863 P P PS PP Sbjct: 623 VTPSPPPPSPVYYPPVTPSPPP 644 Score = 32.3 bits (70), Expect = 0.43 Identities = 25/84 (29%), Positives = 26/84 (30%), Gaps = 7/84 (8%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPX-----PPXRX 797 PPP P P P PP PP P PPPP P R Sbjct: 384 PPPTFKMSPEVRTLPP-----PIYVYSSPPPPPSSKMSPTVRAYSPPPPPSSKMSPSVRA 438 Query: 798 --PPPXPFLAHXXXGXXXPPSXPP 863 PPP P+ PP PP Sbjct: 439 YSPPPPPYSKMSPSVRAYPPPPPP 462 Score = 32.3 bits (70), Expect = 0.43 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +2 Query: 608 YXFXXPXXPPPPPXXXPPXXXXXPPGPXXXXXXXXXXXXXXXXXXXPPPXXXGPPP 775 Y + P PPPPP PP PP P PP PPP Sbjct: 517 YVYSSP--PPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPP 570 Score = 31.9 bits (69), Expect = 0.57 Identities = 20/78 (25%), Positives = 23/78 (29%), Gaps = 1/78 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPX-PXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPX 809 PPP P P P P PPP + PP PP PP Sbjct: 409 PPPSSKMSPTVRAYSPPPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPP 468 Query: 810 PFLAHXXXGXXXPPSXPP 863 P++ S PP Sbjct: 469 PYVYSSPPPPYVYSSPPP 486 Score = 31.5 bits (68), Expect = 0.75 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPX--XXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P PP PP +P P PP P Sbjct: 474 SPPPPYVYSSPPPPPYVYSSPPP--PPYVYSSPPPPYVYSSPPPP 516 Score = 31.5 bits (68), Expect = 0.75 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 628 TPPPPXXX---PPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 +PPPP PPP P PP PP PPP Sbjct: 503 SPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPP 541 Score = 31.5 bits (68), Expect = 0.75 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = +1 Query: 628 TPPPPXXX---PPPXPXXXXPXP--PXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P P P PP AP+ P PPSP Sbjct: 512 SPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSP--PPPSP 557 Score = 31.1 bits (67), Expect = 0.99 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPP--XXXRAPLAPPPXXXPPSP 756 P TP P PPP P P P PP P+ P P PPSP Sbjct: 622 PVTPSP----PPPSPVYYPPVTPSPPPPSPVYYPPVTPSP--PPPSP 662 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = +2 Query: 608 YXFXXPXXPPPPPXXXPPXXXXXPPGPXXXXXXXXXXXXXXXXXXXPPPXXXGPPPP 778 Y P PPP P PP PP P PP PPPP Sbjct: 605 YPQVTPSPPPPSPLYYPPVTPSPPP-PSPVYYPPVTPSPPPPSPVYYPPVTPSPPPP 660 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +2 Query: 623 PXXPPPPPXXXPPXXXXXPPGPXXXXXXXXXXXXXXXXXXXPPPXXXGPPPP 778 P PPP P PP PP P PPP PPP Sbjct: 457 PPPPPPSPSPPPPYVYSSPPPP--YVYSSPPPPPYVYSSPPPPPYVYSSPPP 506 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +1 Query: 631 PPPPXXX--PPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 PPPP PPP P PP P +PPP SP Sbjct: 495 PPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSP 538 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 PPPP P P PP PPP PSP Sbjct: 425 PPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSP 466 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P PPP PP P P P +P P P PP Sbjct: 610 PSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPP 652 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P +PPPP P P P P PP PP P Sbjct: 526 PPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPP 570 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 +PPPP P P P P ++P P P PP Sbjct: 537 SPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPP 577 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/50 (30%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +1 Query: 604 IIYXXXPXTPPPPXX-XPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 + Y +PPPP PP P P P +P P P PP Sbjct: 573 VYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPP 622 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 P TP PP P P PP P +PPP Sbjct: 637 PVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPP 674 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/46 (32%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +1 Query: 622 PXTPPPPXXXP---PPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P T PP P PP P P P +P P P PP Sbjct: 547 PVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPP 592 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 47.2 bits (107), Expect = 1e-05 Identities = 25/69 (36%), Positives = 26/69 (37%), Gaps = 2/69 (2%) Frame = +3 Query: 663 PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPX--PPXRXPPPXPFLAHXXXG 836 P P P PP P PPP PP P PPPP PP + PPP H Sbjct: 42 PFKWGPKFPYSPPKPPPIEKYPPPVQYPP-PIKKYPPPPYEHPPVKYPPPIKTYPHPPVK 100 Query: 837 XXXPPSXPP 863 P PP Sbjct: 101 YPPPEQYPP 109 Score = 41.9 bits (94), Expect = 5e-04 Identities = 23/65 (35%), Positives = 25/65 (38%), Gaps = 5/65 (7%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPP--GPPPXXXPPLPXXXXPPP---PXPPXRXP 800 PP P P P PP P PP PPP P P PPP P P + P Sbjct: 56 PPPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYP 115 Query: 801 PPXPF 815 PP + Sbjct: 116 PPEQY 120 Score = 40.7 bits (91), Expect = 0.001 Identities = 26/80 (32%), Positives = 26/80 (32%), Gaps = 5/80 (6%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGP--PGPPPXXXPPLPXXXXPPP---PXPPX 791 H PPP P P PP P PPP PP P PPP PP Sbjct: 158 HYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYPP-PIKKYPPPIKKYPPPE 216 Query: 792 RXPPPXPFLAHXXXGXXXPP 851 PPP H PP Sbjct: 217 EYPPPIKTYPHPPVKYPPPP 236 Score = 38.3 bits (85), Expect = 0.007 Identities = 23/63 (36%), Positives = 24/63 (38%), Gaps = 6/63 (9%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPP---GPPPXXXPPLPXXXXPPP---PXPPXRX 797 PP P P P PP PP PPP PP P PPP P P + Sbjct: 147 PPPIKKYPPPEHYPPPIKKYPPQEQYPPPIKKYPPPEKYPP-PIKKYPPPEQYPPPIKKY 205 Query: 798 PPP 806 PPP Sbjct: 206 PPP 208 Score = 37.5 bits (83), Expect = 0.011 Identities = 23/66 (34%), Positives = 25/66 (37%), Gaps = 5/66 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPG--PPPXXXPPLPXXXXPPP---PXPPXRX 797 PPP P P P P PP PPP PP P PPP P P + Sbjct: 69 PPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPP-PIKKYPPPEQYPPPIKKY 127 Query: 798 PPPXPF 815 PPP + Sbjct: 128 PPPEQY 133 Score = 35.1 bits (77), Expect = 0.061 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 4/62 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPG--PPPXXXPPLPXXXXPP--PPXPPXRXP 800 PPP P P PP PP PPP P P PP PP + P Sbjct: 88 PPPIKTYPHPPVKYPPPEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYP 147 Query: 801 PP 806 PP Sbjct: 148 PP 149 Score = 35.1 bits (77), Expect = 0.061 Identities = 22/62 (35%), Positives = 23/62 (37%), Gaps = 3/62 (4%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPX---PPXRXPPP 806 PP P P P PP P P PP PP P P PP PP + PP Sbjct: 199 PPPIKKYPPPIKKYPPPEEYPP-PIKTYPHPPVKYPPP-PYKTYPHPPIKTYPPPKECPP 256 Query: 807 XP 812 P Sbjct: 257 PP 258 Score = 34.7 bits (76), Expect = 0.080 Identities = 26/81 (32%), Positives = 28/81 (34%), Gaps = 13/81 (16%) Frame = +3 Query: 603 NHIXXXXXHXPP-------PXXXXXPXPXXXXPXAPXXPPXPXXGPPGP---PPXXXPPL 752 N + H PP P P P P PP PP P PP PP Sbjct: 31 NSVPNWFHHWPPFKWGPKFPYSPPKPPPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPP- 89 Query: 753 PXXXXPPPP---XPPXRXPPP 806 P P PP PP + PPP Sbjct: 90 PIKTYPHPPVKYPPPEQYPPP 110 Score = 34.7 bits (76), Expect = 0.080 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 3/60 (5%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP---PXPPXRXPPP 806 PP P P P P P PP PP P P PPP P PP P P Sbjct: 206 PPPIKKYPPPEEYPPPIKTYPHPPVKYPP-PPYKTYPHPPIKTYPPPKECPPPPEHYPWP 264 Score = 33.5 bits (73), Expect = 0.19 Identities = 23/75 (30%), Positives = 24/75 (32%), Gaps = 2/75 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPG--PPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P PP PP PPP P P PPPP P P Sbjct: 186 PPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKYPPPPYK--TYPHP 243 Query: 807 XPFLAHXXXGXXXPP 851 P + PP Sbjct: 244 -PIKTYPPPKECPPP 257 Score = 31.5 bits (68), Expect = 0.75 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 PPPP P P P P PP P P PP Sbjct: 233 PPPPYKTYPHPPIKTYPPPKECPPPPEHYPWPPKKKYPPP 272 Score = 31.1 bits (67), Expect = 0.99 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P P P P P P P PP + P PPP PP Sbjct: 47 PKFPYSPPKPPPIEKYPPPVQYPPPIKKYP--PPPYEHPP 84 Score = 31.1 bits (67), Expect = 0.99 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 Y P PPP PP P P P PP + P PP PP Sbjct: 94 YPHPPVKYPPPEQYPP--PIKKYPPPEQYPPPIKKYP--PPEQYSPP 136 Score = 31.1 bits (67), Expect = 0.99 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 5/62 (8%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPG--PPPXXXPPLPXXXXPPP---PXPPXRXP 800 PP P P PP PP PPP P P PPP PP + P Sbjct: 128 PPPEQYSPPFKKYPPPEQYPPPIKKYPPPEHYPPPIKKYP-PQEQYPPPIKKYPPPEKYP 186 Query: 801 PP 806 PP Sbjct: 187 PP 188 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/68 (27%), Positives = 19/68 (27%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 PI PPP P P P P P P PP PP PP Sbjct: 221 PIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPPPEHYPWPPKKKYPPPVEYPSPPY 280 Query: 777 PXPPXRXP 800 P P Sbjct: 281 KKYPPADP 288 Score = 30.3 bits (65), Expect = 1.7 Identities = 20/74 (27%), Positives = 22/74 (29%), Gaps = 2/74 (2%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPG--PPPXXXPPLPXXXXPPPPXPPXRXPPPX 809 PP P P PP PP PPP P P PP P + P Sbjct: 115 PPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPIKKYPPPEHYPPPIKKYPPQEQYPP 174 Query: 810 PFLAHXXXGXXXPP 851 P + PP Sbjct: 175 PIKKYPPPEKYPPP 188 Score = 30.3 bits (65), Expect = 1.7 Identities = 27/83 (32%), Positives = 29/83 (34%), Gaps = 10/83 (12%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXX-PPXPXXGPPGPPPXXXPPLPXXXXPP 773 PI PPP P P P P PP P P PP PP P PP Sbjct: 201 PIKKYPPPIKKYPPPEEY--PPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPP-PKECPPP 257 Query: 774 P---PXPPXRX---P---PPXPF 815 P P PP + P P P+ Sbjct: 258 PEHYPWPPKKKYPPPVEYPSPPY 280 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +1 Query: 631 PPPPXXXPP----PXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 PPP PP P P P P PP P PP PP P Sbjct: 193 PPPEQYPPPIKKYPPPIKKYPPPEEYPPPIKTYP--HPPVKYPPPP 236 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/45 (33%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLA--PPPXXXPP 750 P PP PPP P PP P+ PPP PP Sbjct: 78 PPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYPPPEQYPP 122 Score = 29.5 bits (63), Expect = 3.0 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 7/77 (9%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXP-- 770 PI PPP P P P PP PP P PP P Sbjct: 90 PIKTYPHPPVKYPPPEQY--PPPIKKYPPPEQYPPPIKKYPP--PEQYSPPFKKYPPPEQ 145 Query: 771 -PPP----XPPXRXPPP 806 PPP PP PPP Sbjct: 146 YPPPIKKYPPPEHYPPP 162 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/45 (33%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLA--PPPXXXPP 750 P PPP PP P PP P+ PPP PP Sbjct: 156 PEHYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYPP 200 Score = 27.9 bits (59), Expect = 9.2 Identities = 21/75 (28%), Positives = 25/75 (33%), Gaps = 5/75 (6%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXX---PXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXX 767 P+ + + PPP P P P P P P PP P P P Sbjct: 65 PVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPP---PIKKYPPPEQYP 121 Query: 768 PP--PPXPPXRXPPP 806 PP PP + PP Sbjct: 122 PPIKKYPPPEQYSPP 136 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 47.2 bits (107), Expect = 1e-05 Identities = 25/77 (32%), Positives = 26/77 (33%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P P P P P P PP P P P P PPPP P P P P Sbjct: 109 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPV-SPPPPTPTPSVPSPTP 167 Query: 813 FLAHXXXGXXXPPSXPP 863 + PP PP Sbjct: 168 PVPTDPMPSPPPPVSPP 184 Score = 46.0 bits (104), Expect = 3e-05 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 1/61 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXP-PPPXPPXRXPPPX 809 PPP P P +P PP P P P P PP P P P PP PPP Sbjct: 99 PPPPTPTPSVPSPTPPVSPP-PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPT 157 Query: 810 P 812 P Sbjct: 158 P 158 Score = 45.2 bits (102), Expect = 6e-05 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 1/78 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXP-PPPXPPXRXPPPX 809 PPP P P P PP P P P P PP P P P PP PPP Sbjct: 83 PPPPTPSVPSP---TPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPT 139 Query: 810 PFLAHXXXGXXXPPSXPP 863 P P S PP Sbjct: 140 P--TPSVPSPTPPVSPPP 155 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/76 (34%), Positives = 28/76 (36%), Gaps = 2/76 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX-PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP-PP 806 P P P P P P PP P P PPP PP P P P PP P PP Sbjct: 145 PSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPP-PPTPTPSVPSPPDVTPTPP 203 Query: 807 XPFLAHXXXGXXXPPS 854 P + PP+ Sbjct: 204 TPSVPSPPDVTPTPPT 219 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/82 (30%), Positives = 27/82 (32%), Gaps = 6/82 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP---- 800 PP P P P P P P PP P P P P P PP P P Sbjct: 155 PPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVT 214 Query: 801 --PPXPFLAHXXXGXXXPPSXP 860 PP P + PP+ P Sbjct: 215 PTPPTPSVPSPPDVTPTPPTPP 236 Score = 44.0 bits (99), Expect = 1e-04 Identities = 23/63 (36%), Positives = 24/63 (38%), Gaps = 3/63 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPP---XXXPPLPXXXXPPPPXPPXRXPP 803 P P P P P P P PP P P PP+P P PP PP PP Sbjct: 127 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPP-PPVSPPP 185 Query: 804 PXP 812 P P Sbjct: 186 PTP 188 Score = 42.7 bits (96), Expect = 3e-04 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 1/63 (1%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXP-PPPXPPXRXPPPXPFLAHXXXGXXXPPS 854 P P PP P P P P PP P P P PP PPP P P S Sbjct: 77 PVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP--TPSVPSPTPPVS 134 Query: 855 XPP 863 PP Sbjct: 135 PPP 137 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPL--APPPXXXPPSP 756 P P PP PPP P P PP PP P +P P PP P Sbjct: 74 PPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPP 120 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P P PP P + PP P P Sbjct: 176 SPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPP 218 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/62 (35%), Positives = 24/62 (38%), Gaps = 2/62 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGP-PPXXXPPLPXXXXPPPPXPPXRXPP-P 806 PPP P P +P PP P P P PP P+P P P PP P P Sbjct: 135 PPPPTPTPSVPSPTPPVSPP-PPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVP 193 Query: 807 XP 812 P Sbjct: 194 SP 195 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 2/62 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXX-GPPGPPPXXX-PPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P P P PP PP P PP P PP Sbjct: 178 PPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPS 237 Query: 807 XP 812 P Sbjct: 238 VP 239 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +P PP PPP P P P PP +PPP PP P Sbjct: 146 SPTPPVSPPPPTPTPSVPSP--TPPVPTDPMPSPPPPVSPPPP 186 Score = 35.5 bits (78), Expect = 0.046 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = +1 Query: 628 TPPPPXXXPP--PXPXXXXPXPPXXPPXXXRAPL--APPPXXXPPSP 756 +P PP PP P P P PP PP P +P P PP P Sbjct: 92 SPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPP 138 Score = 35.5 bits (78), Expect = 0.046 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = +1 Query: 628 TPPPPXXXPP--PXPXXXXPXPPXXPPXXXRAPL--APPPXXXPPSP 756 +P PP PP P P P PP PP P +P P PP P Sbjct: 110 SPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPP 156 Score = 35.5 bits (78), Expect = 0.046 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPP--PXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +P PP PP P P P PP PP P P P PP P Sbjct: 128 SPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSP--TPPVP 170 Score = 35.5 bits (78), Expect = 0.046 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPP-PXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P +PPPP P P P PP P +P P P PSP Sbjct: 132 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSP 177 Score = 35.5 bits (78), Expect = 0.046 Identities = 26/79 (32%), Positives = 27/79 (34%), Gaps = 2/79 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPL-PXXXXPPPPXPPXRXP-PP 806 P P P P P P PP PP P P + P P P PP P PP Sbjct: 175 PSPPPPVSPPPPTPTPSVPS-PPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPP 233 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P G PP PP Sbjct: 234 TPPSVPTPSG--SPPYVPP 250 Score = 35.1 bits (77), Expect = 0.061 Identities = 19/53 (35%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +1 Query: 622 PXTPPPPXXXP------PPXPXXXXPXP--PXXPPXXXRAPLAPPPXXXPPSP 756 P +PPPP P PP P P P P PP P P P P+P Sbjct: 150 PVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTP 202 Score = 34.7 bits (76), Expect = 0.080 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P P PP P P P P PP P P P P PP Sbjct: 205 PSVPSPPDVTPTP-PTPSVPSPPDVTPTPPTPPSVPTPSGSPP 246 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 TPP P PP P PP P P PPP Sbjct: 216 TPPTPSVPSPPDVTPTPPTPPSVPTPSGSPPYVPPP 251 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPP--XXXRAPLAPPPXXXPPS 753 P +PPPP P P PP P P++PPP PS Sbjct: 80 PVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPS 125 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P TP P PP P P P P +P P P PSP Sbjct: 85 PPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSP 129 Score = 32.3 bits (70), Expect = 0.43 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P PPP P P P P P P PP PP Sbjct: 95 PPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPP 137 Score = 32.3 bits (70), Expect = 0.43 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P PPP P P P P P P PP PP Sbjct: 113 PPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPP 155 Score = 31.9 bits (69), Expect = 0.57 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPP--PXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P TP P P PP P P P P +P P P PSP Sbjct: 101 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSP 147 Score = 31.9 bits (69), Expect = 0.57 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPP--PXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P TP P P PP P P P P +P P P PSP Sbjct: 119 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSP 165 Score = 31.9 bits (69), Expect = 0.57 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXP--PXXPPXXXRAPLAPPPXXXPPS 753 TPP P P P P P P P P++PPP PS Sbjct: 148 TPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPS 191 Score = 31.5 bits (68), Expect = 0.75 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P P PP P P P P PP P + PP P P Sbjct: 190 PSVPSPPDVTPTP-PTPSVPSPPDVTPTPPTPSVPSPPDVTPTPP 233 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPP-XXXRAPLAPPPXXXPPS 753 P P P P P P P P P P++PPP PS Sbjct: 99 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPS 143 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPP-XXXRAPLAPPPXXXPPS 753 P P P P P P P P P P++PPP PS Sbjct: 117 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPS 161 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAP-LAP-PPXXXPPSP 756 TPP P P P P PP P P + P PP PSP Sbjct: 166 TPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSP 210 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PP P P P P P P PP P P P P PPP Sbjct: 195 PPDVTPTPPTPSVPSPP-DVTPTPPTPSVPSPPDVTPTPPTPPSVPTPSGSPPYVPPP 251 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/46 (32%), Positives = 15/46 (32%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAP-PPXXXPPSP 756 P P P P P P P P P P P P PP P Sbjct: 135 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPP 180 Score = 27.9 bits (59), Expect = 9.2 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +3 Query: 717 PPGPPPXXXPPLPXXXXPPPPXPPXRXPP--PXPFLAHXXXGXXXPPSXPP 863 PP P P PP PP P P PP P P PP PP Sbjct: 74 PPAPVPPVSPP------PPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP 118 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 47.2 bits (107), Expect = 1e-05 Identities = 27/81 (33%), Positives = 27/81 (33%), Gaps = 4/81 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPX-RXPP-- 803 PP P P P PP P PP PP P P PP PP PP Sbjct: 20 PPGTTGTCCPPPLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPL 79 Query: 804 -PXPFLAHXXXGXXXPPSXPP 863 P P L PP PP Sbjct: 80 FPPPPLPRLPPPLLPPPEEPP 100 Score = 46.0 bits (104), Expect = 3e-05 Identities = 25/77 (32%), Positives = 28/77 (36%) Frame = +3 Query: 582 IIXLXPINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXX 761 + L P++ P P P P P PP PP PP P LP Sbjct: 33 VFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPL-PPRFELPPPLFPPPPLPRLPPP 91 Query: 762 XXPPPPXPPXRXPPPXP 812 PPP PP PPP P Sbjct: 92 LLPPPEEPPREPPPPPP 108 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPX--PXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P PP P P PPP PP PPPP PP PP Sbjct: 56 PPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPP-PPPPEEPP 114 Query: 807 XP 812 P Sbjct: 115 PP 116 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 P P P P P P PP P PP PP P PPPP R P Sbjct: 68 PLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPPASCLRTKSP 125 Score = 38.3 bits (85), Expect = 0.007 Identities = 27/80 (33%), Positives = 27/80 (33%), Gaps = 4/80 (5%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXP--PLPXXXXPPPPX-PPXRXPP- 803 PP P P P P P PP P P PLP PPP PP P Sbjct: 29 PPPLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRL 88 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P L PP PP Sbjct: 89 PPPLLPPPEEPPREPPPPPP 108 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 634 PPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 PPP PPP P PP PP P PPP PP Sbjct: 76 PPPLFPPPPLPRLP---PPLLPPPE-EPPREPPPPPPPP 110 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 P PPPP PP PP PP P PPP Sbjct: 78 PLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPP 115 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/53 (30%), Positives = 18/53 (33%) Frame = +1 Query: 607 IYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSPXXG 765 ++ P PP PPP P PP PP P P SP G Sbjct: 79 LFPPPPLPRLPPPLLPPPEEPPREPPPPPPPP---EEPPPPASCLRTKSPENG 128 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 4/39 (10%) Frame = +1 Query: 652 PPPX--PXXXXPXPPXXPPXXXRAPLAPP--PXXXPPSP 756 PPP P PP PP P PP P PP P Sbjct: 29 PPPLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEP 67 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 47.2 bits (107), Expect = 1e-05 Identities = 31/78 (39%), Positives = 32/78 (41%), Gaps = 2/78 (2%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXG--GGGXXXXGRGGXXXGGGPGGPXXGXGGXX 689 GG GG + G GGG GG G GGG G GG GGG GG G GG Sbjct: 62 GGHNGGGGHGLDGY---GGGGGHYGGGGGHYGGGGGHYGGGGGHYGGG-GGHYGGGGGGH 117 Query: 688 GAXGXXXXGXGXXXXXGG 635 G G G G GG Sbjct: 118 GGGGHYGGGGGGYGGGGG 135 Score = 46.0 bits (104), Expect = 3e-05 Identities = 24/51 (47%), Positives = 24/51 (47%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GGG GG GG G GG GG GGGGG G Sbjct: 83 GGGGGHYGGGGGHYGGG-GGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGG 132 Score = 45.6 bits (103), Expect = 4e-05 Identities = 27/63 (42%), Positives = 27/63 (42%), Gaps = 3/63 (4%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXX---GRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXX 641 G GGG GG GGG G GG GGG GG G GG G G G G Sbjct: 54 GGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGG-GGHYGGGGGHYGGGGGHYGGGGGHYGG 112 Query: 640 GGG 632 GGG Sbjct: 113 GGG 115 Score = 44.8 bits (101), Expect = 8e-05 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG G GGG GGG G GG G GG GG GGGGG G Sbjct: 68 GGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGG 119 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 2/60 (3%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGP--GGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 GGG G GGGG G GG GGG GG GG G G G G GGG Sbjct: 67 GGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGG 126 Score = 43.2 bits (97), Expect = 2e-04 Identities = 27/63 (42%), Positives = 28/63 (44%), Gaps = 2/63 (3%) Frame = -3 Query: 814 KGXGGGXRXGGXGG-GGXXXXGRGGXXXGGGPG-GPXXGXGGXXGAXGXXXXGXGXXXXX 641 +G GGG GG GG GG G GG GGG G G GG G G G G Sbjct: 41 EGYGGGH--GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGG 98 Query: 640 GGG 632 GGG Sbjct: 99 GGG 101 Score = 42.7 bits (96), Expect = 3e-04 Identities = 26/60 (43%), Positives = 26/60 (43%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G GGG G GGG G GG GGG GG G GG G G G G GGG Sbjct: 74 GYGGGGGHYGGGGG---HYGGGGGHYGGG-GGHYGGGGGHYGGGGGGHGGGGHYGGGGGG 129 Score = 42.7 bits (96), Expect = 3e-04 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GGG GG GG G GG GG GGGG G Sbjct: 76 GGGGGHYGGGGGHYGGG-GGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGG 125 Score = 42.7 bits (96), Expect = 3e-04 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GGG GG GG G GG GG GGGG G Sbjct: 90 GGGGGHYGGGGGHYGGG-GGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGG 139 Score = 42.7 bits (96), Expect = 3e-04 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 3/51 (5%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQ---GGPXXXGGXXXGPGGXXXXXGGXXXGGGG 634 GGGG GGG GGG GG GG G GG GG GGGG Sbjct: 91 GGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGG 141 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/70 (38%), Positives = 27/70 (38%), Gaps = 2/70 (2%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGXG--GGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 G GG G GGG GG G GGG G GG GG GG G GG G Sbjct: 74 GYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGG--GGHYGGGGGGYG 131 Query: 685 AXGXXXXGXG 656 G G G Sbjct: 132 GGGGHHGGGG 141 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GG GGG GG G G G GG GG GGGGG G Sbjct: 46 GHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYG 97 Score = 39.9 bits (89), Expect = 0.002 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 3/60 (5%) Frame = -1 Query: 777 GGGG---PXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXGXXXIY 607 GGGG GGG GG GG GG G GG GG GGGGG G Y Sbjct: 66 GGGGHGLDGYGGGGGHYGGG--GGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHY 123 Score = 38.7 bits (86), Expect = 0.005 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGG-QGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGGG GGG GGG GG GG G GG GG GGG G Sbjct: 98 GGGGHYGGGGGHYGGGGGGHGG----GGHYGGGGGGYGGGGGHHGGGGHG 143 Score = 37.9 bits (84), Expect = 0.009 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 5/57 (8%) Frame = -1 Query: 777 GGGGPX---XXGGGXXXXG--GGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG GGG GG GG GG G GG GG GGGGG G Sbjct: 55 GGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYG 111 Score = 37.5 bits (83), Expect = 0.011 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXXGG-GXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GG GG G GGG G GG G GG GG GGGG G Sbjct: 60 GHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGG 112 Score = 35.1 bits (77), Expect = 0.061 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGR-GGXXXGGGPGGPXXGXGG 695 GG GG GGG GG GGGG G GG G G GG G GG Sbjct: 86 GGHYGGGGGHYGGGGGHYGGGGGHYGG-GGGGHGGGGHYGGGGGGYGGGGGHHGGGG 141 Score = 34.7 bits (76), Expect = 0.080 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 4/63 (6%) Frame = -1 Query: 783 EXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXX----GPGGXXXXXGGXXXGGGGGXXGXX 616 E GGG GG G G GG GG G GG GG GGGG G Sbjct: 41 EGYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGG 100 Query: 615 XIY 607 Y Sbjct: 101 GHY 103 Score = 33.9 bits (74), Expect = 0.14 Identities = 21/55 (38%), Positives = 22/55 (40%) Frame = -1 Query: 786 VEXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 V+ G G G G GGG G GG G G GG GGGGG G Sbjct: 38 VQPEGYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDG--YGGGGGHYGGGGGHYG 90 Score = 33.9 bits (74), Expect = 0.14 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -3 Query: 811 GXGGGXRXGG-XGGGGXXXXGRGGXXXGGGPG 719 G GGG GG GGGG G GG GGG G Sbjct: 112 GGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 46.8 bits (106), Expect = 2e-05 Identities = 25/63 (39%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPS 854 P P PP G P PPLP PPPP PP PPP P G PP Sbjct: 649 PRVPRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPP------GGGPPPPP 702 Query: 855 XPP 863 PP Sbjct: 703 PPP 705 Score = 35.5 bits (78), Expect = 0.046 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXP 699 P PPPP PPP P P PP P Sbjct: 680 PPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 34.7 bits (76), Expect = 0.080 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPP 702 P PPPP PP P P PP PP Sbjct: 679 PPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 33.5 bits (73), Expect = 0.19 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PP P + P P G PP PP P PPPP PPP P Sbjct: 648 PPRVPRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPP-PGGGPPPPPGGGPPPPPPPP 705 Score = 31.9 bits (69), Expect = 0.57 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 PP P PPP P PP PP P PPP Sbjct: 672 PPLPGGGPPPPPPPPGGGPP-PPPGGGPPPPPPPP 705 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 655 PPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 PP P P PP PP P PPP PP P Sbjct: 672 PPLPGGGPPPPP--PPPGGGPP--PPPGGGPPPP 701 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 46.8 bits (106), Expect = 2e-05 Identities = 27/67 (40%), Positives = 27/67 (40%), Gaps = 5/67 (7%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXA-PXXPPXPXXGPPGP-PPXXXPPLPXXXX--PPPPXPPXR 794 H PPP P P P P P P PP P PP PP P PP P PP Sbjct: 156 HKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVI 215 Query: 795 XPP-PXP 812 PP P P Sbjct: 216 TPPTPTP 222 Score = 44.8 bits (101), Expect = 8e-05 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPP-PPXPPXRXPPPX 809 P P P P P PP PP PP P P PP P PP PPP Sbjct: 102 PKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPT 161 Query: 810 P 812 P Sbjct: 162 P 162 Score = 41.5 bits (93), Expect = 7e-04 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 H PP P P P PP PP P P P PPP P P P Sbjct: 111 HPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTP 170 Query: 807 XP 812 P Sbjct: 171 TP 172 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/78 (29%), Positives = 24/78 (30%), Gaps = 1/78 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPX-PXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPX 809 P P P P P P P P PP P PP PP P PP Sbjct: 47 PKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPT 106 Query: 810 PFLAHXXXGXXXPPSXPP 863 H PP+ PP Sbjct: 107 KPHPHPKPPIVKPPTKPP 124 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +3 Query: 684 APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 AP PP PP PP PP P PP P PP P P P Sbjct: 35 APHKPPKHPVKPP-KPPAVKPPKPPAVKPPTPKPPTVKPHPKP 76 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Frame = +3 Query: 633 PPPXXXXXPX-PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP-P 806 PPP P P P P P P P PP PP P P P PP PP P Sbjct: 123 PPPSTPKPPTKPPPSTPKPPTTKPPP--STPKPPHHKPPPTPCPPPTPTPTPPVVTPPTP 180 Query: 807 XP 812 P Sbjct: 181 TP 182 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 1/60 (1%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP-PXP 812 PP P P P P PP P PP P P P PP P PP PP P P Sbjct: 146 PPPSTPKP-PHHKPPPTPCPPPTPTPTPPVVTP--PTPTPPVITPPTPTPPVVTPPTPTP 202 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P TP PP PPP P P P P P PP PP+P Sbjct: 148 PSTPKPPHHKPPPTP--CPPPTPTPTPPVVTPPTPTPPVITPPTP 190 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPX--PPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP PPP P P PP P P PP PP+P Sbjct: 154 PHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTP 200 Score = 38.7 bits (86), Expect = 0.005 Identities = 23/79 (29%), Positives = 23/79 (29%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 H PP P P P P P P P PP P P P PP P P Sbjct: 82 HPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPK-PPIVKPPTKPPPSTPKPPTKPPPSTPK 140 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P P PP Sbjct: 141 PPTTKPPPSTPKPPHHKPP 159 Score = 38.7 bits (86), Expect = 0.005 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 7/67 (10%) Frame = +3 Query: 633 PPPXXXXXPX---PXXXXPXAPXXPPXPXXGPPGP-PPXXXPPLPXXXX--PPPPXPPXR 794 PPP P P P P P PP P PP PP P PP P PP Sbjct: 146 PPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVI 205 Query: 795 XPP-PXP 812 PP P P Sbjct: 206 TPPTPTP 212 Score = 38.3 bits (85), Expect = 0.007 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXP-PLPXXXXPPPPXPPXRXPP-P 806 PP P P P P PP P PP P P P PP P PP PP P Sbjct: 182 PPVITPPTPTPPVVTPPTPT-PPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTP 240 Query: 807 XP 812 P Sbjct: 241 TP 242 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/49 (38%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = +1 Query: 622 PXTPPPPXXXPP-PXP---XXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P TP PP PP P P P PP P P+ PP PP+P Sbjct: 197 PPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTP 245 Score = 37.5 bits (83), Expect = 0.011 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 1/60 (1%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP-PXP 812 PP P P P P P PPP P P PP P PP PP P P Sbjct: 134 PPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPP-TPTPTPPVVTPPTPTPPVITPPTPTP 192 Score = 37.1 bits (82), Expect = 0.015 Identities = 25/86 (29%), Positives = 27/86 (31%), Gaps = 7/86 (8%) Frame = +3 Query: 627 HXPPPXXXXXPXP--XXXXPXAPXXPPXPXXGPPGPPPXXXPPL---PXXXXPPPPXPPX 791 H PP P P P P P P P P PP+ P P P PP Sbjct: 73 HPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPT 132 Query: 792 RXPP--PXPFLAHXXXGXXXPPSXPP 863 + PP P P PP P Sbjct: 133 KPPPSTPKPPTTKPPPSTPKPPHHKP 158 Score = 37.1 bits (82), Expect = 0.015 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 4/64 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPL----PXXXXPPPPXPPXRXP 800 P P P P P P P P PP PP P PP P PP Sbjct: 110 PHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPT 169 Query: 801 PPXP 812 P P Sbjct: 170 PTPP 173 Score = 37.1 bits (82), Expect = 0.015 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P TP PP PPP P P P PP PP+P Sbjct: 136 PSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTP 180 Score = 36.7 bits (81), Expect = 0.020 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXP-PLPXXXXPPPPXPPXRXPPPX 809 PP P P P P PP P PP P P P PP P PP P Sbjct: 192 PPVVTPPTPTPPVITPPTPT-PPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTPIPETC 250 Query: 810 P 812 P Sbjct: 251 P 251 Score = 36.3 bits (80), Expect = 0.026 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P TP PP PP P PP P P PP PP+P Sbjct: 177 PPTPTPP-VITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTP 220 Score = 35.9 bits (79), Expect = 0.035 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P TP PP PP P PP P P PP PP+P Sbjct: 187 PPTPTPP-VVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTP 230 Score = 35.5 bits (78), Expect = 0.046 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXX--PPXXXRAPL-APPPXXXPP 750 P PPP PP P P PP PP + P PPP PP Sbjct: 120 PTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPP 165 Score = 35.5 bits (78), Expect = 0.046 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPP-PXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P TP P P PP P PP P P PP PP+P Sbjct: 165 PPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTP 210 Score = 35.1 bits (77), Expect = 0.061 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 3/62 (4%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPG-PPPXXXPPLPXXXXPPPP--XPPXRXPPP 806 PP P P P P PP PP PP P PP PP + PP Sbjct: 67 PPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPS 126 Query: 807 XP 812 P Sbjct: 127 TP 128 Score = 35.1 bits (77), Expect = 0.061 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +1 Query: 622 PXTPPPPXXXPP--PXPXXXXPXPPXXPPXXXRAPLAP-PPXXXPPSP 756 P TP PP PP P P P P P + P P PP P+P Sbjct: 125 PSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTP 172 Score = 34.3 bits (75), Expect = 0.11 Identities = 23/78 (29%), Positives = 23/78 (29%), Gaps = 2/78 (2%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP- 812 PP P P P PP PP PP P P P PP P P P Sbjct: 29 PPKPSPAPHKPPKHPVKPPKPPAVK--PPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPP 86 Query: 813 -FLAHXXXGXXXPPSXPP 863 H PP P Sbjct: 87 TVKPHPKPPTVKPPHPKP 104 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXP-PXXPPXXXRAPLAPPPXXXPPS 753 P TP PP P P P P P P + P PP PP+ Sbjct: 62 PPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPT 106 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPX---PPXXPPXXXRAPLAPPPXXXPPS 753 P PP P P P P PP P + P+ PP PPS Sbjct: 83 PKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPS 126 Score = 33.9 bits (74), Expect = 0.14 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 1/58 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGP-PPXXXPPLPXXXXPPPPXPPXRXPP 803 P P P P P P P PP P PP PP P PP PP PP Sbjct: 180 PTPPVITPPTPTPPV-VTPPTPTPPVITPPTPTPPVITPPTPT---PPVVTPPTPTPP 233 Score = 33.1 bits (72), Expect = 0.25 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAP-PPXXXPPS 753 P T PP PP P P PP P P P PP PPS Sbjct: 94 PPTVKPPHPKPPTKP-HPHPKPPIVKPPTKPPPSTPKPPTKPPPS 137 Score = 31.9 bits (69), Expect = 0.57 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P PP P P P P P PP + P PPP P Sbjct: 100 PHPKPPTKPHPHPKPPIVKP-PTKPPPSTPKPPTKPPPSTPKP 141 Score = 31.1 bits (67), Expect = 0.99 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 7/50 (14%) Frame = +1 Query: 628 TPP---PPXXXP----PPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 TPP PP P PP P PP P P PP PP+P Sbjct: 191 TPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTP 240 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +1 Query: 628 TPPPPXXXP--PPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 TPP P P PP P PP P + P PP PP+ Sbjct: 28 TPPKPSPAPHKPPKHPVKPPKPPAVKPP--KPPAVKPPTPKPPT 69 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/42 (30%), Positives = 14/42 (33%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP 747 P PP PP P P PP P + P P P Sbjct: 36 PHKPPKHPVKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPP 77 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 6/51 (11%) Frame = +1 Query: 622 PXTPPP-----PXXXPPPXPXXXXPXPP-XXPPXXXRAPLAPPPXXXPPSP 756 P T P P PP P P PP PP + P PP P P Sbjct: 104 PPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPP 154 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 46.8 bits (106), Expect = 2e-05 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G GGG R GG GGG GG GGG G G GG G G G GGG Sbjct: 90 GGGGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGG 149 Score = 41.5 bits (93), Expect = 7e-04 Identities = 27/66 (40%), Positives = 28/66 (42%), Gaps = 7/66 (10%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGX-----GGGGXXXXGR--GGXXXGGGPGGPXXG 704 GG GG R+G GG GG GGGG GR GG GGG GG G Sbjct: 93 GGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGG 152 Query: 703 XGGXXG 686 GG G Sbjct: 153 SGGGGG 158 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGGG GGG GGG G GG G GG GG G GGG Sbjct: 110 GGGGYSGGGGGYSSRGGGGGS--YGGGRREGGGGYGGGEGGGYGGSGGG 156 Score = 38.3 bits (85), Expect = 0.007 Identities = 24/53 (45%), Positives = 24/53 (45%), Gaps = 8/53 (15%) Frame = -3 Query: 811 GXGGGXRXGGXG----GGGXXXXGRGGXXXGGGP----GGPXXGXGGXXGAXG 677 G GGG R GG G GGG G GG GGG GG G GG G G Sbjct: 102 GGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSG 154 Score = 37.9 bits (84), Expect = 0.009 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GGG G GG GG GG GGGG G Sbjct: 97 GGGSYGGGGGRREGGGGYSG---GGGGYSSRGGGGGSYGGGRREGGGGYGG 144 Score = 37.9 bits (84), Expect = 0.009 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG GGG GGG GG GG GG GG GG GG G Sbjct: 102 GGGGGRREGGGGYS-GGG-GGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYG 151 Score = 35.9 bits (79), Expect = 0.035 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = -3 Query: 784 GXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G GGGG RGG GGG GG G GG G G G GGG Sbjct: 88 GSGGGGGH---RGGGSYGGG-GGRREGGGGYSGGGGGYSSRGGGGGSYGGG 134 Score = 35.1 bits (77), Expect = 0.061 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GGG G GG G GG GG GGG G Sbjct: 90 GGGGGHRGGGSY--GGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREG 138 Score = 32.3 bits (70), Expect = 0.43 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 732 GGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGG 634 G G GG GG G GG GG GGGG Sbjct: 88 GSGGGGGHRGGGSYGGGGGRREGGGGYSGGGGG 120 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/62 (37%), Positives = 24/62 (38%), Gaps = 1/62 (1%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRX-PPPXP 812 PP P P A PP PP PP PP P PPP PP PPP P Sbjct: 41 PPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIP 100 Query: 813 FL 818 + Sbjct: 101 IV 102 Score = 46.0 bits (104), Expect = 3e-05 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 2/60 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLP--XXXXPPPPXPPXRXPPP 806 PPP P P P PP PP P PP P PP P PP + PPP Sbjct: 90 PPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPPEQLPPP 149 Score = 42.3 bits (95), Expect = 4e-04 Identities = 25/82 (30%), Positives = 26/82 (31%), Gaps = 5/82 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPP-----LPXXXXPPPPXPPXRX 797 P P P P + PP PP PP PP LP PPP Sbjct: 10 PAPSADSAPPPDTSSDGSAAPPPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPP 69 Query: 798 PPPXPFLAHXXXGXXXPPSXPP 863 PPP PPS PP Sbjct: 70 PPPLDSSPPPPPDLTPPPSSPP 91 Score = 42.3 bits (95), Expect = 4e-04 Identities = 29/86 (33%), Positives = 31/86 (36%), Gaps = 9/86 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPG---PPPXXXPPLPXXXXP----PPPXPPX 791 PPP P P P PP P PP PPP PP+P P PPP Sbjct: 61 PPPTVSSPPPP----PLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTN 116 Query: 792 RXPPPXPFLAHXXXG--XXXPPSXPP 863 PPP F PP+ PP Sbjct: 117 SPPPPEVFEPPPPPADEDESPPAPPP 142 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 2/60 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPP--PPXPPXRXPPP 806 PPP P P PP P PPP P P PP PP P PPP Sbjct: 47 PPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPP 106 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P + PPP PPP P P PP +P PP PP P Sbjct: 86 PPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSP-PPPEVFEPPPP 129 Score = 37.5 bits (83), Expect = 0.011 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPP PPP P P PP +P PPP PP P Sbjct: 60 SPPPTVSSPPPPPLDSSPPPPPDLTPPPSSP--PPPDAPPPIP 100 Score = 37.5 bits (83), Expect = 0.011 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLA---PPPXXXPP 750 PPPP PP P P P PP P+ PPP PP Sbjct: 69 PPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPP 111 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 PPP PPP P PP PP P A P P P Sbjct: 119 PPPEVFEPPPPPADEDESPPAPPPPEQLPPPASSPQGGPKKP 160 Score = 34.7 bits (76), Expect = 0.080 Identities = 18/50 (36%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +1 Query: 604 IIYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP-XXXPP 750 I++ +PPP PP P P PP P +P APPP PP Sbjct: 101 IVFPPPIDSPPPESTNSPPPPEVFEPPPP--PADEDESPPAPPPPEQLPP 148 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 PPP PPP P PP P A +PPP P P Sbjct: 30 PPPTDSAPPPSPPADSSPPPALPSLPP-AVFSPPPTVSSPPP 70 Score = 34.3 bits (75), Expect = 0.11 Identities = 29/99 (29%), Positives = 32/99 (32%), Gaps = 9/99 (9%) Frame = +3 Query: 582 IIXLXPINHIXXXXXHXPPPXXXXXPXP----XXXXPXAPXXP---PXPXXGPPGPP--P 734 I+ PI+ + PPP P P P AP P P P P G P P Sbjct: 101 IVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPPEQLPPPASSPQGGPKKP 160 Query: 735 XXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPP 851 P P PP P P PP P PP Sbjct: 161 KKHHPGP-ATSPPAPSAPATSPPAPPNAPPRNSSHALPP 198 Score = 33.5 bits (73), Expect = 0.19 Identities = 23/92 (25%), Positives = 26/92 (28%), Gaps = 3/92 (3%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 PI + PPP P P P P PPP PP P Sbjct: 98 PIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPPEQLPPPASSPQGGP 157 Query: 777 PXPPXRXPPP---XPFLAHXXXGXXXPPSXPP 863 P P P P + PP+ PP Sbjct: 158 KKPKKHHPGPATSPPAPSAPATSPPAPPNAPP 189 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 3/48 (6%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXP---XPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP PPP P PP P PPP P P Sbjct: 81 PDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPP 128 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PP PPP P PP +P PP PP P Sbjct: 37 PPPSPPADSSPPP-ALPSLPPAVFSPPPTVSSPPPPPLDSSPPPP 80 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/41 (31%), Positives = 15/41 (36%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 +PPP PP P PP + PPP PP Sbjct: 46 SPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPP 86 Score = 27.9 bits (59), Expect = 9.2 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = +3 Query: 684 APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPP---S 854 +P P PP P PPP PP PP P L PP S Sbjct: 8 SPPAPSADSAPPPDTSSDGSAAPPPTDSAPPPSPPADSSPP-PALPSLPPAVFSPPPTVS 66 Query: 855 XPP 863 PP Sbjct: 67 SPP 69 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 6/44 (13%) Frame = +1 Query: 637 PPXXXPPPXPXXXXPXP------PXXPPXXXRAPLAPPPXXXPP 750 PP PP P P P P PP P +PPP PP Sbjct: 55 PPAVFSPP-PTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPP 97 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 46.4 bits (105), Expect = 2e-05 Identities = 25/77 (32%), Positives = 28/77 (36%), Gaps = 1/77 (1%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPX-APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PP P P P +P P PPP P P PPPP P PPP Sbjct: 346 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYTYSPPPYAYSPPPPCPDVYKPPPYV 405 Query: 813 FLAHXXXGXXXPPSXPP 863 + + PPS PP Sbjct: 406 YSSPPPYVYNPPPSSPP 422 Score = 33.5 bits (73), Expect = 0.19 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 4/64 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPP---XPPXRXP 800 P P P P P P P PP P P P PPP PP P Sbjct: 362 PSPYVYKSPPYVYSSPPPYTYSPPPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSP 421 Query: 801 PPXP 812 PP P Sbjct: 422 PPSP 425 Score = 33.1 bits (72), Expect = 0.25 Identities = 22/80 (27%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P P PP P PPP P PP Sbjct: 139 PPPYVYSSPPPYAYSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYV 198 Query: 813 FLAHXXXGXXXPP---SXPP 863 + + PP S PP Sbjct: 199 YSSPPPYAYSPPPYAYSPPP 218 Score = 33.1 bits (72), Expect = 0.25 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPP----GPPPXXXPPLPXXXXPPPPXP 785 + PPP P P P PP PP PPP PP P PP P Sbjct: 382 YSPPPYAYSPPPPC---PDVYKPPPYVYSSPPPYVYNPPPSSPPPSPSYSYSSPPPP 435 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/46 (32%), Positives = 17/46 (36%) Frame = +3 Query: 717 PPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPS 854 PP PPP P PPP P PP + + PPS Sbjct: 32 PPSPPPYVYSSPPPYTYSPPPSPYVYKSPPYVYSSPPPYAYSPPPS 77 Score = 32.7 bits (71), Expect = 0.32 Identities = 21/69 (30%), Positives = 24/69 (34%), Gaps = 7/69 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXX--XPPLPXXXXPPP-----PXPPX 791 PPP P P +P P PPP PP P PP P P Sbjct: 202 PPPYAYSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYA 261 Query: 792 RXPPPXPFL 818 PPP P++ Sbjct: 262 YSPPPSPYV 270 Score = 32.3 bits (70), Expect = 0.43 Identities = 17/52 (32%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP-----PXPPXRXPPPXPFL 818 P +P PP P P PP P PP P P PPP P++ Sbjct: 29 PYSPPSPPPYVYSSPPPYTYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYV 80 Score = 32.3 bits (70), Expect = 0.43 Identities = 22/70 (31%), Positives = 25/70 (35%), Gaps = 8/70 (11%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX-APXXPPXPXXGPPGPPPXX--XPPLPXXXXPPP-----PXPP 788 PPP P P P +P P PPP PP P PP P P Sbjct: 35 PPPYVYSSPPPYTYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPY 94 Query: 789 XRXPPPXPFL 818 PPP P++ Sbjct: 95 AYSPPPSPYV 104 Score = 31.9 bits (69), Expect = 0.57 Identities = 21/74 (28%), Positives = 24/74 (32%), Gaps = 1/74 (1%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPX-APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PP P P P +P P PPP P P PPP P PP Sbjct: 171 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSP-PPYAYSPPPSPYVYKSPPYV 229 Query: 813 FLAHXXXGXXXPPS 854 + + PPS Sbjct: 230 YSSPPPYAYSPPPS 243 Score = 31.5 bits (68), Expect = 0.75 Identities = 23/78 (29%), Positives = 25/78 (32%), Gaps = 5/78 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPP-----GPPPXXXPPLPXXXXPPPPXPPXRXP 800 PP P P P PP PP PPP P P PPP P Sbjct: 115 PPPYAYSPPPS---PYVYKSPPYVYSSPPPYVYSSPPPYAYSP-PPYAYSPPPSPYVYKS 170 Query: 801 PPXPFLAHXXXGXXXPPS 854 PP + + PPS Sbjct: 171 PPYVYSSPPPYAYSPPPS 188 Score = 31.1 bits (67), Expect = 0.99 Identities = 19/73 (26%), Positives = 21/73 (28%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 PP P P P P P PP P PPP P PP + Sbjct: 195 PPYVYSSPPPYAYSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVY 254 Query: 816 LAHXXXGXXXPPS 854 + PPS Sbjct: 255 SSPPPYAYSPPPS 267 Score = 29.9 bits (64), Expect = 2.3 Identities = 23/72 (31%), Positives = 25/72 (34%), Gaps = 11/72 (15%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPP----GPPPXX--XPPLPXXXXPPP-----PX 782 PP P P P PP PP PPP PP P PP P Sbjct: 178 PPPYAYSPPPS---PYVYKSPPYVYSSPPPYAYSPPPYAYSPPPSPYVYKSPPYVYSSPP 234 Query: 783 PPXRXPPPXPFL 818 P PPP P++ Sbjct: 235 PYAYSPPPSPYV 246 Score = 29.5 bits (63), Expect = 3.0 Identities = 22/85 (25%), Positives = 25/85 (29%), Gaps = 9/85 (10%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXX----PPXPXXGPPGP-----PPXXXPPLPXXXXPPPP 779 + PPP P P PP PP P PP P PPP Sbjct: 207 YSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPP 266 Query: 780 XPPXRXPPPXPFLAHXXXGXXXPPS 854 P PP + + PPS Sbjct: 267 SPYVYKSPPYVYSSPPPYAYSPPPS 291 Score = 29.1 bits (62), Expect = 4.0 Identities = 22/83 (26%), Positives = 24/83 (28%), Gaps = 9/83 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX----PPXPXXGPPGP-----PPXXXPPLPXXXXPPPPXP 785 PPP P P PP PP P PP P PPP P Sbjct: 43 PPPYTYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 102 Query: 786 PXRXPPPXPFLAHXXXGXXXPPS 854 PP + + PPS Sbjct: 103 YVYKSPPYVYSSPPPYAYSPPPS 125 Score = 29.1 bits (62), Expect = 4.0 Identities = 22/83 (26%), Positives = 24/83 (28%), Gaps = 9/83 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX----PPXPXXGPPGP-----PPXXXPPLPXXXXPPPPXP 785 PPP P P PP PP P PP P PPP P Sbjct: 233 PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 292 Query: 786 PXRXPPPXPFLAHXXXGXXXPPS 854 PP + + PPS Sbjct: 293 YVYKSPPYVYSSPPPYAYSPPPS 315 Score = 29.1 bits (62), Expect = 4.0 Identities = 22/83 (26%), Positives = 24/83 (28%), Gaps = 9/83 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX----PPXPXXGPPGP-----PPXXXPPLPXXXXPPPPXP 785 PPP P P PP PP P PP P PPP P Sbjct: 257 PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 316 Query: 786 PXRXPPPXPFLAHXXXGXXXPPS 854 PP + + PPS Sbjct: 317 YVYKSPPYVYSSPPPYAYSPPPS 339 Score = 29.1 bits (62), Expect = 4.0 Identities = 22/83 (26%), Positives = 24/83 (28%), Gaps = 9/83 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX----PPXPXXGPPGP-----PPXXXPPLPXXXXPPPPXP 785 PPP P P PP PP P PP P PPP P Sbjct: 281 PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 340 Query: 786 PXRXPPPXPFLAHXXXGXXXPPS 854 PP + + PPS Sbjct: 341 YVYKSPPYVYSSPPPYAYSPPPS 363 Score = 29.1 bits (62), Expect = 4.0 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRX 797 + PPP P P PP PP P P P P PPP Sbjct: 358 YSPPPSPYVYKSPPYVYSSPPPYTYSPPPYAYSPPPPCPDVYKPPPYVYSSPPPY--VYN 415 Query: 798 PPP 806 PPP Sbjct: 416 PPP 418 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +1 Query: 634 PPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 PPP P P P P PP + +PPP Sbjct: 401 PPPYVYSSPPPYVYNPPPSSPPPSPSYSYSSPPP 434 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/62 (29%), Positives = 21/62 (33%), Gaps = 1/62 (1%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPX-APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PP P P P +P P PPP P PPP PPP P Sbjct: 108 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYVYSSPPPYAYSPPPY--AYSPPPSP 165 Query: 813 FL 818 ++ Sbjct: 166 YV 167 Score = 28.7 bits (61), Expect = 5.3 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 4/61 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPP----GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P P PP PPP P P PP P PP Sbjct: 377 PPPYTYSPPPYAYSPPPPC--PDVYKPPPYVYSSPPPYVYNP-PPSSPPPSPSYSYSSPP 433 Query: 804 P 806 P Sbjct: 434 P 434 Score = 27.9 bits (59), Expect = 9.2 Identities = 23/77 (29%), Positives = 25/77 (32%), Gaps = 15/77 (19%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX----PPXPXXGPP----GPPPXX--XPPLPXXXXPPP-- 776 PPP P P PP PP PPP PP P PP Sbjct: 115 PPPYAYSPPPSPYVYKSPPYVYSSPPPYVYSSPPPYAYSPPPYAYSPPPSPYVYKSPPYV 174 Query: 777 ---PXPPXRXPPPXPFL 818 P P PPP P++ Sbjct: 175 YSSPPPYAYSPPPSPYV 191 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 46.4 bits (105), Expect = 2e-05 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 663 PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P PP P PP PPP PP P PPP PPP P Sbjct: 48 PIKCSPSCIQNPPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPP 97 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 P P PP PPP P P PP + PPP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPP 96 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSPXXG 765 P PPP PPP P P PP PP P G Sbjct: 71 PPACPPPPALPPPPPKKVSSYCPPPPPANFLYITGPPGNLYPVDEQFG 118 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 753 PXXXXPPPPXPPXRXPPPXPFL 818 P PPPP PP PP P L Sbjct: 59 PPPPSPPPPSPPPPACPPPPAL 80 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 46.0 bits (104), Expect = 3e-05 Identities = 26/76 (34%), Positives = 26/76 (34%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P PP P P PP PP P P P PP P P P Sbjct: 34 PPPKPQPKPPPAPSPSPCPSPPPKPQPKPV--PPPACPPTPPKPQPKPAPPPEPKPAPPP 91 Query: 813 FLAHXXXGXXXPPSXP 860 A PP P Sbjct: 92 --APKPVPCPSPPKPP 105 Score = 46.0 bits (104), Expect = 3e-05 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P P PP P P P P PP PP P P P Sbjct: 54 PPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVP 113 Score = 45.6 bits (103), Expect = 4e-05 Identities = 28/73 (38%), Positives = 29/73 (39%), Gaps = 4/73 (5%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXXGP-PGPPPXXXP-PLPXXXXPP-PPXP-PXRXPPPXPFLAH 824 P P P PP P P P PPP P P+P PP PP P P PPP P A Sbjct: 30 PCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAP 89 Query: 825 XXXGXXXPPSXPP 863 P PP Sbjct: 90 PPAPKPVPCPSPP 102 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/78 (33%), Positives = 26/78 (33%), Gaps = 1/78 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPPPX 809 P P P P P P PP P PP P P P P P P P PPP Sbjct: 62 PVPPPACPPTPPKPQPK-PAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPK 120 Query: 810 PFLAHXXXGXXXPPSXPP 863 P A P PP Sbjct: 121 PAPAPTPAPSPKPAPSPP 138 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P AP P P GPP P P P P P P P Sbjct: 89 PPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKPENKTIPAV 148 Query: 813 F 815 F Sbjct: 149 F 149 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/64 (39%), Positives = 26/64 (40%), Gaps = 2/64 (3%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPP-LPXXXXPPPPXP-PXRXPPPXPFLAHXXXGXXXPP 851 P AP P PPGP P PP P PP P P P PPP P PP Sbjct: 12 PVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKP-----QPKPVPPP 66 Query: 852 SXPP 863 + PP Sbjct: 67 ACPP 70 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P P P PP PP P P P P PP P Sbjct: 81 PPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKP 140 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/77 (32%), Positives = 25/77 (32%), Gaps = 1/77 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXP-PXRXPPPX 809 P P P P P PP P P P P PP P PP P P P PP Sbjct: 48 PSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAP---PPEPKPAPPPAPKPVPCPSPPKP 104 Query: 810 PFLAHXXXGXXXPPSXP 860 P PP P Sbjct: 105 PAPTPKPVPPHGPPPKP 121 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/76 (28%), Positives = 22/76 (28%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 PP P P PP P PP P P P P P PP PP P Sbjct: 15 PPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPK 74 Query: 816 LAHXXXGXXXPPSXPP 863 P PP Sbjct: 75 PQPKPAPPPEPKPAPP 90 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/76 (28%), Positives = 22/76 (28%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P P P P P P P PP P P PP P P PP P Sbjct: 10 PKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACP 69 Query: 813 FLAHXXXGXXXPPSXP 860 PP P Sbjct: 70 PTPPKPQPKPAPPPEP 85 Score = 39.9 bits (89), Expect = 0.002 Identities = 25/75 (33%), Positives = 25/75 (33%), Gaps = 1/75 (1%) Frame = +3 Query: 639 PXXXXXPXPXXXXPXAPXXPPXPXXGP-PGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 P P P P P P P P P P P PP P PPP P P P P Sbjct: 22 PVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSP---PPKPQPKPVPPPACPPTPPKPQPK 78 Query: 816 LAHXXXGXXXPPSXP 860 A PP P Sbjct: 79 PAPPPEPKPAPPPAP 93 Score = 38.7 bits (86), Expect = 0.005 Identities = 25/78 (32%), Positives = 26/78 (33%), Gaps = 1/78 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLP-XXXXPPPPXPPXRXPPPX 809 P P P P P AP P P PP P PP P P PP P P P Sbjct: 8 PSPKPVAPPGPSSK-PVAPPGPS-PCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPP 65 Query: 810 PFLAHXXXGXXXPPSXPP 863 P P+ PP Sbjct: 66 PACPPTPPKPQPKPAPPP 83 Score = 37.9 bits (84), Expect = 0.009 Identities = 24/81 (29%), Positives = 24/81 (29%), Gaps = 4/81 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP----PXXXPPLPXXXXPPPPXPPXRXP 800 P P P P P P P P PP P P P P PP P P Sbjct: 38 PQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVP 97 Query: 801 PPXPFLAHXXXGXXXPPSXPP 863 P P PP PP Sbjct: 98 CPSPPKPPAPTPKPVPPHGPP 118 Score = 37.5 bits (83), Expect = 0.011 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSPXXG 765 P TPP P P P P PP P +P PP P P G Sbjct: 69 PPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHG 116 Score = 36.3 bits (80), Expect = 0.026 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXP-XXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PP P PPP P P PP P P A PP P P Sbjct: 32 PSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQP 77 Score = 36.3 bits (80), Expect = 0.026 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PP P PPP P P PP P+ PP PP P Sbjct: 79 PAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPV--PPHGPPPKP 121 Score = 35.9 bits (79), Expect = 0.035 Identities = 22/64 (34%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXX-PPLPXXXXPPPPXPPXRXPP-PXPFLAHXXXGXXXPP 851 P P P P PPGP PP P PPP P + PP P P P Sbjct: 3 PPTPDPSPKPV-APPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPK 61 Query: 852 SXPP 863 PP Sbjct: 62 PVPP 65 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXR-APLAPPPXXXPPSP 756 P P P PPP P PP PP + P PP P+P Sbjct: 44 PAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAP 89 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP P P P P PP P+ PP PP+P Sbjct: 30 PCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPV--PPPACPPTP 72 Score = 33.5 bits (73), Expect = 0.19 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P PP P P P P P PP P P P PP Sbjct: 40 PKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPP 82 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP P P P P P P P P P PP+P Sbjct: 50 PCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKP-APPPAP 93 Score = 33.5 bits (73), Expect = 0.19 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXP-PPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP P PP P PP P AP P P PP P Sbjct: 60 PKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAP-KPVPCPSPPKP 104 Score = 32.7 bits (71), Expect = 0.32 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP-PSP 756 P P P P P P P PP P P PPP P P+P Sbjct: 83 PEPKPAPPPAPKPVPCPSPPKPPAPTPKPV-PPHGPPPKPAPAPTP 127 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PP P P P PP P AP +P P PP P Sbjct: 97 PCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAP-SPKPAPSPPKP 140 Score = 31.5 bits (68), Expect = 0.75 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PP P P P P PP P PP P+P Sbjct: 65 PPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTP 109 Score = 31.1 bits (67), Expect = 0.99 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP---PSP 756 P P P PPP P P P APPP P PSP Sbjct: 54 PPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSP 101 Score = 31.1 bits (67), Expect = 0.99 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P P P PP P P P P P AP P P P Sbjct: 58 PQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPP 102 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRA-PLAPPPXXXPP 750 P PP P P P P PP P + P P P PP Sbjct: 22 PVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPP 65 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPP-PXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P TP P P PP P PP P P P PSP Sbjct: 3 PPTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSP 48 Score = 29.9 bits (64), Expect = 2.3 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 6/51 (11%) Frame = +1 Query: 622 PXTPPPPXXXP---PPXPXX--XXPXPPXXPPXXXRAPLAPPPXXXP-PSP 756 P PP P P PP P P PP PP P P P PSP Sbjct: 87 PAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSP 137 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 45.6 bits (103), Expect = 4e-05 Identities = 29/85 (34%), Positives = 30/85 (35%), Gaps = 9/85 (10%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPG-PPPXXXP--------P 749 P +H PPP P P P P PP P PP PPP P P Sbjct: 13 PPSHQHPLPSPVPPPPSHISPPPPPFSP--PHHPPPPHFSPPHQPPPSPYPHPHPPPPSP 70 Query: 750 LPXXXXPPPPXPPXRXPPPXPFLAH 824 P PPPP PPP P H Sbjct: 71 YPHPHQPPPPPHVLPPPPPTPAPGH 95 Score = 44.0 bits (99), Expect = 1e-04 Identities = 25/79 (31%), Positives = 27/79 (34%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 + PP P P P PP P P PPP P PP P P PPP Sbjct: 11 YSPPSHQHPLPSPVPPPPSHISPPPPPFSPPHHPPPPHFS--PPHQPPPSPYPHPHPPPP 68 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P+ H P PP Sbjct: 69 SPY-PHPHQPPPPPHVLPP 86 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 634 PPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P P PPP P PP PP P PP PPSP Sbjct: 19 PLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSP 59 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 45.6 bits (103), Expect = 4e-05 Identities = 26/65 (40%), Positives = 27/65 (41%), Gaps = 4/65 (6%) Frame = -3 Query: 814 KGXGGGXRXGGXGGGGXXXXGRGGXXXGGGP----GGPXXGXGGXXGAXGXXXXGXGXXX 647 +G GGG G GGGG G GG GGG GG G GG G G G Sbjct: 87 RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 146 Query: 646 XXGGG 632 GGG Sbjct: 147 SYGGG 151 Score = 45.6 bits (103), Expect = 4e-05 Identities = 30/78 (38%), Positives = 30/78 (38%), Gaps = 2/78 (2%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGX--GGGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 G GG R G GGG GG GGGG G GG GGG G G GG Sbjct: 90 GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREG-GGGYSGGGGGYSSRGGGGGSY 148 Query: 685 AXGXXXXGXGXXXXXGGG 632 G G G GGG Sbjct: 149 GGGRREGGGGYGGGEGGG 166 Score = 45.2 bits (102), Expect = 6e-05 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGG 634 GGGG GGG GG GG GG G GG GG GGGG Sbjct: 90 GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGG 137 Score = 41.9 bits (94), Expect = 5e-04 Identities = 27/67 (40%), Positives = 28/67 (41%), Gaps = 8/67 (11%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXG------GGGXXXXGR--GGXXXGGGPGGPXX 707 GG GG R+ GGG GG G GGG GR GG GGG GG Sbjct: 109 GGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYG 168 Query: 706 GXGGXXG 686 G GG G Sbjct: 169 GSGGGGG 175 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGGG GGG GGG G GG G GG GG G GGG Sbjct: 127 GGGGYSGGGGGYSSRGGGGGS--YGGGRREGGGGYGGGEGGGYGGSGGG 173 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG GGG GGG G GG GG GG GGGG G Sbjct: 113 GGGGSYGGGGGRREGGGGYSG---GGGGYSSRGGGGGSYGGGRREGGGGYGG 161 Score = 39.9 bits (89), Expect = 0.002 Identities = 27/84 (32%), Positives = 27/84 (32%), Gaps = 4/84 (4%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGG----GGXXXXGRGGXXXGGGPGGPXXGXGG 695 GG GG G GG G GG GG G GG G GG G G Sbjct: 93 GGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGR 152 Query: 694 XXGAXGXXXXGXGXXXXXGGGXXW 623 G G G GGG W Sbjct: 153 REGGGGYGGGEGGGYGGSGGGGGW 176 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGG-XXXGGGGGXXG 622 GGGG GG GG G GG G GG GG GGGGG G Sbjct: 97 GGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYG 149 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 753 GGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GG GG GG GG GGGG G Sbjct: 90 GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSG 133 Score = 37.9 bits (84), Expect = 0.009 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG GGG GGG GG GG GG GG GG GG G Sbjct: 119 GGGGGRREGGGGYS-GGG-GGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYG 168 Score = 37.5 bits (83), Expect = 0.011 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG GGG GGG G GG G GG GG GGG G Sbjct: 106 GGGGGYSGGGGSY--GGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREG 155 Score = 37.1 bits (82), Expect = 0.015 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 753 GGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG G GG G GG GG GGGG G Sbjct: 91 GGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG 134 Score = 35.5 bits (78), Expect = 0.046 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 5/54 (9%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGG-----GQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 G GG GGG GG G GG GG G GG GG GGGGG Sbjct: 88 GSGG----GGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGG 137 Score = 31.1 bits (67), Expect = 0.99 Identities = 21/66 (31%), Positives = 22/66 (33%) Frame = -2 Query: 806 RWGXAGGWXXGGGXPXXGEGGXXXXXXXXXXXXXXXGXXGGXGXXXXGXGGGXXXGGGGV 627 R G GG+ GGG G GG GG G GGG GGG Sbjct: 96 RGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS--GGGGGYSSRGGGGGSYGGGRR 153 Query: 626 XGXXXY 609 G Y Sbjct: 154 EGGGGY 159 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/65 (35%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP + PP Sbjct: 132 PPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 191 Query: 804 PXPFL 818 P P++ Sbjct: 192 PPPYV 196 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/65 (35%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP + PP Sbjct: 152 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 211 Query: 804 PXPFL 818 P P++ Sbjct: 212 PPPYV 216 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/65 (35%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP + PP Sbjct: 172 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 231 Query: 804 PXPFL 818 P P++ Sbjct: 232 PPPYV 236 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/65 (35%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP + PP Sbjct: 192 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 251 Query: 804 PXPFL 818 P P++ Sbjct: 252 PPPYV 256 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/65 (35%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP + PP Sbjct: 212 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 271 Query: 804 PXPFL 818 P P++ Sbjct: 272 PPPYV 276 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/65 (35%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP + PP Sbjct: 232 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 291 Query: 804 PXPFL 818 P P++ Sbjct: 292 PPPYV 296 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/65 (35%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP + PP Sbjct: 252 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 311 Query: 804 PXPFL 818 P P++ Sbjct: 312 PPPYV 316 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/65 (35%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP + PP Sbjct: 272 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 331 Query: 804 PXPFL 818 P P++ Sbjct: 332 PPPYV 336 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/65 (35%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP + PP Sbjct: 352 PPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 411 Query: 804 PXPFL 818 P P++ Sbjct: 412 PPPYV 416 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/65 (35%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP + PP Sbjct: 372 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 431 Query: 804 PXPFL 818 P P++ Sbjct: 432 PPPYV 436 Score = 45.2 bits (102), Expect = 6e-05 Identities = 23/65 (35%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP + PP Sbjct: 52 PPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPP 111 Query: 804 PXPFL 818 P P++ Sbjct: 112 PPPYV 116 Score = 45.2 bits (102), Expect = 6e-05 Identities = 23/65 (35%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP + PP Sbjct: 72 PPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPP 131 Query: 804 PXPFL 818 P P++ Sbjct: 132 PPPYV 136 Score = 45.2 bits (102), Expect = 6e-05 Identities = 23/65 (35%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP + PP Sbjct: 92 PPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPP 151 Query: 804 PXPFL 818 P P++ Sbjct: 152 PPPYV 156 Score = 45.2 bits (102), Expect = 6e-05 Identities = 26/80 (32%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 282 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPP 341 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ S PP Sbjct: 342 PPPYVYKSPPPPPYVYSSPP 361 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/80 (32%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 82 PPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPP 141 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ S PP Sbjct: 142 PPPYVYKSPPPPPYVYSSPP 161 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/80 (32%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 102 PPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPP 161 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ S PP Sbjct: 162 PPPYVYKSPPPPPYVYSSPP 181 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/80 (32%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 122 PPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 181 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ S PP Sbjct: 182 PPPYVYKSPPPPPYVYSSPP 201 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/80 (32%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 142 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 201 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ S PP Sbjct: 202 PPPYVYKSPPPPPYVYSSPP 221 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/80 (32%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 162 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 221 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ S PP Sbjct: 222 PPPYVYKSPPPPPYVYSSPP 241 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/80 (32%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 182 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 241 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ S PP Sbjct: 242 PPPYVYKSPPPPPYVYSSPP 261 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/80 (32%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 202 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 261 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ S PP Sbjct: 262 PPPYVYKSPPPPPYVYSSPP 281 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/80 (32%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 222 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 281 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ S PP Sbjct: 282 PPPYVYKSPPPPPYVYSSPP 301 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/80 (32%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 242 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 301 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ S PP Sbjct: 302 PPPYVYKSPPPPPYVYSSPP 321 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/80 (32%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 302 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPP 361 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ S PP Sbjct: 362 PSPYVYKSPPPPPYVYSSPP 381 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/65 (35%), Positives = 26/65 (40%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 262 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 321 Query: 804 PXPFL 818 P P++ Sbjct: 322 PPPYV 326 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/65 (35%), Positives = 26/65 (40%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 382 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 441 Query: 804 PXPFL 818 P P++ Sbjct: 442 PPPYV 446 Score = 44.0 bits (99), Expect = 1e-04 Identities = 23/65 (35%), Positives = 26/65 (40%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P +P PP PP PP PP P PP PP PP Sbjct: 62 PPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPP 121 Query: 804 PXPFL 818 P P++ Sbjct: 122 PPPYV 126 Score = 43.2 bits (97), Expect = 2e-04 Identities = 27/81 (33%), Positives = 30/81 (37%), Gaps = 4/81 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXX--PPLPXXXXPPPPXPPX--RXP 800 PPP P P +P PP PP PP PP P PPP PP P Sbjct: 322 PPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPP-PPYVYSSP 380 Query: 801 PPXPFLAHXXXGXXXPPSXPP 863 PP P++ S PP Sbjct: 381 PPPPYVYKSPPPPPYVYSSPP 401 Score = 42.3 bits (95), Expect = 4e-04 Identities = 22/65 (33%), Positives = 26/65 (40%), Gaps = 3/65 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P PP PP + P Sbjct: 392 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPS 451 Query: 804 PXPFL 818 P P++ Sbjct: 452 PPPYV 456 Score = 41.9 bits (94), Expect = 5e-04 Identities = 25/82 (30%), Positives = 29/82 (35%), Gaps = 3/82 (3%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRX 797 + PP P P +P PP PP PP PP P PP PP Sbjct: 40 YKPPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSS 99 Query: 798 PPPXPFLAHXXXGXXXPPSXPP 863 PPP P++ S PP Sbjct: 100 PPPPPYIYKSPPPPPYVYSSPP 121 Score = 41.5 bits (93), Expect = 7e-04 Identities = 25/80 (31%), Positives = 28/80 (35%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 PPP P P +P P PP PP PP P PP PP PP Sbjct: 342 PPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 401 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ S PP Sbjct: 402 PPPYVYKSPPPPPYVYSSPP 421 Score = 41.5 bits (93), Expect = 7e-04 Identities = 25/80 (31%), Positives = 28/80 (35%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPPX--RXPP 803 P P P P +P PP PP PP PP P PP PP PP Sbjct: 362 PSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 421 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P++ S PP Sbjct: 422 PPPYVYKSPPPPPYVYSSPP 441 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/75 (30%), Positives = 27/75 (36%), Gaps = 3/75 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP-PXXXPPLPXXXXPPPPXPP--XRXPP 803 PPP P P +P PP PP PP PP P P PP + PP Sbjct: 402 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPP 461 Query: 804 PXPFLAHXXXGXXXP 848 P P ++ P Sbjct: 462 PPPSYSYSYSSPPPP 476 Score = 38.7 bits (86), Expect = 0.005 Identities = 24/83 (28%), Positives = 32/83 (38%), Gaps = 4/83 (4%) Frame = +3 Query: 582 IIXLXPIN-HIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXX--PPL 752 +I L ++ H + PP P +P PP PP PP PP Sbjct: 14 VIALYSVSAHTSAQYTYSPPSPPSYVYKPPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPP 73 Query: 753 PXXXXPPPPXP-PXRXPPPXPFL 818 P PPP P + PPP P++ Sbjct: 74 PYVYSSPPPPPYIYKSPPPPPYV 96 Score = 32.3 bits (70), Expect = 0.43 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP PSP Sbjct: 405 YVYKSPPPPPYVYSSPPPPPYVYKSPP-PPPYVYSSPPPPPYVYKSPSP 452 Score = 31.9 bits (69), Expect = 0.57 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 415 YVYSSPPPPPYVYKSPPPPPYVYSSPP-PPPYVYKSPSPPPYVYKSPPP 462 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 55 YVYSSPPPPPYIYKSPPPPPYVYSSPP-PPPYIYKSPPPPPYVYSSPPP 102 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 75 YVYSSPPPPPYIYKSPPPPPYVYSSPP-PPPYIYKSPPPPPYVYSSPPP 122 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 95 YVYSSPPPPPYIYKSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYNSPPP 142 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 135 YVYNSPPPPPYVYKSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYSSPPP 182 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 155 YVYSSPPPPPYVYKSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYSSPPP 202 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 175 YVYSSPPPPPYVYKSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYSSPPP 222 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 195 YVYSSPPPPPYVYKSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYSSPPP 242 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 215 YVYSSPPPPPYVYKSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYSSPPP 262 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 235 YVYSSPPPPPYVYKSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYSSPPP 282 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 255 YVYSSPPPPPYVYKSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYSSPPP 302 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 275 YVYSSPPPPPYVYKSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYSSPPP 322 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 295 YVYSSPPPPPYVYKSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYNSPPP 342 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 375 YVYSSPPPPPYVYKSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYSSPPP 422 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 395 YVYSSPPPPPYVYKSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYSSPPP 442 Score = 31.1 bits (67), Expect = 0.99 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +1 Query: 607 IYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 IY P PPP PP P PP PP +P PP P P Sbjct: 106 IYKSPP--PPPYVYSSPPPPPYVYKSPP-PPPYVYNSPPPPPYVYKSPPP 152 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 115 YVYSSPPPPPYVYKSPPPPPYVYNSPP-PPPYVYKSPPPPPYVYSSPPP 162 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP ++P PP P P Sbjct: 315 YVYSSPPPPPYVYKSPPPPPYVYNSPP-PPPYVYKSPPPPPYVYSSPPP 362 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +1 Query: 607 IYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 IY P PPP PP P PP PP +P PP P P Sbjct: 66 IYKSPP--PPPYVYSSPPPPPYIYKSPP-PPPYVYSSPPPPPYIYKSPPP 112 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +1 Query: 607 IYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 IY P PPP PP P PP PP +P PP P P Sbjct: 86 IYKSPP--PPPYVYSSPPPPPYIYKSPP-PPPYVYSSPPPPPYVYKSPPP 132 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 305 YVYKSPPPPPYVYSSPPPPPYVYKSPP-PPPYVYNSPPPPPYVYKSPPP 352 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 125 YVYKSPPPPPYVYNSPPPPPYVYKSPP-PPPYVYSSPPPPPYVYKSPPP 172 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 145 YVYKSPPPPPYVYSSPPPPPYVYKSPP-PPPYVYSSPPPPPYVYKSPPP 192 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 165 YVYKSPPPPPYVYSSPPPPPYVYKSPP-PPPYVYSSPPPPPYVYKSPPP 212 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 185 YVYKSPPPPPYVYSSPPPPPYVYKSPP-PPPYVYSSPPPPPYVYKSPPP 232 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 205 YVYKSPPPPPYVYSSPPPPPYVYKSPP-PPPYVYSSPPPPPYVYKSPPP 252 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 225 YVYKSPPPPPYVYSSPPPPPYVYKSPP-PPPYVYSSPPPPPYVYKSPPP 272 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 245 YVYKSPPPPPYVYSSPPPPPYVYKSPP-PPPYVYSSPPPPPYVYKSPPP 292 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 265 YVYKSPPPPPYVYSSPPPPPYVYKSPP-PPPYVYSSPPPPPYVYKSPPP 312 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 285 YVYKSPPPPPYVYSSPPPPPYVYKSPP-PPPYVYSSPPPPPYVYKSPPP 332 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 365 YVYKSPPPPPYVYSSPPPPPYVYKSPP-PPPYVYSSPPPPPYVYKSPPP 412 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP PP +P PP P P Sbjct: 385 YVYKSPPPPPYVYSSPPPPPYVYKSPP-PPPYVYSSPPPPPYVYKSPPP 432 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP P P +P PP P Sbjct: 325 YVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPP 373 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PP P PP P P P PP P Sbjct: 335 YVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPP 383 Score = 28.7 bits (61), Expect = 5.3 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +1 Query: 610 YXXXPXTPPPPX-XXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y PPP PPP P PP PP +P PP P P Sbjct: 345 YVYKSPPPPPYVYSSPPPSPYVYKSPPP--PPYVYSSPPPPPYVYKSPPP 392 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/49 (30%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y P P PP P PP PP ++P PP P P Sbjct: 355 YVYSSPPPSPYVYKSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYSSPPP 402 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 45.2 bits (102), Expect = 6e-05 Identities = 25/73 (34%), Positives = 28/73 (38%), Gaps = 9/73 (12%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX---APXXPPXPXXGPPGPP------PXXXPPLPXXXXPPPPXP 785 PPP P P P +P PP PP PP P PP+ PPPP Sbjct: 737 PPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPA 796 Query: 786 PXRXPPPXPFLAH 824 PPP P + H Sbjct: 797 VHYSPPPPPVIHH 809 Score = 43.2 bits (97), Expect = 2e-04 Identities = 27/77 (35%), Positives = 28/77 (36%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P +P PP P PP P PP PPPP PPP P Sbjct: 717 PPPHYSLPPPTPTYHYISPPPPPTPIHSPP---PQSHPPC-IEYSPPPPPTVHYNPPPPP 772 Query: 813 FLAHXXXGXXXPPSXPP 863 AH PP PP Sbjct: 773 SPAH-----YSPPPSPP 784 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PP P P +P P P P PP PPLP PP P PP Sbjct: 561 PPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPP 617 Score = 37.1 bits (82), Expect = 0.015 Identities = 21/61 (34%), Positives = 22/61 (36%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PP P P +P PP P PPP PL PP P PPP P Sbjct: 783 PPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPL-----PPIPGISYASPPPPP 837 Query: 813 F 815 F Sbjct: 838 F 838 Score = 36.3 bits (80), Expect = 0.026 Identities = 23/77 (29%), Positives = 24/77 (31%), Gaps = 1/77 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXX-GPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPX 809 PP P P P PP P G PP PP P P PP P Sbjct: 546 PPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPS 605 Query: 810 PFLAHXXXGXXXPPSXP 860 P + PPS P Sbjct: 606 PPIVGPTPS-SPPPSTP 621 Score = 35.9 bits (79), Expect = 0.035 Identities = 21/76 (27%), Positives = 23/76 (30%), Gaps = 1/76 (1%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXP-PPPXPPXRXPPPXP 812 PP P P P P P P P P P+P P PP P P Sbjct: 520 PPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPP 579 Query: 813 FLAHXXXGXXXPPSXP 860 + PPS P Sbjct: 580 IIPSPPFTGPSPPSSP 595 Score = 35.1 bits (77), Expect = 0.061 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +1 Query: 604 IIYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 + Y P PP PPP P PP PP PL P P SP Sbjct: 785 VYYYNSPPPPPAVHYSPPPPPVIHHSQPP--PPPIYEGPLPPIPGISYASP 833 Score = 34.7 bits (76), Expect = 0.080 Identities = 23/77 (29%), Positives = 23/77 (29%), Gaps = 1/77 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPPPX 809 P P P P PP PP P P PP P PP P PP Sbjct: 411 PSPPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPT 470 Query: 810 PFLAHXXXGXXXPPSXP 860 G PPS P Sbjct: 471 SPTTPTPGG--SPPSSP 485 Score = 34.7 bits (76), Expect = 0.080 Identities = 24/76 (31%), Positives = 24/76 (31%), Gaps = 2/76 (2%) Frame = +3 Query: 639 PXXXXXPXPXXXXPXAPXXPPXPXXGP--PGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P P P P P P PG PP P P P PP P PP P Sbjct: 514 PSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTP---STPPTP 570 Query: 813 FLAHXXXGXXXPPSXP 860 G PP P Sbjct: 571 I----SPGQNSPPIIP 582 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/59 (28%), Positives = 18/59 (30%) Frame = +3 Query: 687 PXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 P P P G P P P P PP P PP P + P PP Sbjct: 411 PSPPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPP 469 Score = 33.9 bits (74), Expect = 0.14 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 6/63 (9%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPX---PXXGPPGPPPXXXPPLPXXXXPPP---PXPPXRX 797 PP P P P +P P P P P P PP P PP P PP Sbjct: 481 PPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTP 540 Query: 798 PPP 806 P Sbjct: 541 TSP 543 Score = 33.9 bits (74), Expect = 0.14 Identities = 23/78 (29%), Positives = 23/78 (29%), Gaps = 5/78 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXX---PPLPXXXXPPPPXPPXRX 797 PPP P P P PP P PPP PP P PP PP Sbjct: 760 PPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPIYE 819 Query: 798 PPPXPFLAHXXXGXXXPP 851 P P PP Sbjct: 820 GPLPPIPGISYASPPPPP 837 Score = 33.5 bits (73), Expect = 0.19 Identities = 22/79 (27%), Positives = 22/79 (27%), Gaps = 3/79 (3%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP---PP 806 PP P P P P P PG P P P PP P P PP Sbjct: 449 PPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPP 508 Query: 807 XPFLAHXXXGXXXPPSXPP 863 G PS P Sbjct: 509 SSPTTPSPGGSPPSPSISP 527 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPP 750 P P PP P P P PP PP P +PPP P Sbjct: 579 PIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPPSTPTP 623 Score = 33.5 bits (73), Expect = 0.19 Identities = 21/68 (30%), Positives = 23/68 (33%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXG 836 P P +P PP P P P P PPPP P PPP +H Sbjct: 703 PPPAPYYYSSPQPPPPPHYSLPPPTPTY-----HYISPPPPPTPIHSPPPQ---SHPPCI 754 Query: 837 XXXPPSXP 860 PP P Sbjct: 755 EYSPPPPP 762 Score = 33.5 bits (73), Expect = 0.19 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +1 Query: 610 YXXXPXTPPPPX-XXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 Y P PPPP PPP P PP P +PPP PP Sbjct: 709 YYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIH----SPPPQSHPP 752 Score = 33.1 bits (72), Expect = 0.25 Identities = 22/79 (27%), Positives = 25/79 (31%), Gaps = 3/79 (3%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGP--PPXXXPPL-PXXXXPPPPXPPXRXPPP 806 P P P P +P P PP P P PP+ P P P PP Sbjct: 540 PTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPL 599 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P + P S PP Sbjct: 600 PPVIPSPPIVGPTPSSPPP 618 Score = 32.7 bits (71), Expect = 0.32 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP--XXXPPSP 756 P PP PPP P PP PP PPP PP P Sbjct: 758 PPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPP 804 Score = 31.9 bits (69), Expect = 0.57 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXP-XXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y P TP PPP P P P PP +P PP P P Sbjct: 721 YSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPP 770 Score = 31.5 bits (68), Expect = 0.75 Identities = 21/80 (26%), Positives = 22/80 (27%), Gaps = 4/80 (5%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPX---PXXGPPGPPPXXXPP-LPXXXXPPPPXPPXRXPP 803 PP P P P +P P P P P P PP P P P P Sbjct: 468 PPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISP 527 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P PP Sbjct: 528 SPPITVPSPPSTPTSPGSPP 547 Score = 31.5 bits (68), Expect = 0.75 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 3/61 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPX---RXPP 803 P P P P P PP P PPP PP P PP PP PP Sbjct: 705 PAPYYYSSPQPPPP-PHYSLPPPTPTYHYISPPP---PPTPIHSPPPQSHPPCIEYSPPP 760 Query: 804 P 806 P Sbjct: 761 P 761 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/52 (30%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +1 Query: 607 IYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPP--PXXXPPSP 756 ++ P P P PPP P P PP +P PP PP P Sbjct: 764 VHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPP 815 Score = 31.1 bits (67), Expect = 0.99 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 T P P PP P P P PP +P P P PPSP Sbjct: 486 TTPTPGGSPPSSPTT--PTPGGSPPS---SPTTPSPGGSPPSP 523 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/49 (32%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXP----PXXXRAPLAPPPXXXPPSP 756 P +PP P P P P P P P P+ P P PSP Sbjct: 543 PGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSP 591 Score = 31.1 bits (67), Expect = 0.99 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PP P P P P P P P P P P P PP P P Sbjct: 567 PPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPS-PPIVGPTPSSPPPSTPTPGT 625 Query: 813 FL 818 L Sbjct: 626 LL 627 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPX--PXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PP P PPP P PP P P P P P P Sbjct: 735 PPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPP 781 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/76 (26%), Positives = 20/76 (26%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P P P PP P PP P P P P P P P Sbjct: 437 PSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSP-P 495 Query: 813 FLAHXXXGXXXPPSXP 860 PPS P Sbjct: 496 SSPTTPTPGGSPPSSP 511 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 6/51 (11%) Frame = +1 Query: 622 PXTPPPPXXXP----PPXPXXXXPXPPXXP--PXXXRAPLAPPPXXXPPSP 756 P TP P P P P P PP P P +P +P P PSP Sbjct: 511 PTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSP 561 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/45 (31%), Positives = 17/45 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P T P P P P P PP +P +PP P+P Sbjct: 433 PITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTP 477 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 P TP P P P P P +P P P PPS Sbjct: 440 PTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPS 483 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/66 (27%), Positives = 19/66 (28%), Gaps = 7/66 (10%) Frame = +2 Query: 608 YXFXXPXXPPPPPXXXPP-------XXXXXPPGPXXXXXXXXXXXXXXXXXXXPPPXXXG 766 Y + P PPPP PP PP P PP Sbjct: 708 YYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYN 767 Query: 767 PPPPXS 784 PPPP S Sbjct: 768 PPPPPS 773 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y P P PPP P PP PP + PPP P P Sbjct: 777 YSPPPSPPVYYYNSPPPPPAVHYSPPP--PPVIHHSQPPPPPIYEGPLP 823 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 P PP P P P P +P P P PPS Sbjct: 456 PSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPS 496 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/46 (32%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRA-PLAPPPXXXPPSP 756 P P P P P P PP + P P P PPSP Sbjct: 407 PVVVPSPPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSP 452 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/47 (31%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = +1 Query: 628 TPPPPXXX----PPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP P +P PP P P Sbjct: 701 SPPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPP 747 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/50 (30%), Positives = 18/50 (36%) Frame = +1 Query: 607 IYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 I+ P + PP PP P PP P +P PP SP Sbjct: 742 IHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSP 791 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +1 Query: 628 TPPPPX----XXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 +PPPP PPP P P PP P A PPP Sbjct: 800 SPPPPPVIHHSQPPPPPIYEGPLPPI--PGISYASPPPPP 837 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 44.8 bits (101), Expect = 8e-05 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 P P P P P P PP P P PP PP P PP PP PPP Sbjct: 124 PGPEFPVPPSPSPPMPDTPN-PPTPKTPPDVVPPIWEPPRPPDIFPPESPPPGIDPPP 180 Score = 34.7 bits (76), Expect = 0.080 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PP P P P P P PP P P PP PP PP P Sbjct: 105 PPEVTTVPSDPPPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPP 164 Score = 33.5 bits (73), Expect = 0.19 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P TP PP PP PP P P +PPP PP P Sbjct: 139 PDTPNPPTPKTPPDVVPPIWEPPRPPDIFP--PESPPPGIDPPPP 181 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P P P PP P P P PP P PP PP P Sbjct: 120 PPQTPGPEFPVPPSPSPPMPDTP-NPPTPKTPPDVVPPIWEPPRP 163 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSPXXG 765 P +P PP P P P P PP P PP P SP G Sbjct: 131 PPSPSPPMPDTPNPPTPKTP-PDVVPPIW--EPPRPPDIFPPESPPPG 175 Score = 28.7 bits (61), Expect = 5.3 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 9/68 (13%) Frame = +3 Query: 687 PXXPPXPXXGPP-GPPPXXXP--PLPXXXXPP---PPXPPXRXPPP---XPFLAHXXXGX 839 P P PP GPP P P+P PP P PP PP P Sbjct: 106 PEVTTVPSDPPPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPD 165 Query: 840 XXPPSXPP 863 PP PP Sbjct: 166 IFPPESPP 173 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/46 (32%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +3 Query: 684 APXXPPXPXXGPPGPPPXXXPPL---PXXXXPPPPXPPXRXPPPXP 812 +P P P PP PP P PP P PP P P Sbjct: 100 SPSETPPEVTTVPSDPPPLGPPQTPGPEFPVPPSPSPPMPDTPNPP 145 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 44.8 bits (101), Expect = 8e-05 Identities = 25/67 (37%), Positives = 27/67 (40%), Gaps = 4/67 (5%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PPP PP P P PP PP Sbjct: 691 PPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTT--PSPPQGGYGTPP 748 Query: 804 PXPFLAH 824 P +L+H Sbjct: 749 PYAYLSH 755 Score = 43.2 bits (97), Expect = 2e-04 Identities = 28/79 (35%), Positives = 29/79 (36%), Gaps = 3/79 (3%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXA--PXXPPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PP P P P P PP P PP PPP PP P PP PP PP Sbjct: 405 PPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTP--IYSPPVKPPPVHKPP 462 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 463 TPTYS---PPIKPPPVKPP 478 Score = 43.2 bits (97), Expect = 2e-04 Identities = 25/76 (32%), Positives = 28/76 (36%), Gaps = 3/76 (3%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX--PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PP P P P P PP P PP PPP PP P PP PP + PP Sbjct: 455 PPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTP-TYSPPVKPPPIQKPPT 513 Query: 807 XPFLAHXXXGXXXPPS 854 + PP+ Sbjct: 514 PTYSPPIKPPPVKPPT 529 Score = 43.2 bits (97), Expect = 2e-04 Identities = 26/76 (34%), Positives = 28/76 (36%), Gaps = 4/76 (5%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PPP PP P PP PP + PP Sbjct: 674 PPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTP-TYSPPIKPPPVQVPP 732 Query: 804 PXPFLAHXXXGXXXPP 851 + G PP Sbjct: 733 TPTTPSPPQGGYGTPP 748 Score = 42.7 bits (96), Expect = 3e-04 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 3/60 (5%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX--PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PP P P P P PP P PP PPP PP P P P P + P P Sbjct: 321 PPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTP 380 Score = 42.3 bits (95), Expect = 4e-04 Identities = 28/80 (35%), Positives = 29/80 (36%), Gaps = 4/80 (5%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PPP PP P PP PP P Sbjct: 354 PPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTP--TYSPPIKPPPLQKP 411 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P + PP PP Sbjct: 412 PTPTYS---PPIKLPPVKPP 428 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 3/60 (5%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PP P P P P PP P PP PP PP P P P P + P P Sbjct: 152 PPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTP 211 Score = 41.9 bits (94), Expect = 5e-04 Identities = 22/61 (36%), Positives = 23/61 (37%), Gaps = 4/61 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PPP PP P P P P + P Sbjct: 236 PPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPT 295 Query: 804 P 806 P Sbjct: 296 P 296 Score = 41.9 bits (94), Expect = 5e-04 Identities = 22/59 (37%), Positives = 23/59 (38%), Gaps = 3/59 (5%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PP PP P P P PP + PP Sbjct: 438 PPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQP-PPVQKPP 495 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 3/60 (5%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PP P P P P PP P PP PP PP P P P P + P P Sbjct: 488 PPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTP 547 Score = 41.9 bits (94), Expect = 5e-04 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 3/60 (5%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX--PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PP P P P P PP P PP PPP PP P P P P + P P Sbjct: 505 PPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTP 564 Score = 41.5 bits (93), Expect = 7e-04 Identities = 22/61 (36%), Positives = 23/61 (37%), Gaps = 4/61 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PPP PP P P P P + P Sbjct: 202 PPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPT 261 Query: 804 P 806 P Sbjct: 262 P 262 Score = 41.5 bits (93), Expect = 7e-04 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 4/63 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PPP PP P PP PP P Sbjct: 219 PPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYS--PPVKPPPVQTP 276 Query: 804 PXP 812 P P Sbjct: 277 PTP 279 Score = 41.5 bits (93), Expect = 7e-04 Identities = 23/60 (38%), Positives = 24/60 (40%), Gaps = 4/60 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PPP PP P PP PP + PP Sbjct: 253 PPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTP-TYSPPVKSPPVQKPP 311 Score = 41.5 bits (93), Expect = 7e-04 Identities = 22/61 (36%), Positives = 23/61 (37%), Gaps = 4/61 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PPP PP P P P P + P Sbjct: 538 PPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPT 597 Query: 804 P 806 P Sbjct: 598 P 598 Score = 41.5 bits (93), Expect = 7e-04 Identities = 22/61 (36%), Positives = 23/61 (37%), Gaps = 4/61 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PPP PP P P P P + P Sbjct: 555 PPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPT 614 Query: 804 P 806 P Sbjct: 615 P 615 Score = 41.5 bits (93), Expect = 7e-04 Identities = 22/61 (36%), Positives = 23/61 (37%), Gaps = 4/61 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PPP PP P P P P + P Sbjct: 572 PPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPT 631 Query: 804 P 806 P Sbjct: 632 P 632 Score = 41.5 bits (93), Expect = 7e-04 Identities = 22/61 (36%), Positives = 23/61 (37%), Gaps = 4/61 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PPP PP P P P P + P Sbjct: 589 PPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPT 648 Query: 804 P 806 P Sbjct: 649 P 649 Score = 41.5 bits (93), Expect = 7e-04 Identities = 22/61 (36%), Positives = 23/61 (37%), Gaps = 4/61 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PPP PP P P P P + P Sbjct: 606 PPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPT 665 Query: 804 P 806 P Sbjct: 666 P 666 Score = 41.5 bits (93), Expect = 7e-04 Identities = 23/60 (38%), Positives = 24/60 (40%), Gaps = 4/60 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PPP PP P PP PP + PP Sbjct: 623 PPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTP-TYSPPVKPPPVQLPP 681 Score = 41.5 bits (93), Expect = 7e-04 Identities = 23/60 (38%), Positives = 24/60 (40%), Gaps = 4/60 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PPP PP P PP PP + PP Sbjct: 640 PPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTP-TYSPPVKPPPVQVPP 698 Score = 41.5 bits (93), Expect = 7e-04 Identities = 23/60 (38%), Positives = 24/60 (40%), Gaps = 4/60 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PPP PP P PP PP + PP Sbjct: 657 PPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTP-TYSPPVKPPPVQVPP 715 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/61 (36%), Positives = 23/61 (37%), Gaps = 4/61 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PPP PP P P P P + P Sbjct: 118 PPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPT 177 Query: 804 P 806 P Sbjct: 178 P 178 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 4/61 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PPP PP P PP PP + P Sbjct: 371 PPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYS-PPIKLPPVKPPT 429 Query: 804 P 806 P Sbjct: 430 P 430 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/60 (38%), Positives = 24/60 (40%), Gaps = 4/60 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PPP PP P PP PP + PP Sbjct: 101 PPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTP-SYSPPVKPPPVQMPP 159 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 4/63 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PPP PP P PP PP P Sbjct: 84 PPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYS--PPIYPPPIQKP 141 Query: 804 PXP 812 P P Sbjct: 142 PTP 144 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 4/60 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PPP PP P PP PP PP Sbjct: 135 PPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYS--PPIKPPVHKPP 192 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/76 (32%), Positives = 27/76 (35%), Gaps = 6/76 (7%) Frame = +3 Query: 597 PINHIXXXXXHXPP--PXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPX 758 P H + PP P P P P P PP P PP PPP PP P Sbjct: 170 PPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPT 229 Query: 759 XXXPPPPXPPXRXPPP 806 P P P + P P Sbjct: 230 YSPPVKPPPVHKPPTP 245 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/76 (31%), Positives = 26/76 (34%), Gaps = 6/76 (7%) Frame = +3 Query: 597 PINHIXXXXXHXPP---PXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPX 758 P H + PP P P P P P PP P PP PP PP P Sbjct: 288 PPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPI 347 Query: 759 XXXPPPPXPPXRXPPP 806 P P P + P P Sbjct: 348 YSPPVKPPPVHKPPTP 363 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/61 (39%), Positives = 25/61 (40%), Gaps = 4/61 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXP 800 PPP P P P P PP P PP PPP PP P PP PP + P Sbjct: 338 PPPVKP--PTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTP-IYSPPVKPPPIQKP 394 Query: 801 P 803 P Sbjct: 395 P 395 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/62 (37%), Positives = 24/62 (38%), Gaps = 4/62 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXP 800 PPP P P P P PP P PP PPP PP P P P P + P Sbjct: 522 PPPVKP--PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPP 579 Query: 801 PP 806 P Sbjct: 580 TP 581 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/52 (40%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = +1 Query: 607 IYXXXPX--TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 IY P TPPPP PP P PP P P+ PPP PP+P Sbjct: 48 IYGAPPSYTTPPPPIYSPPIYP------PPIQKPPTYSPPIYPPPIQKPPTP 93 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPPPX 809 PPP P PP P PP PPP PP P PP PP PP Sbjct: 69 PPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTP--TYSPPIYPPPIQKPPT 126 Query: 810 P 812 P Sbjct: 127 P 127 Score = 38.7 bits (86), Expect = 0.005 Identities = 24/77 (31%), Positives = 27/77 (35%), Gaps = 4/77 (5%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP P PP PP PP P PP PP + PP Sbjct: 270 PPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTP-TYSPPIKPPPVQKPP 328 Query: 804 PXPFLAHXXXGXXXPPS 854 + PP+ Sbjct: 329 TPTYSPPIKPPPVKPPT 345 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 H PP P P PP P PP PP PP P P P P + P P Sbjct: 442 HKPPTPIYSPP----VKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTP 497 Score = 38.3 bits (85), Expect = 0.007 Identities = 30/86 (34%), Positives = 31/86 (36%), Gaps = 10/86 (11%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPX-APXX--PPXPXXGPP-GPPPXXXPPLPXXXXP---PP--PXPP 788 PP P P P +P PP P PP PPP PP P P PP P P Sbjct: 287 PPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTP 346 Query: 789 XRXPPPXPFLAH-XXXGXXXPPSXPP 863 PP P H PP PP Sbjct: 347 IYSPPVKPPPVHKPPTPIYSPPVKPP 372 Score = 37.5 bits (83), Expect = 0.011 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 4/54 (7%) Frame = +3 Query: 657 PXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 P P P P PP P PP PPP PP P PP PP + P P Sbjct: 428 PTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTP-TYSPPIKPPPVKPPTP 480 Score = 37.5 bits (83), Expect = 0.011 Identities = 24/61 (39%), Positives = 24/61 (39%), Gaps = 4/61 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXP 800 PPP P P P P PP P PP PPP PP P PP PP P Sbjct: 472 PPPVKP--PTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYS--PPIKPPPVKP 527 Query: 801 P 803 P Sbjct: 528 P 528 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAP-LAPPPXXXPPSP 756 P PPP P P PP PP +P + PPP PP+P Sbjct: 452 PVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTP 497 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRA-PLAPPPXXXPPSP 756 P PPP P P PP PP + P+ PPP PP+P Sbjct: 502 PVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTP 547 Score = 36.7 bits (81), Expect = 0.020 Identities = 25/73 (34%), Positives = 26/73 (35%), Gaps = 4/73 (5%) Frame = +3 Query: 606 HIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPX---PXXGPP-GPPPXXXPPLPXXXXPP 773 H + PP P P P P PP P PP PPP PP P P Sbjct: 42 HAHPPPIYGAPPSYTTPPPPIYSPPIYP--PPIQKPPTYSPPIYPPPIQKPPTPTYS--P 97 Query: 774 PPXPPXRXPPPXP 812 P PP PP P Sbjct: 98 PIYPPPIQKPPTP 110 Score = 36.7 bits (81), Expect = 0.020 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRA-PLAPPPXXXPPSP 756 P PPP P P PP PP + P+ PPP PP+P Sbjct: 402 PIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTP 447 Score = 34.7 bits (76), Expect = 0.080 Identities = 22/79 (27%), Positives = 24/79 (30%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 H PP P P P P P P PP PP+ PP P P Sbjct: 42 HAHPPPIYGAP-PSYTTPPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIY 100 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 101 PPPIQKPPTPTYSPPIYPP 119 Score = 34.7 bits (76), Expect = 0.080 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRA-PLAPPPXXXPPSP 756 P PPP P P P PP + P+ PPP PP+P Sbjct: 519 PIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTP 564 Score = 34.3 bits (75), Expect = 0.11 Identities = 24/86 (27%), Positives = 26/86 (30%), Gaps = 10/86 (11%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX--PPXPXXGPP--------GPPPXXXPPLPXXXXPPPPXP 785 PP P P P P PP P PP P P PP+ PP P Sbjct: 169 PPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTP 228 Query: 786 PXRXPPPXPFLAHXXXGXXXPPSXPP 863 P P + PP PP Sbjct: 229 TYSPPVKPPPVHKPPTPIYSPPIKPP 254 Score = 34.3 bits (75), Expect = 0.11 Identities = 22/64 (34%), Positives = 24/64 (37%), Gaps = 5/64 (7%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGP---PPXXXPPL--PXXXXPPPPXPPXRXP 800 PP P P +P P P PP P PP PP+ P PP PP Sbjct: 388 PPPIQKPPTPTY----SPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHK 443 Query: 801 PPXP 812 PP P Sbjct: 444 PPTP 447 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPP--PXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PP P PP P P P P PP + PPP PP+P Sbjct: 474 PVKPPTPTYSPPVQPPPVQKPPTPTYSPP------VKPPPIQKPPTP 514 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRA-PLAPPPXXXPPSP 756 P PPP P P P PP + P+ PPP PP+P Sbjct: 166 PIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTP 211 Score = 33.5 bits (73), Expect = 0.19 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPX-PXXXXPXPPXXPPXXXRA-PLAPPPXXXPPSP 756 P PPP P P P P PP + P+ PPP PP+P Sbjct: 216 PIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTP 262 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPP--XPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP P P P P P P+ PPP PP+P Sbjct: 284 PVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTP 330 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRA-PLAPPPXXXPPSP 756 P PPP P P P PP + P+ PPP PP+P Sbjct: 335 PIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTP 380 Score = 33.5 bits (73), Expect = 0.19 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPP--PXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PP P PP P P P P PP + PPP PP+P Sbjct: 424 PVKPPTPIYSPPVKPPPVHKPPTPIYSPP------VKPPPVHKPPTP 464 Score = 33.5 bits (73), Expect = 0.19 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXP-PPXPXXXXPXPPXXPPXXXRA-PLAPPPXXXPPSP 756 P PPP P P P P PP + P+ PPP PP+P Sbjct: 569 PIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 615 Score = 33.5 bits (73), Expect = 0.19 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXP-PPXPXXXXPXPPXXPPXXXRA-PLAPPPXXXPPSP 756 P PPP P P P P PP + P+ PPP PP+P Sbjct: 603 PIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 649 Score = 33.5 bits (73), Expect = 0.19 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPX-PXXXXPXPPXXPPXXXRA-PLAPPPXXXPPSP 756 P PPP P P P P PP + P+ PPP PP+P Sbjct: 688 PVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTP 734 Score = 33.5 bits (73), Expect = 0.19 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +1 Query: 631 PPPPXXXPP--PXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSPXXG 765 PP P PP P P P P PP P+ PP PSP G Sbjct: 697 PPTPTYSPPVKPPPVQVPPTPTYSPPIKP-PPVQVPPTPTTPSPPQG 742 Score = 33.1 bits (72), Expect = 0.25 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPX-PXXXXPXPPXXPPXXXRA-PLAPPPXXXPPSP 756 P PPP P P P P PP + P+ PPP PP+P Sbjct: 233 PVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTP 279 Score = 33.1 bits (72), Expect = 0.25 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPX-PXXXXPXPPXXPPXXXRA-PLAPPPXXXPPSP 756 P PPP P P P P PP + P+ PPP PP+P Sbjct: 250 PIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTP 296 Score = 33.1 bits (72), Expect = 0.25 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPX-PXXXXPXPPXXPPXXXRA-PLAPPPXXXPPSP 756 P PPP P P P P PP + P+ PPP PP+P Sbjct: 351 PVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTP 397 Score = 33.1 bits (72), Expect = 0.25 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPX-PXXXXPXPPXXPPXXXRA-PLAPPPXXXPPSP 756 P PPP P P P P PP + P+ PPP PP+P Sbjct: 368 PVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTP 414 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPP--XPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP P P P P P P+ PPP PP+P Sbjct: 637 PIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTP 683 Score = 33.1 bits (72), Expect = 0.25 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPX-PXXXXPXPPXXPPXXXRA-PLAPPPXXXPPSP 756 P PPP P P P P PP + P+ PPP PP+P Sbjct: 654 PIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTP 700 Score = 33.1 bits (72), Expect = 0.25 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPX-PXXXXPXPPXXPPXXXRA-PLAPPPXXXPPSP 756 P PPP P P P P PP + P+ PPP PP+P Sbjct: 671 PVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTP 717 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPX-PXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP P P P P PP +P PP PP+P Sbjct: 149 PVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTP 194 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPX-PXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP P P P P PP +P PP PP+P Sbjct: 435 PVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTP 480 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXX--PPXXXRAPLAPPPXXXPPSP 756 P PPP PP PP PP +P PP PP+P Sbjct: 484 PPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTP 530 Score = 32.3 bits (70), Expect = 0.43 Identities = 20/58 (34%), Positives = 23/58 (39%), Gaps = 13/58 (22%) Frame = +1 Query: 622 PXTPPPPXXXPP--PXPXXXXPXP----PXXPPXXXR-------APLAPPPXXXPPSP 756 P PP P PP P P P P P PP + P+ PPP PP+P Sbjct: 524 PVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTP 581 Score = 31.1 bits (67), Expect = 0.99 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPP--PXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PP PP P P P P P P+ PPP PP+P Sbjct: 70 PPIQKPPTYSPPIYPPPIQKPPTPTYSP------PIYPPPIQKPPTP 110 Score = 31.1 bits (67), Expect = 0.99 Identities = 21/63 (33%), Positives = 24/63 (38%), Gaps = 13/63 (20%) Frame = +1 Query: 607 IYXXXPXTPPPPXXXPP--PXPXXXXPXP----PXXPPXXXR-------APLAPPPXXXP 747 IY PP P PP P P P P P PP + P+ PPP P Sbjct: 82 IYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKP 141 Query: 748 PSP 756 P+P Sbjct: 142 PTP 144 Score = 31.1 bits (67), Expect = 0.99 Identities = 21/63 (33%), Positives = 24/63 (38%), Gaps = 13/63 (20%) Frame = +1 Query: 607 IYXXXPXTPPPPXXXPP--PXPXXXXPXP----PXXPPXXXR-------APLAPPPXXXP 747 IY PP P PP P P P P P PP + P+ PPP P Sbjct: 99 IYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMP 158 Query: 748 PSP 756 P+P Sbjct: 159 PTP 161 Score = 30.7 bits (66), Expect = 1.3 Identities = 23/80 (28%), Positives = 26/80 (32%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXX--PXPXXXXPX-APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P +P P P PP P PP+ PP P P Sbjct: 59 PPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPP--TPTYSPPIYPPPIQKPPTPTYSPPI 116 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 117 YPPPIQKPPTPTYSPPIYPP 136 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/69 (26%), Positives = 20/69 (28%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXG 836 P P P PP P P PP+ PP P P P + Sbjct: 321 PPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTP 380 Query: 837 XXXPPSXPP 863 PP PP Sbjct: 381 IYSPPVKPP 389 Score = 30.3 bits (65), Expect = 1.7 Identities = 21/63 (33%), Positives = 23/63 (36%), Gaps = 13/63 (20%) Frame = +1 Query: 607 IYXXXPXTPPPPXXXPP--PXPXXXXPXP----PXXPP-------XXXRAPLAPPPXXXP 747 IY PP P PP P P P P P PP P+ PPP P Sbjct: 116 IYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKP 175 Query: 748 PSP 756 P+P Sbjct: 176 PTP 178 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 13/55 (23%) Frame = +1 Query: 631 PPPPXXXPP--PXPXXXXPXP----PXXPPXXXR-------APLAPPPXXXPPSP 756 PP P PP P P P P P PP + P+ PPP PP+P Sbjct: 544 PPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 598 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 13/55 (23%) Frame = +1 Query: 631 PPPPXXXPP--PXPXXXXPXP----PXXPPXXXR-------APLAPPPXXXPPSP 756 PP P PP P P P P P PP + P+ PPP PP+P Sbjct: 578 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 632 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 13/55 (23%) Frame = +1 Query: 631 PPPPXXXPP--PXPXXXXPXP----PXXPPXXXR-------APLAPPPXXXPPSP 756 PP P PP P P P P P PP + P+ PPP PP+P Sbjct: 612 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTP 666 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/47 (31%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXX--PPXXXRAPLAPPPXXXPPSP 756 P PPP PP PP PP +P P PP+P Sbjct: 384 PPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTP 430 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 631 PPPPXXXPP--PXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 PP P PP P P P P PP P+ PP P Sbjct: 394 PPTPTYSPPIKPPPLQKPPTPTYSPPIKL-PPVKPPTPIYSP 434 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 631 PPPPXXXPP--PXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 PP P PP P P P P PP P+ PP P Sbjct: 494 PPTPTYSPPVKPPPIQKPPTPTYSPPIKP-PPVKPPTPTYSP 534 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 44.8 bits (101), Expect = 8e-05 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXG 656 G G G GGGG G GG GGG GG G GG G G G G Sbjct: 61 GSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCG 110 Score = 44.8 bits (101), Expect = 8e-05 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = -3 Query: 823 WARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXG 656 W G GGG GG GGGG G G GGG GG G G G G G Sbjct: 67 WGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREGRG 122 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGG 637 GGGG GGG GGG GG GG G G GG G G Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKG 117 Score = 37.1 bits (82), Expect = 0.015 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG GGG GGG GG GG G GG GGGG G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGG----GGWGWGGGGGGGGWYKWGCGGGGKGKG 117 Score = 36.7 bits (81), Expect = 0.020 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG G G G GGG GG GG G GG GG GGGGG G Sbjct: 60 GGSGSYRWGWGGGGGGGGGGG----GGGGGGGGGG----GGWGWGGGGGGGG 103 Score = 36.3 bits (80), Expect = 0.026 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GGG GG G G GG G G G G G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREG 120 Score = 32.3 bits (70), Expect = 0.43 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRX-GGXGGGGXXXXGRGGXXXGGGPGG 716 GG GG G GGG GG GGGG G GG G G G Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREG 120 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 44.8 bits (101), Expect = 8e-05 Identities = 21/57 (36%), Positives = 23/57 (40%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXP 848 P P PP P P PPP PP PP P PP PPP ++ G P Sbjct: 49 PPPPPSPPPPSC-TPSPPPPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTYPPGDLYP 104 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 PPPP PPP P P PP P +P P PP P Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPP 90 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/45 (42%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +1 Query: 622 PXTPPPPXXXP-PPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 P +PPPP P PP P P PP +PL PPP PP+ Sbjct: 52 PPSPPPPSCTPSPPPPSPPPPKKSSCPP----SPLPPPPPPPPPN 92 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 639 PXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXP 785 P P P P P P PP P PP P PPPP P Sbjct: 43 PCLQNQPPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 36.3 bits (80), Expect = 0.026 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 P P P PP P PP PLP PPPP PP Sbjct: 51 PPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTYPP 99 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 6/66 (9%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXG-----PPGPPP-XXXPPLPXXXXPPPPXPPXR 794 PPP P P P PP PP PPP PP P PP PP Sbjct: 674 PPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPP 733 Query: 795 XPPPXP 812 PPP P Sbjct: 734 PPPPAP 739 Score = 42.7 bits (96), Expect = 3e-04 Identities = 25/76 (32%), Positives = 27/76 (35%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P PP P PP PP P + PPPP PP PP P Sbjct: 689 PPPPP---PPPPMQHSTVTKVPPPPPPAPPAPP---TPIVHTSSPPPPPPPPPPPAPPTP 742 Query: 813 FLAHXXXGXXXPPSXP 860 PP+ P Sbjct: 743 QSNGISAMKSSPPAPP 758 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/74 (32%), Positives = 24/74 (32%), Gaps = 2/74 (2%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 PI H PPP P P A P PP P P P PPP Sbjct: 720 PIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPP 779 Query: 777 PXPPXRXP--PPXP 812 P R P PP P Sbjct: 780 PLGQTRAPSAPPPP 793 Score = 39.1 bits (87), Expect = 0.004 Identities = 27/95 (28%), Positives = 29/95 (30%), Gaps = 6/95 (6%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 P+ H PPP P +P PP P P P P PP Sbjct: 697 PMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPA 756 Query: 777 PXPPXRXP-----PPXPFL-AHXXXGXXXPPSXPP 863 P P R P PP P G PS PP Sbjct: 757 PPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPP 791 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 P P PP PPP PPPP P P P + H PP PP Sbjct: 684 PALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTP---IVHTSSPPPPPPPPPP 736 Score = 35.1 bits (77), Expect = 0.061 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 PPP PPP P P PP L+P PP+P Sbjct: 771 PPPTAPPPPPLGQTRAPSAPPPPPPKLGTKLSPSGPNVPPTP 812 Score = 34.7 bits (76), Expect = 0.080 Identities = 16/48 (33%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLA---PPPXXXPPSP 756 P PPP P P PP PP + + PPP PP+P Sbjct: 670 PARSPPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAP 717 Score = 33.9 bits (74), Expect = 0.14 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 7/52 (13%) Frame = +1 Query: 622 PXTPPPPXXXP-------PPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPPP PP P P PP P +P PPP PP+P Sbjct: 689 PPPPPPPPPMQHSTVTKVPPPPPPAPPAPP-TPIVHTSSPPPPPPPPPPPAP 739 Score = 31.9 bits (69), Expect = 0.57 Identities = 17/63 (26%), Positives = 19/63 (30%) Frame = +2 Query: 590 SXTNKSYXFXXPXXPPPPPXXXPPXXXXXPPGPXXXXXXXXXXXXXXXXXXXPPPXXXGP 769 S ++K P PPPPP PP P PPP P Sbjct: 678 SNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPP 737 Query: 770 PPP 778 PP Sbjct: 738 APP 740 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 723 GPPPXXXPPLPXXXXPPP-PXPPXRXPPPXPFLAHXXXGXXXPPSXP 860 G P PP+ P P PP PPP P + H PP P Sbjct: 668 GQPARSPPPISNSDKKPALPRPPP--PPPPPPMQHSTVTKVPPPPPP 712 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 P P PP P G P PP P P P P P Sbjct: 770 PPPPTAPPPPPLGQTRAPSAPPPPPPKLGTKLSPSGPNVPPTP 812 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +3 Query: 720 PGPPPXXXPPLPXXXXPPPPXP-PXRXPPPXPFLAH 824 P PP P L PPPP P P P L H Sbjct: 532 PSPPHPVRPQLAQAGAPPPPPPLPAAASKPSEQLQH 567 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Frame = +3 Query: 633 PP--PXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXP 785 PP P P P P P PP PPP L PP P Sbjct: 760 PPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPPPKLGTKLSPSGPNVPPTP 812 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/58 (39%), Positives = 24/58 (41%) Frame = +3 Query: 639 PXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P P P A PP P PP PPP PP+ PP PP PPP P Sbjct: 50 PVTIPPPPPVYSRPVA-FPPPPPIYSPP-PPPIYPPPIYSPPPPPIYPPPIYSPPPTP 105 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 6/59 (10%) Frame = +3 Query: 705 PXXGPPGPP---PXXXPPLPXXXXPP---PPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 P PP PP P PP P P PP PP PPP P PP PP Sbjct: 38 PIYSPPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPP 96 Score = 39.1 bits (87), Expect = 0.004 Identities = 25/76 (32%), Positives = 26/76 (34%), Gaps = 1/76 (1%) Frame = +3 Query: 639 PXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPL-PXXXXPPPPXPPXRXPPPXPF 815 P P P P P PP P PP PPP PP+ P P P P P Sbjct: 63 PVAFPPPPPIYSPPPPPIYPP-PIYSPP-PPPIYPPPIYSPPPTPISPPPKVHHPAPQAQ 120 Query: 816 LAHXXXGXXXPPSXPP 863 A PPS P Sbjct: 121 KAFYYRQSPPPPSGQP 136 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPL-APPPXXXPPSP 756 PPPP PPP P P PP P+ +PPP P P Sbjct: 68 PPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPP 110 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXR---APLAPPPXXXPPSP 756 +PPPP PPP P PP PP P++PPP P+P Sbjct: 74 SPPPPPIYPPPI--YSPPPPPIYPPPIYSPPPTPISPPPKVHHPAP 117 Score = 35.9 bits (79), Expect = 0.035 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P PP P PP P P P PPP P PPP Sbjct: 55 PPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTP--ISPPP 110 Score = 34.7 bits (76), Expect = 0.080 Identities = 18/48 (37%), Positives = 20/48 (41%) Frame = +1 Query: 607 IYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 +Y PPPP PP P P P PP P+ PPP PP Sbjct: 59 VYSRPVAFPPPPPIYSPP-PPPIYPPPIYSPPP---PPIYPPPIYSPP 102 Score = 33.5 bits (73), Expect = 0.19 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +1 Query: 607 IYXXXPXTPPPPXXXPPPXPXXXXPXP-PXXPP--XXXRAPLAPPPXXXPPSP 756 IY P P PPP P P P PP P+ PPP PP P Sbjct: 39 IYSPPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPP 91 Score = 33.5 bits (73), Expect = 0.19 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 10/70 (14%) Frame = +3 Query: 684 APXXPPX--PXXGPPGPP----PXXXPPLPXXXXPPPPX---PPX-RXPPPXPFLAHXXX 833 +P PP P PP PP P PP P PPPP PP PPP + Sbjct: 41 SPPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYS 100 Query: 834 GXXXPPSXPP 863 P S PP Sbjct: 101 PPPTPISPPP 110 Score = 33.5 bits (73), Expect = 0.19 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 5/65 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPP--GPPPXXXPPLPXXXXPPPPXPP---XRX 797 PPP P P P PP P PP PPP P P P P R Sbjct: 69 PPPIYSPPPPPIYPPPIY-SPPPPPIYPPPIYSPPPTPISPPPKVHHPAPQAQKAFYYRQ 127 Query: 798 PPPXP 812 PP P Sbjct: 128 SPPPP 132 Score = 32.7 bits (71), Expect = 0.32 Identities = 25/79 (31%), Positives = 26/79 (32%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 + PPP P P P P PP PPP PP P PPP PPP Sbjct: 40 YSPPPPPYRSPVTI---PPPPPVYSRPVAFPP-PPPIYSPPPPPIY--PPPIYS---PPP 90 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P P PP Sbjct: 91 PPIYPPPIYSPPPTPISPP 109 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +1 Query: 640 PXXXPPPXPXXXXPXPPXXPPXXXRAPLA---PPPXXXPPSP 756 P PPP P P PP R P+A PPP PP P Sbjct: 38 PIYSPPPPPYRSPVTIPPPPPVYSR-PVAFPPPPPIYSPPPP 78 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 44.4 bits (100), Expect = 1e-04 Identities = 28/78 (35%), Positives = 28/78 (35%), Gaps = 1/78 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGR-GGXXXGGGPGGPXXGXGGXXG 686 GG GG G GG G GGGG R GG GGG GG G GG Sbjct: 91 GGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRRE 150 Query: 685 AXGXXXXGXGXXXXXGGG 632 G G GGG Sbjct: 151 GGGYGGGDGGSYGGGGGG 168 Score = 43.6 bits (98), Expect = 2e-04 Identities = 27/82 (32%), Positives = 28/82 (34%), Gaps = 2/82 (2%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGG--GXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXX 689 GG GG + G GG G GG GGG R G G GG G GG Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGG 147 Query: 688 GAXGXXXXGXGXXXXXGGGXXW 623 G G GGG W Sbjct: 148 RREGGGYGGGDGGSYGGGGGGW 169 Score = 42.3 bits (95), Expect = 4e-04 Identities = 23/61 (37%), Positives = 24/61 (39%) Frame = -3 Query: 814 KGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 +G GGG G GGG G GG GGG G G GG G G G G Sbjct: 85 RGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYG 144 Query: 634 G 632 G Sbjct: 145 G 145 Score = 41.9 bits (94), Expect = 5e-04 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXXGGG-XXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG GGG GGG G G G GG GG GGGGG G Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRG 142 Score = 41.9 bits (94), Expect = 5e-04 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG GGG GGG G GG G GG GG GGG G Sbjct: 105 GGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGG 156 Score = 41.5 bits (93), Expect = 7e-04 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGGG G GGG GG GG GG GG GGGGG Sbjct: 120 GGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 168 Score = 41.1 bits (92), Expect = 0.001 Identities = 26/65 (40%), Positives = 28/65 (43%), Gaps = 2/65 (3%) Frame = -3 Query: 820 ARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGG--XXGAXGXXXXGXGXXX 647 +R GGG GG GGG G GG GGG GG G GG + G G G Sbjct: 84 SRGSGGGGGGRGGSGGG--YRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGR 141 Query: 646 XXGGG 632 GGG Sbjct: 142 GYGGG 146 Score = 37.1 bits (82), Expect = 0.015 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GG G GG G GG GG GG GG G Sbjct: 114 GGGYSGGGGGGYERRSGGYGS--GGGGGGRGYGGGGRREGGGYGGGDGGSYG 163 Score = 32.3 bits (70), Expect = 0.43 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 753 GGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGG GG GG GG GG GG GGGGG Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGG----GGYSGGGGGG 124 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/76 (32%), Positives = 27/76 (35%), Gaps = 3/76 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPP---PPXPPXRXPP 803 PPP P P P P P PP P P PP P PP P + PP Sbjct: 100 PPPTPKKSPSPPSLTPFVPHPTPKKSPSPP-PTPSLPPPAPKKSPSTPSLPPPTPKKSPP 158 Query: 804 PXPFLAHXXXGXXXPP 851 P P +H PP Sbjct: 159 PPP--SHHSSSPSNPP 172 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P P P P PP P P P P P P P P PPP P Sbjct: 80 PIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAP 139 Score = 35.9 bits (79), Expect = 0.035 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPP PPP P P PP ++P PPP SP Sbjct: 127 SPPPTPSLPPPAPKKSPSTPSLPPPTPKKSP-PPPPSHHSSSP 168 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/63 (33%), Positives = 23/63 (36%), Gaps = 3/63 (4%) Frame = +3 Query: 684 APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP---XPFLAHXXXGXXXPPS 854 AP P P P PP P PPP P + P P PF+ H PS Sbjct: 70 APAISISPSTPIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPT--PKKSPS 127 Query: 855 XPP 863 PP Sbjct: 128 PPP 130 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/67 (29%), Positives = 22/67 (32%), Gaps = 1/67 (1%) Frame = +3 Query: 663 PXXXXPXAPXXPPX-PXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGX 839 P P P PP P PP P P P P P P + P P P + Sbjct: 80 PIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAP 139 Query: 840 XXPPSXP 860 PS P Sbjct: 140 KKSPSTP 146 Score = 31.9 bits (69), Expect = 0.57 Identities = 24/77 (31%), Positives = 25/77 (32%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P PP P P P P P PPP P + P P Sbjct: 91 PPPAPKKSPPPPT--PKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAP--KKSPSTP 146 Query: 813 FLAHXXXGXXXPPSXPP 863 L PP PP Sbjct: 147 SLPPPTPKKSPPP--PP 161 Score = 31.5 bits (68), Expect = 0.75 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 H P P P AP P PP P PP P P PP P Sbjct: 119 HPTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPPPSHHSSSPSNPPHHQQNP 178 Score = 29.9 bits (64), Expect = 2.3 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 10/55 (18%) Frame = +1 Query: 622 PXTPPP----PXXXPPPXPXXXXPXPPXXP-----PXXXRAPLAPP-PXXXPPSP 756 P TP P P PPP P PP P ++P PP P PP+P Sbjct: 85 PSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAP 139 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P P PPP P P P P P P P PP P Sbjct: 118 PHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLPP--PTPKKSPPPP 160 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 44.4 bits (100), Expect = 1e-04 Identities = 27/74 (36%), Positives = 28/74 (37%), Gaps = 1/74 (1%) Frame = -3 Query: 850 GGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXG-GXXGAXGX 674 GG + G GGG GG GGG GG GG GG G G G G G Sbjct: 110 GGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGG 169 Query: 673 XXXGXGXXXXXGGG 632 G G GGG Sbjct: 170 GGIGGGVIIGGGGG 183 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GG GG G G GG GG GGGGG G Sbjct: 135 GGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCG 186 Score = 42.3 bits (95), Expect = 4e-04 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G G GG GGGG G GG GGG GG G G GA G G GGG Sbjct: 97 GFKGELTAGGYGGGGPGYGG-GGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGG 155 Score = 42.3 bits (95), Expect = 4e-04 Identities = 25/53 (47%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXX-GGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGGP GGG GGG GG GG G GG GG GGG G G Sbjct: 153 GGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGG--SCSGGGGGGGGYGHGG 203 Score = 41.9 bits (94), Expect = 5e-04 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGGP GGG GGG GG GG G G G G GGG G Sbjct: 108 GGGGPGYGGGGY-GPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPG 158 Score = 41.1 bits (92), Expect = 0.001 Identities = 26/62 (41%), Positives = 26/62 (41%), Gaps = 2/62 (3%) Frame = -3 Query: 811 GXGGGXRX-GGXGGGGXXXX-GRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXG 638 G GGG GG GGGG G GG GGG GG GG G G G G G Sbjct: 141 GSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYG 200 Query: 637 GG 632 G Sbjct: 201 HG 202 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGG-GQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXGXXXI 610 GGGG GGG G G GG G G GG GG GGGGG G I Sbjct: 123 GGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGG-GGPGYGSGGGGIGGGGGIGGGVII 178 Score = 39.5 bits (88), Expect = 0.003 Identities = 29/82 (35%), Positives = 29/82 (35%), Gaps = 6/82 (7%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXG---GXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXX 689 G GG P GGG G G GGG G GG G G GG G GG Sbjct: 113 GYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGI 172 Query: 688 GA---XGXXXXGXGXXXXXGGG 632 G G G G GGG Sbjct: 173 GGGVIIGGGGGGCGGSCSGGGG 194 Score = 38.3 bits (85), Expect = 0.007 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGG-PGGPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 G GGG G GG G G GG GGG GG G GG G G G GG Sbjct: 106 GYGGGGPGYGGGGYGPGGGG-GGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGG 164 Query: 634 G 632 G Sbjct: 165 G 165 Score = 37.5 bits (83), Expect = 0.011 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 4/66 (6%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGG----XXXGGGPGGPXXGXGG 695 GG G W GGG G GGG G GG GGG GG G GG Sbjct: 135 GGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGG 194 Query: 694 XXGAXG 677 G G Sbjct: 195 GGGGYG 200 Score = 36.7 bits (81), Expect = 0.020 Identities = 26/59 (44%), Positives = 26/59 (44%), Gaps = 3/59 (5%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGG---GXXXXGRGGXXXGGGPGGPXXGXGG 695 GG GG P G GGG GG GGG G G GG GGG GG G GG Sbjct: 150 GGNGGGG--PGYGSGGGGIGGG---GGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGG 203 Score = 35.9 bits (79), Expect = 0.035 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGP----GGXXXXXGGXXXGGGGGXXG 622 GGG G G G G GG GG G GG GG GGGGG G Sbjct: 143 GGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGG 198 Score = 30.7 bits (66), Expect = 1.3 Identities = 24/67 (35%), Positives = 25/67 (37%), Gaps = 6/67 (8%) Frame = -2 Query: 809 ARWGXAGG--WXXG--GGXPXXGEGGXXXXXXXXXXXXXXXGXXGGX--GXXXXGXGGGX 648 A +G GG W G GG P G GG G GG G G GGG Sbjct: 138 AGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGG 197 Query: 647 XXGGGGV 627 G GGV Sbjct: 198 GYGHGGV 204 Score = 29.1 bits (62), Expect = 4.0 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -1 Query: 732 GGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGG-GGXXG 622 G G GGP GG GPGG GG GGG GG G Sbjct: 106 GYGGGGPG-YGGGGYGPGG---GGGGVVIGGGFGGGAG 139 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = -1 Query: 750 GGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXGXXXIYD 604 GG G G GG GG G GG GG GG G G +D Sbjct: 105 GGYGGGGPGYGG----GGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWD 149 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 44.0 bits (99), Expect = 1e-04 Identities = 23/57 (40%), Positives = 23/57 (40%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 GGG GG GGGG G GG G G G G GG G G G GG Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGG 178 Score = 41.1 bits (92), Expect = 0.001 Identities = 29/79 (36%), Positives = 29/79 (36%), Gaps = 3/79 (3%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGG-GXRXGGXGGGGXXXXGRGGXXX--GGGPGGPXXGXGGX 692 GG GG G GG G GG GG G G GG GGG GG G G Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGG 181 Query: 691 XGAXGXXXXGXGXXXXXGG 635 GA G G GG Sbjct: 182 SGAGGYGGDATGHGGAGGG 200 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G G G GG GG G G GG GG GG G GG G G GG Sbjct: 127 GGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGG 186 Score = 38.7 bits (86), Expect = 0.005 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGGG GGG GG GG GG G GG GG GG GG Sbjct: 126 GGGGYGGGGGGYGGSGGYGGGAGGYGG-SGGYGGGAGGYGGNSGGGYGG 173 Score = 37.9 bits (84), Expect = 0.009 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GGG GG GG G GG GG GG GG G Sbjct: 122 GGG--FGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGG--AGGYGGNSG 168 Score = 37.9 bits (84), Expect = 0.009 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGG-XXXXXGGXXXGGGGG 631 GGGG GG GG GG GG G GG GG GG GG Sbjct: 132 GGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGG 181 Score = 37.1 bits (82), Expect = 0.015 Identities = 21/52 (40%), Positives = 22/52 (42%) Frame = -3 Query: 787 GGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 GG GGG G GG GG GG G GG G+ G G GGG Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGG---GAGGYGGSGGYGGGAGGYGGNSGGG 170 Score = 36.3 bits (80), Expect = 0.026 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GG GGG GG GG G GG GG G G G Sbjct: 131 GGGGGGYGGS-GGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYG 180 Score = 35.9 bits (79), Expect = 0.035 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG G GG GG GG G G GG GG G GG G Sbjct: 144 GGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSG---AGGYGGDATGHGGAGGG 200 Query: 682 XG 677 G Sbjct: 201 YG 202 Score = 33.5 bits (73), Expect = 0.19 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 2/60 (3%) Frame = -3 Query: 811 GXGGGXRXGGXGG--GGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXG 638 G GG GG G GG G GG GG G G GG G G G G Sbjct: 149 GYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGGYGSSGGFG 208 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GG GGG GG GG G G GG G G GG G Sbjct: 149 GYGGSGGYGGGAGGYGGNSGG-GYGGNAAGGYGGSGAGGYGGDATGHGGAGG 199 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGG 634 GGG GG GGG GG G G GG G GGG Sbjct: 157 GGGAGGYGGN---SGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGG 200 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGG--GGXXXXGRGGXXXGGGPGGPXXGXGGXX 689 GG G G GG G G GG G GG G G G G G Sbjct: 148 GGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGGYGSSGGF 207 Query: 688 GAXG 677 G+ G Sbjct: 208 GSSG 211 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 GG GG GG G GG G G GG G G G G G Sbjct: 157 GGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGGYGSSGGFGSSGNTYG 215 Score = 29.1 bits (62), Expect = 4.0 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGG G G GGG GG G G G GG GG GG Sbjct: 144 GGGAGGYGGSG--GYGGGAGGYGGNSGGGYG-GNAAGGYGGSGAGGYGG 189 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 44.0 bits (99), Expect = 1e-04 Identities = 27/77 (35%), Positives = 29/77 (37%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG + G + G G G R G G G G GG GGG GG G GG G Sbjct: 87 GGGDAGSEAGSYAGSHAGSGSGGRSGSGRGRGS---GGGGGHGGGGGGGGGRGGGGGSGN 143 Query: 682 XGXXXXGXGXXXXXGGG 632 G G GGG Sbjct: 144 GEGYGEGGGYGGGYGGG 160 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 G G GGG GGG GG GG G G GG G GGG Sbjct: 112 GSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 Score = 36.7 bits (81), Expect = 0.020 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G G G G GG GG GG G GG G G GGG G Sbjct: 104 GSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGG 155 Score = 35.5 bits (78), Expect = 0.046 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGG-QGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GG G G GGG GG GG G GG G GG GG G Sbjct: 106 GSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYG 158 Score = 28.7 bits (61), Expect = 5.3 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -1 Query: 768 GPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 G G G G+G GG G GG GG GGGGG Sbjct: 100 GSHAGSGSGGRSGSGRGRGSGGGGGHGGGGG-----GGGGRGGGGG 140 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = -1 Query: 750 GGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG G + G G GG G GGGGG G Sbjct: 85 GGGGGDAGSEAGSYAGSHAGSGSGGRSGSGRGRGSGGGGGHGG 127 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/56 (28%), Positives = 17/56 (30%) Frame = -3 Query: 799 GXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G GG G G G GG G G G GG + GGG Sbjct: 34 GLDLGGIGAGIGIGIGIGGGGSGSGAGAGSGSGGGGSSSSSSSSSSSSSSSGGGGG 89 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +3 Query: 717 PPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 PP PP PP P PPPP PP PPP F Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPPPPAF 97 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPP 788 PP P P PPP PP P PPPP PP Sbjct: 65 PPPPPTSP--PPPSPPPPSPPPPSPPPPSPP 93 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 PPPP PPP P P PP PP P PPP Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPPP-----PSPPPP 95 Score = 37.5 bits (83), Expect = 0.011 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPP 702 P T PPP PPP P P PP PP Sbjct: 68 PPTSPPPPSPPPPSPPPPSPPPPSPPP 94 Score = 35.9 bits (79), Expect = 0.035 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 655 PPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 PP P P PP PP P PPP PP+ Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPPPA 96 Score = 35.5 bits (78), Expect = 0.046 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 687 PXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP 779 P PP P PPP PP P PPPP Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 35.1 bits (77), Expect = 0.061 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 P P PP P PP PPP PP PPP + P Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPPP---PSPPPPAFAVGKTP 103 Score = 30.3 bits (65), Expect = 1.7 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPP 690 P +PPPP PPP P P PP Sbjct: 74 PPSPPPPSP-PPPSPPPPSPPPP 95 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 768 PPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PPPP P PPP P PPS PP Sbjct: 64 PPPPPP-TSPPPPSPPPPSPPPPSPPPPSPPP 94 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 PPPP PPP PP PP RAPL PPP Sbjct: 24 PPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPP 58 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 4/53 (7%) Frame = +3 Query: 717 PPGPPPXXXPPLPXXXXPPPPXPPXR----XPPPXPFLAHXXXGXXXPPSXPP 863 PP PPP P PPPP PP R PPP P PP PP Sbjct: 24 PPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPP 76 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = +1 Query: 622 PXTPPP-----PXXXPPPXPXXXX-PXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP P PPP P P PP PP R L PP PP P Sbjct: 28 PPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPPLP 78 Score = 34.7 bits (76), Expect = 0.080 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 4/63 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPP-XXXPPLPXXXXPPPPXPPXR---XPP 803 PP P P P P PP PPP PLP PPPP R PP Sbjct: 15 PPMRGRVPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLP---PPPPPAMRRRVLPRPP 71 Query: 804 PXP 812 P P Sbjct: 72 PPP 74 Score = 32.7 bits (71), Expect = 0.32 Identities = 24/76 (31%), Positives = 25/76 (32%), Gaps = 2/76 (2%) Frame = +3 Query: 633 PPPXXXXXPXP--XXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 P P P P P P PP P PPP PP P P PP PPP Sbjct: 22 PLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPP--PPPAMRRRVLPRPPPP---PPP 76 Query: 807 XPFLAHXXXGXXXPPS 854 P PP+ Sbjct: 77 LPMFDAEVLCCCYPPT 92 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/47 (44%), Positives = 22/47 (46%) Frame = -3 Query: 817 RKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXG 677 +KG GGG R GG GGG G GG GG G G GG G Sbjct: 71 KKGGGGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGGSSSRGG 117 Score = 33.5 bits (73), Expect = 0.19 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = -1 Query: 786 VEXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 V+ GGGG GGG G GG G G GG GG GGG Sbjct: 70 VKKGGGGGGRGGGGFGGGGRSFGG---GGSSSRGGGGSSSRGGGGSSSRGGG 118 Score = 32.3 bits (70), Expect = 0.43 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -3 Query: 778 GGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 GGGG GRGG GGG G G G G G GGG Sbjct: 73 GGGGG---GRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGGSSSRGGG 118 Score = 29.1 bits (62), Expect = 4.0 Identities = 21/67 (31%), Positives = 22/67 (32%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG + GGG GGGG G GG GG P GG Sbjct: 73 GGGGGGRGGGGFGGGGRSFGGGGSS-SRGGGGSSSRGGGGSSSRGGGLRPIPIYGGGTHR 131 Query: 682 XGXXXXG 662 G G Sbjct: 132 SGHHSSG 138 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/58 (41%), Positives = 25/58 (43%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 GGG GG GGG G GGG GGP GG G+ G G G GGG Sbjct: 314 GGG---GGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGG 368 Score = 42.7 bits (96), Expect = 3e-04 Identities = 24/59 (40%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = -1 Query: 774 GGGPXXX-GGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXGXXXIYDL 601 GGGP GG GGG GGP G G G GG GGGG G YD+ Sbjct: 320 GGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGG-YDM 377 Score = 42.3 bits (95), Expect = 4e-04 Identities = 27/67 (40%), Positives = 27/67 (40%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG R GGG GG GGGG G GG GG GG G GG G Sbjct: 355 GGYGGGMGGAGGGGYR--GGGGYDMGGVGGGGAGGYGAGG---GGNGGGSFYGGGGGRGG 409 Query: 682 XGXXXXG 662 G G Sbjct: 410 YGGGGSG 416 Score = 41.5 bits (93), Expect = 7e-04 Identities = 23/60 (38%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = -3 Query: 811 GXGGGXRXGGXG-GGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 G GGG GG GGG G G GG G P G GG G+ G G GG Sbjct: 301 GGGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGG 360 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGG-GGGXXGXXXIY 607 GGG GGG G G GG G G GG GG GG GGG G Y Sbjct: 365 GGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGGSGRYHPY 421 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGG--QGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GGG GG G G GG GG GGGGG G Sbjct: 358 GGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGG-GGNGGGSFYGGGGGRGG 409 Score = 38.7 bits (86), Expect = 0.005 Identities = 26/77 (33%), Positives = 26/77 (33%), Gaps = 2/77 (2%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXG--GGGXXXXGRGGXXXGGGPGGPXXGXGGXX 689 GG G G GGG GG G GG G GG GGG G GG Sbjct: 346 GGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGG 405 Query: 688 GAXGXXXXGXGXXXXXG 638 G G G G G Sbjct: 406 GRGGYGGGGSGRYHPYG 422 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGP-XXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GG GGP GG G G GG G GGG G Sbjct: 229 GGGYGDGYGGGHGGGYGGPGGPYKSGGGYGGGRSGGYGGYGGEFGGYGGGGYG 281 Score = 38.3 bits (85), Expect = 0.007 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 4/81 (4%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGG-GXRXGGXGGGGXXXXG---RGGXXXGGGPGGPXXGXGG 695 GG G + G GG G GG GGGG G GG GG GG G GG Sbjct: 336 GGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGA-GGYGAGGGG 394 Query: 694 XXGAXGXXXXGXGXXXXXGGG 632 G G G G GGG Sbjct: 395 NGG--GSFYGGGGGRGGYGGG 413 Score = 36.7 bits (81), Expect = 0.020 Identities = 24/63 (38%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Frame = -3 Query: 820 ARKGXGGGXRXGGXGGGGXXXXGRGG-XXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXX 644 +R GGG G GG G G GG GGG GG G G G G G G Sbjct: 224 SRSNFGGGYGDGYGGGHGGGYGGPGGPYKSGGGYGG---GRSGGYGGYGGEFGGYGGGGY 280 Query: 643 XGG 635 GG Sbjct: 281 GGG 283 Score = 35.1 bits (77), Expect = 0.061 Identities = 27/77 (35%), Positives = 28/77 (36%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG + GG G GGG G GG GGG GG G GG G Sbjct: 317 GGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGY--GGGMGG--AGGGGYRGG 372 Query: 682 XGXXXXGXGXXXXXGGG 632 G G G G G Sbjct: 373 GGYDMGGVGGGGAGGYG 389 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -3 Query: 799 GXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G GGG G G GGPGGP GG G G G GG Sbjct: 222 GDSRSNFGGGYGDGYGGGHGGGYGGPGGPYKSGGGYGGGRSGGYGGYGGEFGGYGG 277 Score = 34.3 bits (75), Expect = 0.11 Identities = 28/85 (32%), Positives = 29/85 (34%), Gaps = 8/85 (9%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGG----GXXXXGRGGXXXGGG----PGGPXX 707 GG GG P + GG GG GG G G GG GGG G P Sbjct: 238 GGHGGGYGGPGGPYK----SGGGYGGGRSGGYGGYGGEFGGYGGGGYGGGVGPYRGEPAL 293 Query: 706 GXGGXXGAXGXXXXGXGXXXXXGGG 632 G G G G G GGG Sbjct: 294 GYSGRYGGGGGGYNRGGYSMGGGGG 318 Score = 33.1 bits (72), Expect = 0.25 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG G GG GG GG GG G GG GGGG G Sbjct: 347 GGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGG 398 Score = 31.5 bits (68), Expect = 0.75 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGP-XXXGGXXXGPGGXXXXXGGXXXGGGG 634 GGGG G GG GGP GG PGG G GG G Sbjct: 302 GGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYG 350 Score = 31.1 bits (67), Expect = 0.99 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = -1 Query: 777 GGGGPXXX-GGGXXXXG-GGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GGP GGG G GG GG G GG GG GGG G G Sbjct: 337 GYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVG-GGGAGGYG 389 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGG--QGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G G GGG GGG +GG G G G GG GGG G Sbjct: 350 GSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGG 403 Score = 30.3 bits (65), Expect = 1.7 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 3/60 (5%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGG---GGGXXGXXXIY 607 G G G GGG GG GG G G GG GG GGG G Y Sbjct: 343 GSYGGGYGSSGIGGYGGGMGG-AGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFY 401 Score = 29.1 bits (62), Expect = 4.0 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G G GGG GG G GG GPG G GG GG G Sbjct: 294 GYSGRYGGGGGGYNRGGYSMG--GGGGYGGGPGDMYGGSYGEPGGGYGGPSG 343 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 43.2 bits (97), Expect = 2e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXG 677 G G GG GGGG GRGG GGG GG G GG G G Sbjct: 92 GGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGG--RGSGGRGGGGG 134 Score = 39.9 bits (89), Expect = 0.002 Identities = 26/60 (43%), Positives = 27/60 (45%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G G G GGGG GRGG GGG GG G GG G+ G G G GGG Sbjct: 80 GPDGAPVQGNSGGGGSS-GGRGGFGGGGGRGG---GRGG--GSYGGGYGGRGSGGRGGGG 133 Score = 37.5 bits (83), Expect = 0.011 Identities = 29/86 (33%), Positives = 30/86 (34%), Gaps = 13/86 (15%) Frame = -3 Query: 850 GGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGP------GGP-------X 710 GG + G GG R GG GGG G GG GGG G P Sbjct: 93 GGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGGDNSCFKCGEPGHMARECS 152 Query: 709 XGXGGXXGAXGXXXXGXGXXXXXGGG 632 G GG G G G G GGG Sbjct: 153 QGGGGYSGGGGGGRYGSGGGGGGGGG 178 Score = 33.1 bits (72), Expect = 0.25 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -1 Query: 771 GGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGG--XXXXXGGXXXGGGGGXXG 622 G P G GG+GG GG G GG GG GG GG G Sbjct: 83 GAPVQGNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGG 134 Score = 32.3 bits (70), Expect = 0.43 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGGG GG GGG G GG G G GG GGGGG Sbjct: 91 GGGGS---SGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGG--RGGGGG 134 Score = 31.5 bits (68), Expect = 0.75 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -3 Query: 820 ARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGG 725 AR+ GG G GGGG G GG GGG Sbjct: 148 ARECSQGGGGYSGGGGGGRYGSGGGGGGGGGG 179 Score = 28.7 bits (61), Expect = 5.3 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAX 680 G GG + G R GGGG G GG GG GG G GG Sbjct: 127 GGRGGGGGDNSCFKCGEPGHMARECSQGGGGYSGGGGGGRYGSGGGGG---GGGGGLSCY 183 Query: 679 GXXXXGXGXXXXXGGG 632 G GG Sbjct: 184 SCGESGHFARDCTSGG 199 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 43.2 bits (97), Expect = 2e-04 Identities = 26/62 (41%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Frame = -3 Query: 814 KGXGGGXRXGGXGG-GGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXG 638 +G GGG GG GG GG G GG GGG G G GG G G G G Sbjct: 41 EGYGGGH--GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGG 98 Query: 637 GG 632 GG Sbjct: 99 GG 100 Score = 43.2 bits (97), Expect = 2e-04 Identities = 26/60 (43%), Positives = 26/60 (43%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G GGG GG GGG G G GGG GG G GG G G G G GGG Sbjct: 54 GGGGGHGHGGHNGGG----GHGLDGYGGG-GGHYGGGGGHYGGGGGHYGGGGGGYGGGGG 108 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXG 656 GGG G GGGG G GG GG GG G GG G G G G Sbjct: 67 GGGHGLDGYGGGGGHYGGGGGHYGGG--GGHYGGGGGGYGGGGGHHGGGG 114 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGG 634 GG G GGG GGG GG GG G GG GG GGGG Sbjct: 68 GGHGLDGYGGGGGHYGGG-GGHYGGGGGHYGGGGGGYGGGGGHHGGGG 114 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GG GGG GG G G G GG GG GGGGG G Sbjct: 46 GHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYG 97 Score = 37.9 bits (84), Expect = 0.009 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXG 677 G GGG GG GGG G GG GGG GG G GG G G Sbjct: 74 GYGGG---GGHYGGGGGHYGGGGGHYGGG-GGGYGGGGGHHGGGG 114 Score = 37.5 bits (83), Expect = 0.011 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXXGG-GXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GG GG G GGG G GG G GG GG GGGG G Sbjct: 60 GHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGGHHGG 112 Score = 35.5 bits (78), Expect = 0.046 Identities = 24/57 (42%), Positives = 25/57 (43%), Gaps = 2/57 (3%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXG--GGGXXXXGRGGXXXGGGPGGPXXGXG 698 GG GG + G GGG GG G GGG G GG GGG GG G G Sbjct: 62 GGHNGGGGHGLDGY---GGGGGHYGGGGGHYGGGGGHYGGGGGGYGGG-GGHHGGGG 114 Score = 34.7 bits (76), Expect = 0.080 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXX-GGGGGXXG 622 G GG G G GGG G GG GG GG GGGGG G Sbjct: 52 GHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYG 104 Score = 34.3 bits (75), Expect = 0.11 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Frame = -1 Query: 783 EXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXX----GPGGXXXXXGGXXXGGGGGXXG 622 E GGG GG G G GG GG G GG GG GGGG G Sbjct: 41 EGYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGG 98 Score = 33.9 bits (74), Expect = 0.14 Identities = 21/55 (38%), Positives = 22/55 (40%) Frame = -1 Query: 786 VEXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 V+ G G G G GGG G GG G G GG GGGGG G Sbjct: 38 VQPEGYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDG--YGGGGGHYGGGGGHYG 90 Score = 32.3 bits (70), Expect = 0.43 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = -3 Query: 811 GXGGGXRXGGXG---GGGXXXXGRGGXXXGGGPG 719 G GGG GG G GGG G GG GGG G Sbjct: 83 GGGGGHYGGGGGHYGGGGGGYGGGGGHHGGGGHG 116 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 43.2 bits (97), Expect = 2e-04 Identities = 25/69 (36%), Positives = 26/69 (37%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG G GGG GG GGG +GG GGG GG G G Sbjct: 30 GGNGGGSGKGQWLHGGGGEGGGGEGGGGEGGGGQKISKGG--GGGGSGGGQRSSSGGGGG 87 Query: 682 XGXXXXGXG 656 G G G Sbjct: 88 GGEGDGGGG 96 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/52 (38%), Positives = 23/52 (44%) Frame = -1 Query: 786 VEXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 ++ GG G G GGG+GG GG G GG GG G GGG Sbjct: 27 LQAGGNGGGSGKGQWLHGGGGEGGGGEGGGGEGG-GGQKISKGGGGGGSGGG 77 Score = 37.5 bits (83), Expect = 0.011 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG G G GGG G GG G GG G GGG G G Sbjct: 44 GGGGEGGGGEGGGGEGGG-GQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGG 94 Score = 34.7 bits (76), Expect = 0.080 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 4/55 (7%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGG----XXXGGGGGXXG 622 G G GGG GG GG GG GG GG GGGGG G Sbjct: 37 GKGQWLHGGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEG 91 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -3 Query: 787 GGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 GG GGGG G GG GG G GG G G G GGG Sbjct: 46 GGEGGGGEGGGGEGGGGQKISKGGGGGGSGG--GQRSSSGGGGGGGEGDGGG 95 Score = 33.1 bits (72), Expect = 0.25 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 3/63 (4%) Frame = -3 Query: 811 GXGGGXRXGGX--GGGGXXXXGRGGX-XXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXX 641 G GGG G GGGG G GG GGG G GG G G G Sbjct: 31 GNGGGSGKGQWLHGGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGE 90 Query: 640 GGG 632 G G Sbjct: 91 GDG 93 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGG---XXXGPGGXXXXXGGXXXGGGGGXXG 622 G G GG GGG+GG GG G GG G GGGG G Sbjct: 35 GSGKGQWLHGGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGG 89 Score = 33.1 bits (72), Expect = 0.25 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -1 Query: 783 EXGGG-GPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGG 634 E GGG G GGG G GG GG GG GG GGGG Sbjct: 48 EGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGG--GGEGDGGGG 96 Score = 32.7 bits (71), Expect = 0.32 Identities = 21/64 (32%), Positives = 23/64 (35%) Frame = -2 Query: 821 GQKRARWGXAGGWXXGGGXPXXGEGGXXXXXXXXXXXXXXXGXXGGXGXXXXGXGGGXXX 642 G + +W GG GGG GEGG G G G GGG Sbjct: 35 GSGKGQWLHGGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGG--GQRSSSGGGGGGGEGD 92 Query: 641 GGGG 630 GGGG Sbjct: 93 GGGG 96 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 42.7 bits (96), Expect = 3e-04 Identities = 27/74 (36%), Positives = 29/74 (39%) Frame = -3 Query: 853 EGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGX 674 +GG P + G GGG GG GGG GRG GGG G G GG G Sbjct: 8 DGGGGAPIPSYGGDGYGGG---GGYGGGDAGYGGRGA--SGGGSYGGRGGYGGGGGRGNR 62 Query: 673 XXXGXGXXXXXGGG 632 G G GG Sbjct: 63 GGGGGGYQGGDRGG 76 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/56 (39%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Frame = -1 Query: 783 EXGGGGPXXXGGGXXXXGGG--QGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 + GGG P GG GGG GG GG GG GG GGG G G Sbjct: 8 DGGGGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRG 63 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -1 Query: 783 EXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 + G GG GGG GG GG G G GG G GGGG G Sbjct: 33 DAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGGRDG 86 Score = 37.1 bits (82), Expect = 0.015 Identities = 21/59 (35%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGXGG-GGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 G GG + +G GG GG GG GG G G GG GG G G G Sbjct: 24 GGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGG 82 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GG GGG G GG GG G G GG GGGG Sbjct: 19 GGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGG 66 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXG--GGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG G G G GG+GG GG GG GG G G G G Sbjct: 30 GGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGG 83 Score = 31.9 bits (69), Expect = 0.57 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGG-GQGGPXXXGGXXXGPGGXXXXXG-GXXXGGGGGXXG 622 GGGG GGG GG G G GG G GG G G GGGGG G Sbjct: 24 GGGGGY--GGGDAGYGGRGASG----GGSYGGRGGYGGGGGRGNRGGGGGGYQG 71 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGG 743 G GG R G GGG + G GG G GR G Sbjct: 48 GGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGGRDG 86 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXG 700 GGG GGG GGG+GG G Sbjct: 125 GGGGYSRGGGDSDRGGGRGGRNDSG 149 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 42.7 bits (96), Expect = 3e-04 Identities = 27/74 (36%), Positives = 29/74 (39%) Frame = -3 Query: 853 EGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGX 674 +GG P + G GGG GG GGG GRG GGG G G GG G Sbjct: 8 DGGGGAPIPSYGGDGYGGG---GGYGGGDAGYGGRGA--SGGGSYGGRGGYGGGGGRGNR 62 Query: 673 XXXGXGXXXXXGGG 632 G G GG Sbjct: 63 GGGGGGYQGGDRGG 76 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/56 (39%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Frame = -1 Query: 783 EXGGGGPXXXGGGXXXXGGG--QGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 + GGG P GG GGG GG GG GG GG GGG G G Sbjct: 8 DGGGGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRG 63 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -1 Query: 783 EXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 + G GG GGG GG GG G G GG G GGGG G Sbjct: 33 DAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGGRDG 86 Score = 37.1 bits (82), Expect = 0.015 Identities = 21/59 (35%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGXGG-GGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 G GG + +G GG GG GG GG G G GG GG G G G Sbjct: 24 GGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGG 82 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GG GGG G GG GG G G GG GGGG Sbjct: 19 GGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGG 66 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXG--GGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG G G G GG+GG GG GG GG G G G G Sbjct: 30 GGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGG 83 Score = 31.9 bits (69), Expect = 0.57 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGG-GQGGPXXXGGXXXGPGGXXXXXG-GXXXGGGGGXXG 622 GGGG GGG GG G G GG G GG G G GGGGG G Sbjct: 24 GGGGGY--GGGDAGYGGRGASG----GGSYGGRGGYGGGGGRGNRGGGGGGYQG 71 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGG 743 G GG R G GGG + G GG G GR G Sbjct: 48 GGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGGRDG 86 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXG 700 GGG GGG GGG+GG G Sbjct: 125 GGGGYSRGGGDSDRGGGRGGRNDSG 149 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 42.7 bits (96), Expect = 3e-04 Identities = 28/79 (35%), Positives = 28/79 (35%), Gaps = 2/79 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXP-PLPXXXXPPPPXPPXRXPPPX 809 PPP P P P P P PGPPP P P P P P PP P P Sbjct: 204 PPPSPSPTPGPDSPLPSPGPDSPLPL---PGPPPSSSPTPGPDSPLPSPGPPPSPSPTPG 260 Query: 810 PFLAHXXXGXXXP-PSXPP 863 P G P PS P Sbjct: 261 PDSPLPSPGPDSPLPSPGP 279 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/69 (30%), Positives = 22/69 (31%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXG 836 P P P P P P GP P P P P PPP P P P + Sbjct: 166 PPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDS 225 Query: 837 XXXPPSXPP 863 P PP Sbjct: 226 PLPLPGPPP 234 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/84 (32%), Positives = 27/84 (32%), Gaps = 7/84 (8%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPP---GPPPXXXPPLPXXXX----PPPPXPPX 791 PPP P P P P P GPP P P PLP P P PP Sbjct: 176 PPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPS 235 Query: 792 RXPPPXPFLAHXXXGXXXPPSXPP 863 P P P G PS P Sbjct: 236 SSPTPGPDSPLPSPGPPPSPSPTP 259 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/77 (32%), Positives = 26/77 (33%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P +P P P P P P PLP P P P P P P Sbjct: 165 PPPPPYPSPLP---PPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSP 221 Query: 813 FLAHXXXGXXXPPSXPP 863 PPS P Sbjct: 222 GPDSPLPLPGPPPSSSP 238 Score = 37.1 bits (82), Expect = 0.015 Identities = 22/59 (37%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP-PXPPXRXPPP 806 PPP P P P +P PP P PGP P P P P P PP P P Sbjct: 232 PPPSSSPTPGPDSPLP-SPGPPPSPS-PTPGPDSPLPSPGPDSPLPSPGPDPPLPSPGP 288 Score = 36.7 bits (81), Expect = 0.020 Identities = 17/51 (33%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = +1 Query: 604 IIYXXXPXTPPPPXXXPPPXPXXXXPXPPXXP--PXXXRAPLAPPPXXXPP 750 +++ P PPPP P P P P P P P P +P P PP Sbjct: 155 VLWSSDPPLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPP 205 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXP-PXXPPXXXRAPLAPPPXXXPPSP 756 PPPP P P P P P P P P +P P P SP Sbjct: 175 PPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSP 217 Score = 34.7 bits (76), Expect = 0.080 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P P P PP P P P P P P PPP P Sbjct: 164 PPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSP 208 Score = 33.5 bits (73), Expect = 0.19 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXP-PXXPPXXXRAPLAPPPXXXPPSP 756 P PPP P P P P P P P P +P P P SP Sbjct: 228 PLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSP 273 Score = 33.5 bits (73), Expect = 0.19 Identities = 22/64 (34%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGP-PGPPPXXXPPLPXXXXP-PPPXPPXRXPPP 806 P P P P P +P P P P P P P P P P P P P P P Sbjct: 230 PGPPPSSSPTPG---PDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPPLPSP 286 Query: 807 XPFL 818 P L Sbjct: 287 GPHL 290 Score = 33.1 bits (72), Expect = 0.25 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 717 PPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PP PPP P P P P P P P P G PS P Sbjct: 164 PPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTP 212 Score = 32.7 bits (71), Expect = 0.32 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 652 PPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 PPP P P PP P P +P P P SP Sbjct: 164 PPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSP 198 Score = 32.3 bits (70), Expect = 0.43 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +3 Query: 717 PPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PP PPP PP P PPPP P P P + P PP Sbjct: 161 PPLPPPP--PPYPSPL-PPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPP 206 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +P PP P P P P P P P PP P P Sbjct: 172 SPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGP 214 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP 747 P PPP P P P P P P P P P P Sbjct: 247 PSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPPLPSPGP 288 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P P P P P P P P P P PP P P Sbjct: 198 PLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGP 242 Score = 28.7 bits (61), Expect = 5.3 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSPXXG 765 P P P P P P P P P +PL P P PP P G Sbjct: 245 PLPSPGPPPSPSPTPGPDSPLPSPGPD----SPL-PSPGPDPPLPSPG 287 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 663 PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P PP P PP PP PP P PPP P PPP P Sbjct: 255 PLKLPPGRSAPPPPPAAAPPPQPPPPPPPKP----QPPPPPKIARPPPAP 300 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/53 (41%), Positives = 23/53 (43%) Frame = +3 Query: 705 PXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 P P PPP PP PPPP PP PPP P +A PP PP Sbjct: 260 PGRSAPPPPPAAAPP----PQPPPPPPPKPQPPPPPKIAR-------PPPAPP 301 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 663 PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 P P P P PP PPP PP P PPP PP P Sbjct: 260 PGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKGAAP 306 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXX--RAPLAPPPXXXP 747 PPPP PPP P P P PP R P APP P Sbjct: 266 PPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKGAAP 306 Score = 36.7 bits (81), Expect = 0.020 Identities = 18/49 (36%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPX-PPXXPPXXXRAPLAPPPXXXPPSPXXG 765 P PP PPP P P PP PP + P P PP+P G Sbjct: 255 PLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKG 303 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 723 GPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 G PP PP PPP P PPP P Sbjct: 252 GLPPLKLPPGRSAPPPPPAAAPPPQPPPPP 281 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 42.7 bits (96), Expect = 3e-04 Identities = 24/56 (42%), Positives = 24/56 (42%) Frame = -3 Query: 799 GXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G GG G GG GRGG G GPGGP G GG G G G G G Sbjct: 4 GGCGGGPGRGGRGFGGRGGGP-GFGPGGPGFGPGGPGFGPGGPGFGPGGPGFGGRG 58 Score = 41.9 bits (94), Expect = 5e-04 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQG-GPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGP G G GGG G GP GG GPGG GG G GG G Sbjct: 7 GGGPGRGGRGFGGRGGGPGFGP---GGPGFGPGGPGFGPGGPGFGPGGPGFG 55 Score = 41.1 bits (92), Expect = 0.001 Identities = 25/56 (44%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = -3 Query: 817 RKGXGGGXRXGGXG-GGGXXXXGRGGXXXGGGPGGPXXGXGG-XXGAXGXXXXGXG 656 R G GGG GG G GG G G G GPGGP G GG G G G G Sbjct: 3 RGGCGGGPGRGGRGFGGRGGGPGFGPGGPGFGPGGPGFGPGGPGFGPGGPGFGGRG 58 Score = 38.7 bits (86), Expect = 0.005 Identities = 27/70 (38%), Positives = 29/70 (41%), Gaps = 1/70 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXG-GGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 GG GG + +G G G GG G G G G GG G GPGGP G G G Sbjct: 4 GGCGGGPGRGGRGFGGRGGGPGFGPGGPGFGPGGPGFGPGGP--GFGPGGPGFGGRGPRG 61 Query: 685 AXGXXXXGXG 656 G G G Sbjct: 62 -PGFGPRGPG 70 Score = 35.9 bits (79), Expect = 0.035 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXG--GGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG GP G G G G GP GG GPG G GGGG G Sbjct: 55 GGRGPRGPGFGPRGPGPWSGPRGPRPGGGGGPGPGPWSGPRGPRPGGGGGPGSG 108 Score = 33.5 bits (73), Expect = 0.19 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 6/54 (11%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPG------GXXXXXGGXXXGGGGG 631 G GP G G G G GGP G GPG G G GGGGG Sbjct: 32 GFGPGGPGFGPGGPGFGPGGPGFGGRGPRGPGFGPRGPGPWSGPRGPRPGGGGG 85 Score = 33.5 bits (73), Expect = 0.19 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQG----GPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GGP GG GG G GP G GPG G GGGG G Sbjct: 34 GPGGPGFGPGGPGFGPGGPGFGGRGPRGPGFGPRGPGPWSGPRGPRPGGGGGPGPG 89 Score = 33.5 bits (73), Expect = 0.19 Identities = 25/65 (38%), Positives = 25/65 (38%), Gaps = 5/65 (7%) Frame = -3 Query: 811 GXGG-GXRXGGXGGGGXXXXGRG----GXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXX 647 G GG G GG G GG G G G GP GP G GG G G G Sbjct: 41 GPGGPGFGPGGPGFGGRGPRGPGFGPRGPGPWSGPRGPRPGGGGGPG-PGPWSGPRGPRP 99 Query: 646 XXGGG 632 GGG Sbjct: 100 GGGGG 104 Score = 32.3 bits (70), Expect = 0.43 Identities = 24/68 (35%), Positives = 26/68 (38%), Gaps = 4/68 (5%) Frame = -3 Query: 814 KGXGGGXRXGGXGGG--GXXXXGRGGXXXG--GGPGGPXXGXGGXXGAXGXXXXGXGXXX 647 +G G G R G G G G GG G GP GP G GG G+ G G Sbjct: 60 RGPGFGPRGPGPWSGPRGPRPGGGGGPGPGPWSGPRGPRPGGGGGPGSGCGSGTGGG--- 116 Query: 646 XXGGGXXW 623 G G W Sbjct: 117 NQGQGGMW 124 Score = 31.9 bits (69), Expect = 0.57 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXG-PGGXXXXXGGXXXGGGGGXXG 622 G GP G GGG GP G PGG G G GGG G Sbjct: 68 GPGPWSGPRGPRPGGGGGPGPGPWSGPRGPRPGGGGGPGSGCGSGTGGGNQG 119 Score = 30.7 bits (66), Expect = 1.3 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXG 656 G G G G G GG GRG G GP GP G G G G G Sbjct: 37 GPGFGPGGPGFGPGGPGFGGRGPRGPGFGPRGP----GPWSGPRGPRPGGGG 84 Score = 29.9 bits (64), Expect = 2.3 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 3/51 (5%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXG--GGQGGPXXXGGXXXGPG-GXXXXXGGXXXGGGG 634 G GP GGG G G GP GG GPG G GG G GG Sbjct: 74 GPRGPRPGGGGGPGPGPWSGPRGPRPGGG--GGPGSGCGSGTGGGNQGQGG 122 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 42.7 bits (96), Expect = 3e-04 Identities = 23/77 (29%), Positives = 28/77 (36%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P +P PP P P PP P+ PPP PP P P Sbjct: 52 PPPTTTTPPVSAAQPPASPVTPP-PAVTPTSPPAPKVAPV-ISPATPPPQPPQSPPASAP 109 Query: 813 FLAHXXXGXXXPPSXPP 863 ++ P+ PP Sbjct: 110 TVSPPPVSPPPAPTSPP 126 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAP--PPXXXPPSP 756 P +PPP PPP P P P PP P AP PP PSP Sbjct: 115 PVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSP 161 Score = 41.5 bits (93), Expect = 7e-04 Identities = 22/77 (28%), Positives = 23/77 (29%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P P P P PP P P P PP P P Sbjct: 96 PPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPP 155 Query: 813 FLAHXXXGXXXPPSXPP 863 A P+ P Sbjct: 156 VQAPSPISLPPAPAPAP 172 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP 747 P +PPP PPP P P P PP +P++ PP P Sbjct: 129 PASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAP 170 Score = 39.5 bits (88), Expect = 0.003 Identities = 25/79 (31%), Positives = 26/79 (32%), Gaps = 3/79 (3%) Frame = +3 Query: 633 PPPXXXXX--PXPXXXXPXAPXXPPX-PXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P +P PP P PP P PP P P P PP Sbjct: 73 PPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPP-PVSPPPAPTSPPPTPAS 131 Query: 804 PXPFLAHXXXGXXXPPSXP 860 P P A PP P Sbjct: 132 PPPAPASPPPAPASPPPAP 150 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAP-LAPPPXXXPPSP 756 P +PP P P P P PP PP AP ++PPP PP+P Sbjct: 79 PTSPPAPKVAPVISPATPPPQPPQSPP--ASAPTVSPPPVSPPPAP 122 Score = 38.3 bits (85), Expect = 0.007 Identities = 25/81 (30%), Positives = 26/81 (32%), Gaps = 4/81 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPX-PXXGPPGP--PPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P AP PP P PP P PP P P P P P + Sbjct: 118 PPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAPAPTKHKR 177 Query: 804 PXPFLAHXXXGXXXP-PSXPP 863 H P P PP Sbjct: 178 KHKHKRHHHAPAPAPIPPSPP 198 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P TPPP PP PP PP AP +PPP P P Sbjct: 93 PATPPPQPPQSPPASAPTVSPPPVSPPP---APTSPPPTPASPPP 134 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 T PP PPP P P P PP AP +PPP P P Sbjct: 110 TVSPPPVSPPPAPTSPPPTPASPPP----APASPPPAPASPPP 148 Score = 36.7 bits (81), Expect = 0.020 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 3/78 (3%) Frame = +3 Query: 636 PPXXXXXPXPXXXX--PXAPXXPPXPXXGPPGP-PPXXXPPLPXXXXPPPPXPPXRXPPP 806 PP P P P AP P P P PP P PPP PP P Sbjct: 66 PPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSP 125 Query: 807 XPFLAHXXXGXXXPPSXP 860 P A PP P Sbjct: 126 PPTPASPPPAPASPPPAP 143 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P T PP PP P PP +P+ PPP P SP Sbjct: 41 PTTAAPPTTAAPPPTTTTPPVSAAQPP---ASPVTPPPAVTPTSP 82 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXP-XPPXXPPXXXRAPL---APPPXXXPPSP 756 TPP PP P P P PP AP+ A PP P SP Sbjct: 58 TPPVSAAQPPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSP 104 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 42.7 bits (96), Expect = 3e-04 Identities = 25/75 (33%), Positives = 29/75 (38%), Gaps = 6/75 (8%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXX----GPPGPPPXXXPPLPXXXXPPPP--XPPXRXPPPXPFL 818 P P +P PP P PP PPP PP+ PPP P + PPP P Sbjct: 608 PPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPP-- 665 Query: 819 AHXXXGXXXPPSXPP 863 + PP PP Sbjct: 666 VYYSPVTQSPPPPPP 680 Score = 41.5 bits (93), Expect = 7e-04 Identities = 25/85 (29%), Positives = 29/85 (34%), Gaps = 7/85 (8%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXX------GPPGPPPXXXPPLPXXXXPPPP-XP 785 + PP P P P PP P PP PPP PP+ P P P Sbjct: 639 YYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYP 698 Query: 786 PXRXPPPXPFLAHXXXGXXXPPSXP 860 P PP P + + PP P Sbjct: 699 PVTQSPPPPPVYYLPVTQSPPPPSP 723 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/58 (34%), Positives = 22/58 (37%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P +P P PP P P PP+ PPPP P PP Sbjct: 705 PPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPV--TQSPPPPSTPVEYHPP 760 Score = 39.9 bits (89), Expect = 0.002 Identities = 25/77 (32%), Positives = 28/77 (36%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P PP PP P P + PPP PP PPP P Sbjct: 487 PPPSSKMSPSVKAYPPPPP--PPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPP-P 543 Query: 813 FLAHXXXGXXXPPSXPP 863 ++ PPS P Sbjct: 544 YI----YSSPPPPSPSP 556 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/60 (38%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = +3 Query: 687 PXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXP-PSXPP 863 P PP P P PPP P PPP PP PPP P + P PS PP Sbjct: 501 PPPPPPPEY-EPSPPPPSSEMSPSVRAYPPP-PPLSPPPPSPPPPYIYSSPPPPSPSPPP 558 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/62 (32%), Positives = 23/62 (37%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P +P P P PPP PP PPPP P PP P Sbjct: 504 PPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSP----SPPPP 559 Query: 813 FL 818 ++ Sbjct: 560 YI 561 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/78 (29%), Positives = 27/78 (34%), Gaps = 2/78 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP--XPPXRXPPP 806 PPP P P P P PP P P PP+ PPP P + PPP Sbjct: 662 PPPPVYYSPVTQSPPPPPPVYYPPVTQSPP-PSPVYYPPVTQSPPPPPVYYLPVTQSPPP 720 Query: 807 XPFLAHXXXGXXXPPSXP 860 + + PP P Sbjct: 721 PSPVYYPPVAKSPPPPSP 738 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 3/63 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPP---PPXPPXRXPP 803 PPP P P P PP P PP PP P P PP P PP Sbjct: 528 PPPPPLSPPPPSPPPPYIYSSPPPPSPSPP-PPYIYSSPPPVVNCPPTTQSPPPPKYEQT 586 Query: 804 PXP 812 P P Sbjct: 587 PSP 589 Score = 37.1 bits (82), Expect = 0.015 Identities = 21/77 (27%), Positives = 22/77 (28%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P PPP PPPP PP P P P Sbjct: 456 PPPPSSKMSPSFRATPPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPP 515 Query: 813 FLAHXXXGXXXPPSXPP 863 + P PP Sbjct: 516 PSSEMSPSVRAYPPPPP 532 Score = 37.1 bits (82), Expect = 0.015 Identities = 26/82 (31%), Positives = 28/82 (34%), Gaps = 5/82 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGP--PPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P + P PP P PP PP P PPP P PPP Sbjct: 501 PPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPP--PSPSPPP 558 Query: 807 XPFLAHXXXGXXXPP---SXPP 863 + PP S PP Sbjct: 559 PYIYSSPPPVVNCPPTTQSPPP 580 Score = 35.9 bits (79), Expect = 0.035 Identities = 23/76 (30%), Positives = 27/76 (35%), Gaps = 2/76 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP--XPPXRXPPP 806 PPP P P P PP PPP P+ PPP P + PPP Sbjct: 619 PPPPPPTYYAVQSPPPPPPVYYPPVTASPP-PPPVYYTPVIQSPPPPPVYYSPVTQSPPP 677 Query: 807 XPFLAHXXXGXXXPPS 854 P + + PPS Sbjct: 678 PPPVYYPPVTQSPPPS 693 Score = 34.7 bits (76), Expect = 0.080 Identities = 23/81 (28%), Positives = 23/81 (28%), Gaps = 4/81 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP----XPPXRXP 800 PPP P P P P PPP PPPP P R Sbjct: 426 PPPSFKMSPTVRVLPPPPPSSKMSPTFRATPPPPSSKMSPSFRATPPPPSSKMSPSFRAT 485 Query: 801 PPXPFLAHXXXGXXXPPSXPP 863 PP P PP PP Sbjct: 486 PPPPSSKMSPSVKAYPPPPPP 506 Score = 34.7 bits (76), Expect = 0.080 Identities = 26/87 (29%), Positives = 28/87 (32%), Gaps = 11/87 (12%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX-APXX------PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPX 791 PPP P P P +P PP P PP PP PPP PP Sbjct: 579 PPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPV 638 Query: 792 RXPP----PXPFLAHXXXGXXXPPSXP 860 PP P P + PP P Sbjct: 639 YYPPVTASPPPPPVYYTPVIQSPPPPP 665 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 Y P PPP PPP P P PP PP PP+ Sbjct: 527 YPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPT 574 Score = 34.3 bits (75), Expect = 0.11 Identities = 25/93 (26%), Positives = 30/93 (32%), Gaps = 4/93 (4%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGP--PPXXXPPLPXXXXP 770 P+ ++ PP P P +P P PP P P PP P Sbjct: 708 PVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASPNQSP 767 Query: 771 PP--PXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PP PP + P H PPS PP Sbjct: 768 PPEYQSPPPKGCNDSPSNDHHYQ-TPTPPSLPP 799 Score = 33.9 bits (74), Expect = 0.14 Identities = 21/77 (27%), Positives = 24/77 (31%), Gaps = 3/77 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXR---XPP 803 PPP P P P P P PP P P P P P + PP Sbjct: 549 PPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPP 608 Query: 804 PXPFLAHXXXGXXXPPS 854 P + A PP+ Sbjct: 609 PPTYYATQSPPPPPPPT 625 Score = 33.9 bits (74), Expect = 0.14 Identities = 20/63 (31%), Positives = 22/63 (34%), Gaps = 3/63 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP---XPPXRXPP 803 PPP P P P PP PP P+ PPPP P + PP Sbjct: 633 PPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPP-VYYSPVTQSPPPPPPVYYPPVTQSPP 691 Query: 804 PXP 812 P P Sbjct: 692 PSP 694 Score = 33.5 bits (73), Expect = 0.19 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +1 Query: 622 PXTPPPPX--XXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P PPPP PPP P PP PL+PPP PP Sbjct: 501 PPPPPPPEYEPSPPPPSSEMSPSVRAYPPP---PPLSPPPPSPPP 542 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P P P ++P PP PSP Sbjct: 548 SPPPPSPSPPPPYIYSSPPPVVNCPPTTQSP-PPPKYEQTPSP 589 Score = 33.1 bits (72), Expect = 0.25 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAP-----LAPPPXXXPPSP 756 +PPPP P P PP PP P PPP PP P Sbjct: 512 SPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPP 559 Score = 32.3 bits (70), Expect = 0.43 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 13/56 (23%) Frame = +1 Query: 628 TPPPPXXX---------PPPXPXXXXPXPPXXPPXXXRAP----LAPPPXXXPPSP 756 TPPPP PPP P P PP PP +P PPP PP P Sbjct: 485 TPPPPSSKMSPSVKAYPPPPPPPEYEPSPP--PPSSEMSPSVRAYPPPPPLSPPPP 538 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/49 (28%), Positives = 18/49 (36%) Frame = +1 Query: 604 IIYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 + Y +PPPP P P P P ++P P P PP Sbjct: 695 VYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPP 743 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/49 (30%), Positives = 19/49 (38%) Frame = +1 Query: 604 IIYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 + Y +PPPP P P PP ++P PPP PP Sbjct: 638 VYYPPVTASPPPPPVYYTPV-IQSPPPPPVYYSPVTQSPPPPPPVYYPP 685 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/49 (30%), Positives = 19/49 (38%) Frame = +1 Query: 604 IIYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 + Y +PPPP P P PP P ++P P P PP Sbjct: 652 VYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSP-PPSPVYYPP 699 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXP-PXXPPXXXRAPLAPPPXXXPPSP 756 TPPPP P P P P P PPP PSP Sbjct: 470 TPPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSP 513 Score = 28.7 bits (61), Expect = 5.3 Identities = 17/62 (27%), Positives = 20/62 (32%) Frame = +2 Query: 590 SXTNKSYXFXXPXXPPPPPXXXPPXXXXXPPGPXXXXXXXXXXXXXXXXXXXPPPXXXGP 769 S + ++Y P P PPP PP PP P PP P Sbjct: 521 SPSVRAYPPPPPLSP-PPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPP 579 Query: 770 PP 775 PP Sbjct: 580 PP 581 Score = 27.9 bits (59), Expect = 9.2 Identities = 26/82 (31%), Positives = 27/82 (32%), Gaps = 5/82 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP-----XPPXRX 797 PPP P P P PPP PP P PPP P R Sbjct: 471 PPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPP---PP-PEYEPSPPPPSSEMSPSVRA 526 Query: 798 PPPXPFLAHXXXGXXXPPSXPP 863 PP P L+ PPS PP Sbjct: 527 YPPPPPLS------PPPPSPPP 542 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 Y PPPP PP P P P P PPP P Sbjct: 626 YYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPP--PPPVYYSP 670 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 42.7 bits (96), Expect = 3e-04 Identities = 25/77 (32%), Positives = 26/77 (33%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG +G G G GG GGGG G GG G G G G G Sbjct: 15 GGGDGTKGGGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHG 74 Query: 682 XGXXXXGXGXXXXXGGG 632 G G G GGG Sbjct: 75 DGLGCSGGGGDGTKGGG 91 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = -1 Query: 786 VEXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 V GGGG GGG GGG G GG G G GG GGG G G Sbjct: 11 VVSGGGGDGTKGGGNTITGGGGEGKKKNGGGEGGGGEGTSGEGG--GGGGDGTKG 63 Score = 36.7 bits (81), Expect = 0.020 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = -3 Query: 817 RKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXG 638 +K GGG GG G G G G GGG G G G G G G G Sbjct: 35 KKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGTKGGGRRG 94 Query: 637 GG 632 G Sbjct: 95 DG 96 Score = 36.7 bits (81), Expect = 0.020 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG G G GGG GG GG GG G GGG G G Sbjct: 39 GGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGTKG 89 Score = 34.7 bits (76), Expect = 0.080 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = -3 Query: 802 GGXRXGGXGGGG--XXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 GG G GGG G G GGG GG G G G G G GGG Sbjct: 14 GGGGDGTKGGGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGG 72 Score = 33.9 bits (74), Expect = 0.14 Identities = 21/55 (38%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Frame = -1 Query: 777 GGGGPXXXGGGXXXX--GGGQ-GGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GGG+ GG G G GG GG GGG G Sbjct: 22 GGGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDG 76 Score = 33.5 bits (73), Expect = 0.19 Identities = 25/58 (43%), Positives = 25/58 (43%), Gaps = 4/58 (6%) Frame = -1 Query: 783 EXGGGGPX-XXGGGXXXXGGGQG-GPXXXGGXXXG-PGGXXXXXG-GXXXGGGGGXXG 622 E GGGG GGG GGG G G GG G GG G G G GGG G Sbjct: 52 EGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGTKGGGRRGDGLGRGLGRGGGRGG 109 Score = 32.7 bits (71), Expect = 0.32 Identities = 27/77 (35%), Positives = 27/77 (35%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG EGG G GGG G GGG G GG G G G G G Sbjct: 39 GGGEGGGGE-----GTSGEGGGGGGDGTKGGGDGISG-GGHGDGLGCSG---GGGDGTKG 89 Query: 682 XGXXXXGXGXXXXXGGG 632 G G G GGG Sbjct: 90 GGRRGDGLGRGLGRGGG 106 Score = 31.1 bits (67), Expect = 0.99 Identities = 24/70 (34%), Positives = 25/70 (35%), Gaps = 3/70 (4%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPG---GPXXGXGGX 692 GG GG G G G G GGGG +GG G G G G G GG Sbjct: 53 GGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGT--KGGGRRGDGLGRGLGRGGGRGGW 110 Query: 691 XGAXGXXXXG 662 G G G Sbjct: 111 NGRKGFSGEG 120 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 42.3 bits (95), Expect = 4e-04 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 4/64 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXP-PXPXXGPPGPPPXXXPPLPXXXXPPPP---XPPXRXP 800 PPP P P P P P P G P PPP PP P PPPP P P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPP---PPGPKGPRPPPPMSLGPKAPRP 426 Query: 801 PPXP 812 P P Sbjct: 427 PSGP 430 Score = 41.5 bits (93), Expect = 7e-04 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSX 857 P P GPP PPP PP PPPP P PP P PPS Sbjct: 372 PPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPM--SLGPKAPRPPSG 429 Query: 858 P 860 P Sbjct: 430 P 430 Score = 34.7 bits (76), Expect = 0.080 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +3 Query: 663 PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P +P PP GPP PP P P PP R PPP P Sbjct: 142 PGSSPSPSPSRPPKRSRGPPRPPTRPKSPPPR----KSSFPPSRSPPPPP 187 Score = 33.9 bits (74), Expect = 0.14 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 622 PXTPPPPXXXPP-PXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P + PP PP P P P PP PP + P PPP P Sbjct: 380 PSSAGPPRPPPPAPPPGSGGPKPP--PPPGPKGPRPPPPMSLGP 421 Score = 32.7 bits (71), Expect = 0.32 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +1 Query: 622 PXTPPPPXXXP----PPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP 747 P PPPP P P P P P PP P AP P P Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P + P P PP P PP P + PP PP P Sbjct: 142 PGSSPSPSPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPPP 186 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 726 PPPXXXPPLPXXXXPP---PPXPPXRXPPPXPFLAHXXXGXXXPP 851 PPP P +P PP PP PP P P G PP Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +3 Query: 720 PGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PG P P P PP PP R P P + PP PP Sbjct: 142 PGSSPSPSPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPP--PP 187 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 4/53 (7%) Frame = +3 Query: 717 PPGPPPXXXPPLPXXXXPPPPXPPXRXP----PPXPFLAHXXXGXXXPPSXPP 863 PP PP PPPP P + P PP P G P PP Sbjct: 353 PPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPP 405 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSPXXG 765 P P PP P PP P + A PP PP+P G Sbjct: 351 PLPPEPPKFLKVSSKKASAPPPPVPAPQMPSS--AGPPRPPPPAPPPG 396 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 42.3 bits (95), Expect = 4e-04 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 4/64 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXP-PXPXXGPPGPPPXXXPPLPXXXXPPPP---XPPXRXP 800 PPP P P P P P P G P PPP PP P PPPP P P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPP---PPGPKGPRPPPPMSLGPKAPRP 426 Query: 801 PPXP 812 P P Sbjct: 427 PSGP 430 Score = 41.5 bits (93), Expect = 7e-04 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSX 857 P P GPP PPP PP PPPP P PP P PPS Sbjct: 372 PPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPM--SLGPKAPRPPSG 429 Query: 858 P 860 P Sbjct: 430 P 430 Score = 34.7 bits (76), Expect = 0.080 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +3 Query: 663 PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P +P PP GPP PP P P PP R PPP P Sbjct: 142 PGSSPSPSPSRPPKRSRGPPRPPTRPKSPPPR----KSSFPPSRSPPPPP 187 Score = 33.9 bits (74), Expect = 0.14 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 622 PXTPPPPXXXPP-PXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P + PP PP P P P PP PP + P PPP P Sbjct: 380 PSSAGPPRPPPPAPPPGSGGPKPP--PPPGPKGPRPPPPMSLGP 421 Score = 32.7 bits (71), Expect = 0.32 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +1 Query: 622 PXTPPPPXXXP----PPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP 747 P PPPP P P P P P PP P AP P P Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P + P P PP P PP P + PP PP P Sbjct: 142 PGSSPSPSPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPPP 186 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 726 PPPXXXPPLPXXXXPP---PPXPPXRXPPPXPFLAHXXXGXXXPP 851 PPP P +P PP PP PP P P G PP Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +3 Query: 720 PGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PG P P P PP PP R P P + PP PP Sbjct: 142 PGSSPSPSPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPP--PP 187 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 4/53 (7%) Frame = +3 Query: 717 PPGPPPXXXPPLPXXXXPPPPXPPXRXP----PPXPFLAHXXXGXXXPPSXPP 863 PP PP PPPP P + P PP P G P PP Sbjct: 353 PPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPP 405 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSPXXG 765 P P PP P PP P + A PP PP+P G Sbjct: 351 PLPPEPPKFLKVSSKKASAPPPPVPAPQMPSS--AGPPRPPPPAPPPG 396 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 42.3 bits (95), Expect = 4e-04 Identities = 24/78 (30%), Positives = 26/78 (33%), Gaps = 2/78 (2%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP--PPX 809 PP P P P P P PP PP P P P P P PP Sbjct: 299 PPSGQSQPPPTIQPPYQPPPPTQSLHQPPYQPPPQQPQYPQQPPPQLQHPSGYNPEEPPY 358 Query: 810 PFLAHXXXGXXXPPSXPP 863 P ++ PPS PP Sbjct: 359 PQQSYPPNPPRQPPSHPP 376 Score = 36.7 bits (81), Expect = 0.020 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 3/61 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXP--PXPXXGPPGPPPXXXPPLPXXXXPP-PPXPPXRXPP 803 PPP P P P P P P P PP P PP PP P PP Sbjct: 317 PPPTQSLHQPPYQPPPQQPQYPQQPPPQLQHPSGYNPEEPPYPQQSYPPNPPRQPPSHPP 376 Query: 804 P 806 P Sbjct: 377 P 377 Score = 33.1 bits (72), Expect = 0.25 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 P T PP PPP P P PP + P PPP PS Sbjct: 307 PPTIQPPYQPPPPTQSLHQP-PYQPPPQQPQYPQQPPPQLQHPS 349 Score = 32.7 bits (71), Expect = 0.32 Identities = 19/68 (27%), Positives = 20/68 (29%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXG 836 P P + P P PP PP L PPP P P P L H Sbjct: 292 PQQEPYFPPSGQSQPPPTIQPPYQPPPPTQSLHQPPYQPPPQQPQYPQQPPPQLQHPSGY 351 Query: 837 XXXPPSXP 860 P P Sbjct: 352 NPEEPPYP 359 Score = 27.9 bits (59), Expect = 9.2 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +1 Query: 622 PXTPPPPXXX---PPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPPP PP P P P PP + P P PP P Sbjct: 313 PYQPPPPTQSLHQPPYQPPPQQPQYPQQPPPQLQHPSGYNP-EEPPYP 359 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 42.3 bits (95), Expect = 4e-04 Identities = 22/75 (29%), Positives = 24/75 (32%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 H P P P P P P PP P P PP P PP PPP Sbjct: 40 HSPLPSPVYSSPADLPPPPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPP 99 Query: 807 XPFLAHXXXGXXXPP 851 + A+ PP Sbjct: 100 QAYQAYYYRKSPPPP 114 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/58 (32%), Positives = 22/58 (37%) Frame = +1 Query: 577 SXLYXSXQ*IIYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 S +Y S + P PPP PPP P PP P+ PPP PP Sbjct: 45 SPVYSSPADLPPPPTPVYSPPPADLPPPPTPYYSPPADLPPP----TPIYPPPVAFPP 98 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/59 (28%), Positives = 19/59 (32%) Frame = +3 Query: 687 PXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 P P P P PP P PP P PPP P+ + P PP Sbjct: 38 PQHSPLPSPVYSSPADLPPPPTPVYSPPPADLP----PPPTPYYSPPADLPPPTPIYPP 92 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 42.3 bits (95), Expect = 4e-04 Identities = 27/77 (35%), Positives = 27/77 (35%), Gaps = 2/77 (2%) Frame = +3 Query: 639 PXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPL--PXXXXPPPPXPPXRXPPPXP 812 P P P AP PP P PP PPP PP P PPPP PP P Sbjct: 6 PPYPPLPQPPSQNSLAPPPPP-PSLPPPVPPP---PPSHQPYSYPPPPPPPPHAYYQQGP 61 Query: 813 FLAHXXXGXXXPPSXPP 863 PP PP Sbjct: 62 HYPQFNQLQAPPPPPPP 78 Score = 37.9 bits (84), Expect = 0.009 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 7/67 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPP-------XXXPPLPXXXXPPPPXPPX 791 PPP P P P P P PP PPP P PPPP PP Sbjct: 24 PPPPSLPPPVP----PPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPPS 79 Query: 792 RXPPPXP 812 PP P Sbjct: 80 APPPLVP 86 Score = 32.7 bits (71), Expect = 0.32 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y P P PPP P P P PP PPP PP P Sbjct: 8 YPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPP---PPPP 53 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPP-XXXRAPLAPPPXXXPP 750 P + PPP PPP P P P +AP PPP PP Sbjct: 42 PYSYPPP---PPPPPHAYYQQGPHYPQFNQLQAPPPPPPPSAPP 82 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 6/46 (13%) Frame = +1 Query: 631 PPPPXXXPP------PXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P PP PP P P PP PP P + PP PP Sbjct: 7 PYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPP 52 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +1 Query: 631 PPPPXXXPPP--XPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 PP P PP P PP PP P + P PP P Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPP 49 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 41.5 bits (93), Expect = 7e-04 Identities = 27/70 (38%), Positives = 27/70 (38%), Gaps = 3/70 (4%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRG-GXXXGGGPGGPXXGXGG--X 692 GG GG A G GG G GGG G G G GGGPGG G G Sbjct: 149 GGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGGASGDKP 208 Query: 691 XGAXGXXXXG 662 GA G G Sbjct: 209 EGAPGDKPGG 218 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/63 (38%), Positives = 25/63 (39%), Gaps = 3/63 (4%) Frame = -3 Query: 811 GXGG--GXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXG-XGGXXGAXGXXXXGXGXXXXX 641 G GG G + GG GGG G G GG GG G GG G G G Sbjct: 125 GAGGPSGDKPGGASGGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGAS 184 Query: 640 GGG 632 GGG Sbjct: 185 GGG 187 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/69 (39%), Positives = 27/69 (39%), Gaps = 2/69 (2%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGG--GXXXXGRGGXXXGGGPGGPXXGXGGXX 689 GG GG P G G G GG GG G G G GGGPGG GG Sbjct: 135 GGASGGGDKPG---GASGGGPGGASGGASGGASGGASGGASGGASGGGPGG--ASGGGPG 189 Query: 688 GAXGXXXXG 662 GA G G Sbjct: 190 GASGGGPGG 198 Score = 39.5 bits (88), Expect = 0.003 Identities = 26/77 (33%), Positives = 27/77 (35%), Gaps = 1/77 (1%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGX-GGXXGA 683 G G P GGG + GG GGG G G GG GG G GG G Sbjct: 121 GEMSGAGGPSGDKPGGASGGGDKPGGASGGGPG--GASGGASGGASGGASGGASGGASGG 178 Query: 682 XGXXXXGXGXXXXXGGG 632 G G GGG Sbjct: 179 GPGGASGGGPGGASGGG 195 Score = 38.3 bits (85), Expect = 0.007 Identities = 25/78 (32%), Positives = 25/78 (32%), Gaps = 2/78 (2%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGG--GGXXXXGRGGXXXGGGPGGPXXGXGGXX 689 GG GG A G GG G GG GG GG G GGP GG Sbjct: 145 GGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGGAS 204 Query: 688 GAXGXXXXGXGXXXXXGG 635 G G GG Sbjct: 205 GDKPEGAPGDKPGGAWGG 222 Score = 37.1 bits (82), Expect = 0.015 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRG-GXXXGGGPGGPXXGXGGXXG 686 G GG A G GG G GG G G G GGGPGG GG G Sbjct: 141 GDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGG--ASGGGPGG 198 Query: 685 AXG 677 A G Sbjct: 199 ASG 201 Score = 35.5 bits (78), Expect = 0.046 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = -1 Query: 774 GGGPXXXGGGXXXXG-GGQGGPXXXGGXXXGPGG-XXXXXGGXXXGGGGGXXG 622 GGGP GG GG G G GPGG GG GG GG G Sbjct: 149 GGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASG 201 Score = 33.5 bits (73), Expect = 0.19 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 2/78 (2%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGG--GGXXXXGRGGXXXGGGPGGPXXGXGGXX 689 GG GG A G GG GG GG GG GG G P GG Sbjct: 161 GGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGGASGDKPEGAPGDKPGGAW 220 Query: 688 GAXGXXXXGXGXXXXXGG 635 G G GG Sbjct: 221 GGKPGKKPGHKPEGARGG 238 Score = 31.9 bits (69), Expect = 0.57 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GG GG GG G G GPGG G GG G Sbjct: 157 GGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGGASG 205 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 G GGP G GG + G GG GG G GG G Sbjct: 125 GAGGPSGDKPGGASGGGDKPGGASGGGPGGASGGASGGASGGASGGASG 173 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG G GG GG G GG G GG G Sbjct: 139 GGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPG 189 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQ-GGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G P GG GG GGP G G G GG G GG G Sbjct: 131 GDKPGGASGGGDKPGGASGGGPGGASGGASG-GASGGASGGASGGASGGGPG 181 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGG--PGGPXXGXGGXXGAXGXXXXG 662 G G + G G G + G GGG PGG GG GA G G Sbjct: 113 GGASGDKPGEMSGAGGPSGDKPGGASGGGDKPGGA--SGGGPGGASGGASGG 162 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = -1 Query: 774 GGGPX-XXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXG 643 GGGP GGG GG G G PGG G G Sbjct: 185 GGGPGGASGGGPGGASGGASGDKPEGAPGDKPGGAWGGKPGKKPG 229 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GG GG GG G G GPGG G G G Sbjct: 165 GGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGGASGDKPEGAPG 213 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 41.5 bits (93), Expect = 7e-04 Identities = 22/66 (33%), Positives = 25/66 (37%), Gaps = 4/66 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPP--XXXPPLPXXXXPPPPXPP--XRXP 800 P P P P +P PP PP PPP PP P PP PP P Sbjct: 47 PSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSP 106 Query: 801 PPXPFL 818 PP ++ Sbjct: 107 PPPTYI 112 Score = 37.1 bits (82), Expect = 0.015 Identities = 21/62 (33%), Positives = 23/62 (37%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P PP P PPP PP PPPP PPP P Sbjct: 65 PPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPP---PPF-VYSSPPPPTYIYNSPPPPP 120 Query: 813 FL 818 ++ Sbjct: 121 YV 122 Score = 36.7 bits (81), Expect = 0.020 Identities = 23/68 (33%), Positives = 25/68 (36%), Gaps = 6/68 (8%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXP-XXGPPGPPP---XXXPPLPXXXXPPPPXPP--XR 794 PPP P PP P P PPP PP P PP PP + Sbjct: 35 PPPQPYVYSPPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYK 94 Query: 795 XPPPXPFL 818 PPP PF+ Sbjct: 95 SPPPPPFV 102 Score = 32.3 bits (70), Expect = 0.43 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +1 Query: 631 PPPPX--XXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 PPPP PPP P PP PP ++P PP P P Sbjct: 66 PPPPYVYNSPPPPPPYIYNSPP-RPPYVYKSPPPPPFVYSSPPP 108 Score = 31.5 bits (68), Expect = 0.75 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 3/52 (5%) Frame = +1 Query: 610 YXXXPXTPPP-PXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP--XXXPPSP 756 Y P P P PPP P PP PP +P PPP PP P Sbjct: 40 YVYSPPLPSPYVYKSPPPSPYLYSSPPP--PPYVYNSPPPPPPYIYNSPPRP 89 Score = 31.1 bits (67), Expect = 0.99 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y P P PP P PP PP +P PP P P Sbjct: 50 YVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPP 98 Score = 30.3 bits (65), Expect = 1.7 Identities = 21/54 (38%), Positives = 24/54 (44%), Gaps = 7/54 (12%) Frame = +3 Query: 678 PXAPXXPPXPXX-GPPGPPPXXX---PPLPXXXXPPPPXPPX---RXPPPXPFL 818 P +P PP P PP P P PP P PPP PP PPP P++ Sbjct: 32 PQSP--PPQPYVYSPPLPSPYVYKSPPPSPYLYSSPPP-PPYVYNSPPPPPPYI 82 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/66 (28%), Positives = 22/66 (33%), Gaps = 4/66 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXX---PPLPXXXXPPPPXP-PXRXP 800 PPP P + PP P PPP P +P PPP P Sbjct: 157 PPPPYVYNSAPRVLFIYSSPPPPPYVYNSPPPPPYVYESVPRIPFIYSSPPPPPYVYNSA 216 Query: 801 PPXPFL 818 P PF+ Sbjct: 217 PRIPFI 222 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPP-PXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P +PPP P PP P P P +P PP P P Sbjct: 32 PQSPPPQPYVYSPPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPP 77 Score = 29.1 bits (62), Expect = 4.0 Identities = 21/71 (29%), Positives = 23/71 (32%), Gaps = 2/71 (2%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXXGPPGPPPXXXPP--LPXXXXPPPPXPPXRXPPPXPFLAHXX 830 P P AP P PP P P L PPPP PPP P++ Sbjct: 137 PPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPRVLFIYSSPPPPPYVYNSPPPPPYVYESV 196 Query: 831 XGXXXPPSXPP 863 S PP Sbjct: 197 PRIPFIYSSPP 207 Score = 28.7 bits (61), Expect = 5.3 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 1/59 (1%) Frame = +1 Query: 583 LYXSXQ*IIYXXXPXTPPPP-XXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 LY S Y PPPP PP P PP PP +P PPP SP Sbjct: 61 LYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPP-PPPFVYSSP--PPPTYIYNSP 116 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 41.5 bits (93), Expect = 7e-04 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPPP PPP P P P P PPP PP P Sbjct: 69 PPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPP 113 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = +3 Query: 663 PXXXXPXAPXXPPXPXXGPP---GPPPXXXPPLPXXXX-PPPPXPPXRXPPPXP 812 P P P PP P PP P P PP P P P PP PPP P Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPP 114 Score = 37.9 bits (84), Expect = 0.009 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P PP P P PP PP P PP P PPP P Sbjct: 63 PPPPQTPPPPP----PPQSLPPPSPSPEPEHYPP---PPYHHYITPSPPPPRPLPPPPPP 115 Score = 37.5 bits (83), Expect = 0.011 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +3 Query: 684 APXXPPXPXXGPPGPPPXXXPPLPXXXXPPP-PXPPXRXPPPXPFLAHXXXGXXXPPSXP 860 AP P P PP PP P PPP P P PP P+ + P P Sbjct: 51 APSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLP 110 Query: 861 P 863 P Sbjct: 111 P 111 Score = 37.1 bits (82), Expect = 0.015 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 5/63 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGP-----PPXXXPPLPXXXXPPPPXPPXRX 797 PPP P P P P P P PP P P PP P PPPP PP Sbjct: 64 PPPQTPPPPPPPQSLPP-PSPSPEPEHYPPPPYHHYITPSPPPPRPL---PPPPPPPLHF 119 Query: 798 PPP 806 P Sbjct: 120 SSP 122 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPL-APPPXXXPPSP 756 Y +P P P P P P PP PP P +P P PP P Sbjct: 47 YNSPAPSPEPEDYLPLPPPPQTPPPPP--PPQSLPPPSPSPEPEHYPPPP 94 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 41.5 bits (93), Expect = 7e-04 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXG 662 G GGG GG GGG G GG G G GG G GG GA G G Sbjct: 101 GGGGGGYGGGTPGGG----GGGGGDTGAGAGGGGYGGGGDTGAGGGVGSG 146 Score = 35.9 bits (79), Expect = 0.035 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 772 GGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 GG G GG GG PGG G G G G G GGG Sbjct: 96 GGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGG 142 Score = 35.9 bits (79), Expect = 0.035 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGG 637 GGG GGG GGG GG G G GG G G G Sbjct: 101 GGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGGVGSG 146 Score = 34.7 bits (76), Expect = 0.080 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 768 GPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGG 634 G GGG GGG G GG G G GG GGGG Sbjct: 91 GTTPPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGG 135 Score = 33.9 bits (74), Expect = 0.14 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GGG G GG G G GG G GG G Sbjct: 96 GGGDVGGGGGG---YGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGGVG 144 Score = 33.1 bits (72), Expect = 0.25 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 787 GGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXG 638 GG GGG G G GGG GG G G G G G G Sbjct: 97 GGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGGVGSG 146 Score = 32.7 bits (71), Expect = 0.32 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPG 719 GG GG G GGG G G GG G G GGG G Sbjct: 97 GGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGGVG 144 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 747 GXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GGG G G PGG G G GGG G Sbjct: 91 GTTPPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYG 132 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 720 PGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P PPP PP P PPPP PP PPP P Sbjct: 365 PVPPPRRSPP-PLQTPPPPPPPPPLAPPPPP 394 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP +P PP PPP PP PPPP PP PPP Sbjct: 347 PPPPPNRAAFQAITQEKSPVPPPRR-----SPPPLQTPP------PPPPPPPLAPPPP 393 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPP 702 P PPP PPP P P PP PP Sbjct: 369 PRRSPPPLQTPPPPP----PPPPLAPP 391 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/58 (29%), Positives = 18/58 (31%), Gaps = 1/58 (1%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLP-XXXXPPPPXPPXRXPPPXPFLAHXXXGXXXP 848 P + PP P PP P P P P PPP P A G P Sbjct: 37 PESSTPPPPDFQSTPSPPLPDTPDQPFFPENPSTPQQTLFPPPPPPVSADVNGGLPIP 94 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 +P PP PP P P PP P PLAPPP Sbjct: 364 SPVPPPRRSPP-PLQTPPPPPPPP------PLAPPP 392 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 41.1 bits (92), Expect = 0.001 Identities = 25/78 (32%), Positives = 26/78 (33%), Gaps = 4/78 (5%) Frame = +3 Query: 639 PXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPP----PPXPPXRXPPP 806 P P P P PP P PP P PP+P PP PP P PPP Sbjct: 175 PPFLKKPCPPKYSPPVEVPPPVPVYEPP-PKKEIPPPVPVYDPPPKKEVPPPVPVYKPPP 233 Query: 807 XPFLAHXXXGXXXPPSXP 860 L PP P Sbjct: 234 KVELPPPIPKKPCPPKPP 251 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/60 (38%), Positives = 24/60 (40%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P PP P PP P PP+P PP P P PPP P Sbjct: 208 PPPVPVYDPPPKKEVP-----PPVPVYKPP-PKVELPPPIPKKPCPPKP-PKIEHPPPVP 260 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/61 (37%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXR-XPPPX 809 PPP P P P PP P PP P PP+P P P PP + PPP Sbjct: 256 PPPVPVYKPPPKIEKP-----PPVPVYKPP-PKIEHPPPVPVHKLPKKPCPPKKVDPPPV 309 Query: 810 P 812 P Sbjct: 310 P 310 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/69 (34%), Positives = 26/69 (37%), Gaps = 5/69 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXP-----PPPXPPXRX 797 PPP P P P PP P PP P PP+P P PPP P Sbjct: 193 PPPVPVYEPPPKKEIP-----PPVPVYDPP-PKKEVPPPVPVYKPPPKVELPPPIPKKPC 246 Query: 798 PPPXPFLAH 824 PP P + H Sbjct: 247 PPKPPKIEH 255 Score = 37.5 bits (83), Expect = 0.011 Identities = 24/63 (38%), Positives = 25/63 (39%), Gaps = 5/63 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPP-LPXXXXPP----PPXPPXRX 797 PPP P P P P P P PP PP PP +P PP PP P Sbjct: 223 PPPVPVYKPPPKVELP--PPIPKKPC--PPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYK 278 Query: 798 PPP 806 PPP Sbjct: 279 PPP 281 Score = 35.9 bits (79), Expect = 0.035 Identities = 26/92 (28%), Positives = 30/92 (32%), Gaps = 2/92 (2%) Frame = +3 Query: 582 IIXLXPINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPG--PPPXXXPPLP 755 +I I H + PPP P P PP P PP P PP+P Sbjct: 340 VIPPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVPIYKPPVVIPKKPCPPPVP 399 Query: 756 XXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPP 851 PP P + PP P L PP Sbjct: 400 -VYKPPVVVIPKKPCPPLPQLPPLPKFPPLPP 430 Score = 35.1 bits (77), Expect = 0.061 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 720 PGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPP 851 P PPP PP PP PP PPP P PP Sbjct: 167 PLPPPLELPPFLKKPCPPKYSPPVEVPPPVPVYEPPPKKEIPPP 210 Score = 34.7 bits (76), Expect = 0.080 Identities = 25/76 (32%), Positives = 25/76 (32%), Gaps = 4/76 (5%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPP----GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP PP PPP P P PP P PP Sbjct: 231 PPPKVELPPPIPKKP-CPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKPP--PKIEHPP 287 Query: 804 PXPFLAHXXXGXXXPP 851 P P H PP Sbjct: 288 PVP--VHKLPKKPCPP 301 Score = 34.7 bits (76), Expect = 0.080 Identities = 22/82 (26%), Positives = 23/82 (28%), Gaps = 3/82 (3%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPP---XXXPPLPXXXXPPPPXPPXRX 797 H PP P P P P P P P P P P PPP P + Sbjct: 255 HPPPVPVYKPPPKIEKPPPVPVYKPPPKIEHPPPVPVHKLPKKPCPPKKVDPPPVPVHKP 314 Query: 798 PPPXPFLAHXXXGXXXPPSXPP 863 P P P PP Sbjct: 315 PTKKPCPPKKVDPPPVPVHKPP 336 Score = 34.3 bits (75), Expect = 0.11 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 8/68 (11%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPG----PPPXXXPPLPXXXXPPP----PXPP 788 PPP P PP P PP PP PP PPP P P Sbjct: 286 PPPVPVHKLPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKIVIPPPK 345 Query: 789 XRXPPPXP 812 PPP P Sbjct: 346 IEHPPPVP 353 Score = 34.3 bits (75), Expect = 0.11 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 3/63 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPP---PPXPPXRXPP 803 PP P P P PP PP P P PP P PP PP PP Sbjct: 321 PPKKVDPPPVPVHKPPPKIVIPPPKIEHPP-PVPVYKPP-PKIEHPPIYIPPIVKKPCPP 378 Query: 804 PXP 812 P P Sbjct: 379 PVP 381 Score = 33.9 bits (74), Expect = 0.14 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 4/62 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPP----GPPPXXXPPLPXXXXPPPPXPPXRXP 800 PP P P P PP PP PPP P P PPP P P Sbjct: 300 PPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKIVIPPPKIEHPPP--VPVYKP 357 Query: 801 PP 806 PP Sbjct: 358 PP 359 Score = 33.5 bits (73), Expect = 0.19 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 3/60 (5%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPL---PXXXXPPPPXPPXRXPP 803 PPP P P P P P PP PP+ P P PP P PP Sbjct: 327 PPPVPVHKPPPKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVPIYKPP 386 Score = 33.1 bits (72), Expect = 0.25 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP-PXPPXRXPP 803 PP P P P P P P P PP+P PP PP PP Sbjct: 314 PPTKKPCPPKKVDPPPVPVHKPPPKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIPP 370 Score = 31.9 bits (69), Expect = 0.57 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXX-XPPPXPXXXXPXPPXXPPXXXRAPLAP-PPXXXPPSP 756 P PPP PPP P P PP + P P PP P P Sbjct: 212 PVYDPPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPP 258 Score = 31.9 bits (69), Expect = 0.57 Identities = 23/71 (32%), Positives = 25/71 (35%), Gaps = 8/71 (11%) Frame = +3 Query: 636 PPXXXX--XPXPXXXXPXAPXXPPXPXXGPPGP--PPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P P PP PP P P P P PPP P + PP Sbjct: 279 PPPKIEHPPPVPVHKLPKKP-CPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPP 337 Query: 804 ----PXPFLAH 824 P P + H Sbjct: 338 KIVIPPPKIEH 348 Score = 31.1 bits (67), Expect = 0.99 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 4/62 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPP----PPXPPXRXP 800 PP P P P P PP PP+P PP PP P P Sbjct: 157 PPFKGFDHPFPLPPPLELPPFLKKPCPPKYSPPVEVPPPVPVYEPPPKKEIPPPVPVYDP 216 Query: 801 PP 806 PP Sbjct: 217 PP 218 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +1 Query: 622 PXTPPPPXXX--PPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P PPP PPP P P PP P P P PP Sbjct: 189 PVEVPPPVPVYEPPPKKEIPPPVPVYDPPPKKEVP-PPVPVYKPP 232 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PP PPP P P PP PPP P P Sbjct: 183 PPKYSPPVEVPPPVPVYEPPPKKEIPPPV--PVYDPPPKKEVPPP 225 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +1 Query: 622 PXTPPPPX-XXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P P PP PPP P P PP P P P PP Sbjct: 295 PKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPP--PVPVHKPP 336 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/47 (31%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 P PPP PP P P PP P+ PP P P Sbjct: 331 PVHKPPPKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPCP 377 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/60 (36%), Positives = 23/60 (38%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 H PPP P P +P PP PP PP P P PPPP PPP Sbjct: 565 HSPPPPPYYSPSPKPAYKSSP--PPYVYSSPP-PPYYSPAPKPVYKSPPPPYVYNSPPPP 621 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 3/61 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAP---XXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P P PP P P P PP P PPP PP P Sbjct: 694 PPPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPP-PPYYSPS 752 Query: 804 P 806 P Sbjct: 753 P 753 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 4/62 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX---APXXPPXPXXGPPGPPPXXXP-PLPXXXXPPPPXPPXRXP 800 PPP P P P A PP P PPP P P P PPPP P Sbjct: 233 PPPYVYSSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPIYKSPPPPYVYNSPP 292 Query: 801 PP 806 PP Sbjct: 293 PP 294 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 4/62 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX---APXXPPXPXXGPPGPPPXXXP-PLPXXXXPPPPXPPXRXP 800 PPP P P P A PP P PPP P P P PPPP P Sbjct: 333 PPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPP 392 Query: 801 PP 806 PP Sbjct: 393 PP 394 Score = 39.5 bits (88), Expect = 0.003 Identities = 25/86 (29%), Positives = 28/86 (32%), Gaps = 9/86 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPX------P 785 PPP P P P P PP P P P PP P PPP Sbjct: 342 PPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSPK 401 Query: 786 PXRXPPPXPFLAHXXXGXXXPPSXPP 863 P PP P++ + PS P Sbjct: 402 PVYKSPPPPYIYNSPPPPYYSPSPKP 427 Score = 39.5 bits (88), Expect = 0.003 Identities = 28/82 (34%), Positives = 29/82 (35%), Gaps = 5/82 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX----PPXPXXGPPGPPPXXXP-PLPXXXXPPPPXPPXRX 797 PPP P P P AP PP P PPP P P P PPPP Sbjct: 685 PPPYVYSSPPPPYYSP-APKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSP 743 Query: 798 PPPXPFLAHXXXGXXXPPSXPP 863 PPP + PP PP Sbjct: 744 PPPPYYSPSPKVEYKSPP--PP 763 Score = 39.1 bits (87), Expect = 0.004 Identities = 25/86 (29%), Positives = 28/86 (32%), Gaps = 9/86 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPX------P 785 PPP P P P P PP P P P PP P PPP Sbjct: 217 PPPYYSPSPKPVYKSPPPPYVYSSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPK 276 Query: 786 PXRXPPPXPFLAHXXXGXXXPPSXPP 863 P PP P++ + PS P Sbjct: 277 PIYKSPPPPYVYNSPPPPYYSPSPKP 302 Score = 38.7 bits (86), Expect = 0.005 Identities = 26/86 (30%), Positives = 29/86 (33%), Gaps = 9/86 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXX-PPPPX-----P 785 PPP P P P P PP P P P PP P PPPP Sbjct: 267 PPPYYSPSPKPIYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPK 326 Query: 786 PXRXPPPXPFLAHXXXGXXXPPSXPP 863 P PP P++ + PS P Sbjct: 327 PVYKSPPPPYVYNSPPPPYYSPSPKP 352 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 4/62 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXP-PLPXXXXPPPPXPPXRXP 800 PPP P P P PP P PPP P P P PPPP P Sbjct: 83 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYNSPP 142 Query: 801 PP 806 PP Sbjct: 143 PP 144 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 4/62 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXP-PLPXXXXPPPPXPPXRXP 800 PPP P P P PP P PPP P P P PPPP P Sbjct: 183 PPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPPYVYSSPP 242 Query: 801 PP 806 PP Sbjct: 243 PP 244 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 4/62 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXP-PLPXXXXPPPPXPPXRXP 800 PPP P P P PP P PPP P P P PPPP P Sbjct: 208 PPPYIYSSPPPPYYSPSPKPVYKSPPPPYVYSSPPPPYYSPSPKPAYKSPPPPYVYSSPP 267 Query: 801 PP 806 PP Sbjct: 268 PP 269 Score = 38.3 bits (85), Expect = 0.007 Identities = 25/86 (29%), Positives = 27/86 (31%), Gaps = 9/86 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPX------P 785 PPP P P P P PP P P P PP P PPP Sbjct: 317 PPPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPK 376 Query: 786 PXRXPPPXPFLAHXXXGXXXPPSXPP 863 P PP P++ PS P Sbjct: 377 PTYKSPPPPYVYSSPPPPYYSPSPKP 402 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 4/62 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXP-PLPXXXXPPPPXPPXRXP 800 PPP P P P PP P PPP P P P PPPP P Sbjct: 458 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKPSYKSPPPPYVYNSPP 517 Query: 801 PP 806 PP Sbjct: 518 PP 519 Score = 38.3 bits (85), Expect = 0.007 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 5/63 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX----PPXPXXGPPGPPPXXXP-PLPXXXXPPPPXPPXRX 797 PPP P P P AP PP P PPP P P P PPPP Sbjct: 585 PPPYVYSSPPPPYYSP-APKPVYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSP 643 Query: 798 PPP 806 PPP Sbjct: 644 PPP 646 Score = 38.3 bits (85), Expect = 0.007 Identities = 25/86 (29%), Positives = 27/86 (31%), Gaps = 9/86 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPX------P 785 PPP P P P P PP P P P PP P PPP Sbjct: 594 PPPYYSPAPKPVYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPK 653 Query: 786 PXRXPPPXPFLAHXXXGXXXPPSXPP 863 P PP P++ PS P Sbjct: 654 PTYKSPPPPYVYSSPPPPYYSPSPKP 679 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 4/62 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXP-PLPXXXXPPPPXPPXRXP 800 PPP P P P PP P PPP P P P PPPP P Sbjct: 635 PPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPP 694 Query: 801 PP 806 PP Sbjct: 695 PP 696 Score = 38.3 bits (85), Expect = 0.007 Identities = 25/86 (29%), Positives = 27/86 (31%), Gaps = 9/86 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPX------P 785 PPP P P P P PP P P P PP P PPP Sbjct: 644 PPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAPK 703 Query: 786 PXRXPPPXPFLAHXXXGXXXPPSXPP 863 P PP P++ PS P Sbjct: 704 PTYKSPPPPYVYSSPPPPYYSPSPKP 729 Score = 37.9 bits (84), Expect = 0.009 Identities = 25/86 (29%), Positives = 27/86 (31%), Gaps = 9/86 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPX------P 785 PPP P P P P PP P P P PP P PPP Sbjct: 192 PPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPPYVYSSPPPPYYSPSPK 251 Query: 786 PXRXPPPXPFLAHXXXGXXXPPSXPP 863 P PP P++ PS P Sbjct: 252 PAYKSPPPPYVYSSPPPPYYSPSPKP 277 Score = 37.9 bits (84), Expect = 0.009 Identities = 25/86 (29%), Positives = 27/86 (31%), Gaps = 9/86 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPX------P 785 PPP P P P P PP P P P PP P PPP Sbjct: 292 PPPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSPK 351 Query: 786 PXRXPPPXPFLAHXXXGXXXPPSXPP 863 P PP P++ PS P Sbjct: 352 PAYKSPPPPYVYSSPPPPYYSPSPKP 377 Score = 37.9 bits (84), Expect = 0.009 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 4/62 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXP-PLPXXXXPPPPXPPXRXP 800 PPP P P P PP P PPP P P P PPPP P Sbjct: 383 PPPYVYSSPPPPYYSPSPKPVYKSPPPPYIYNSPPPPYYSPSPKPSYKSPPPPYVYSSPP 442 Query: 801 PP 806 PP Sbjct: 443 PP 444 Score = 37.5 bits (83), Expect = 0.011 Identities = 25/86 (29%), Positives = 27/86 (31%), Gaps = 9/86 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPX------P 785 PPP P P P P PP P P P PP P PPP Sbjct: 242 PPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPIYKSPPPPYVYNSPPPPYYSPSPK 301 Query: 786 PXRXPPPXPFLAHXXXGXXXPPSXPP 863 P PP P++ PS P Sbjct: 302 PAYKSPPPPYVYSFPPPPYYSPSPKP 327 Score = 37.1 bits (82), Expect = 0.015 Identities = 24/86 (27%), Positives = 27/86 (31%), Gaps = 9/86 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPX------P 785 PPP P P P P PP P P P PP P PPP Sbjct: 619 PPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPK 678 Query: 786 PXRXPPPXPFLAHXXXGXXXPPSXPP 863 P PP P++ P+ P Sbjct: 679 PTYKSPPPPYVYSSPPPPYYSPAPKP 704 Score = 36.7 bits (81), Expect = 0.020 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 3/61 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAP---XXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P P PP P P P PP P PP PP P Sbjct: 392 PPPYYSPSPKPVYKSPPPPYIYNSPPPPYYSPSPKPSYKSPPPPYVYSSPP--PPYYSPS 449 Query: 804 P 806 P Sbjct: 450 P 450 Score = 36.7 bits (81), Expect = 0.020 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P PP PP +P P PP P Sbjct: 617 SPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPP 662 Score = 36.7 bits (81), Expect = 0.020 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P P PP P P Sbjct: 710 PPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSP 769 Query: 804 PXPF 815 P P+ Sbjct: 770 PPPY 773 Score = 36.3 bits (80), Expect = 0.026 Identities = 22/71 (30%), Positives = 24/71 (33%), Gaps = 9/71 (12%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPX------P 785 PPP P P P P PP P P P PP P PPP Sbjct: 367 PPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSPKPVYKSPPPPYIYNSPPPPYYSPSPK 426 Query: 786 PXRXPPPXPFL 818 P PP P++ Sbjct: 427 PSYKSPPPPYV 437 Score = 36.3 bits (80), Expect = 0.026 Identities = 20/65 (30%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX----PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 PPP P P +P PP P PPP P PPP P Sbjct: 735 PPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSP 794 Query: 801 PPXPF 815 PP P+ Sbjct: 795 PPPPY 799 Score = 35.9 bits (79), Expect = 0.035 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P PP PP +P P PP P Sbjct: 190 SPPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPP 235 Score = 35.5 bits (78), Expect = 0.046 Identities = 23/76 (30%), Positives = 24/76 (31%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 PP P P P PP PP PP P PPPP PPP + Sbjct: 769 PPPPYYSPSPKVEYKSPP--PPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYY 826 Query: 816 LAHXXXGXXXPPSXPP 863 PP PP Sbjct: 827 SPSPKVEYKSPP--PP 840 Score = 35.5 bits (78), Expect = 0.046 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 4/64 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX----PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 PPP P P +P PP P PPP P P PP P Sbjct: 786 PPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYYSPSPKVEYKSPPPPYVYNS 845 Query: 801 PPXP 812 PP P Sbjct: 846 PPPP 849 Score = 35.5 bits (78), Expect = 0.046 Identities = 22/80 (27%), Positives = 24/80 (30%), Gaps = 4/80 (5%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX----PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 PPP P P +P PP P PPP P P PP P Sbjct: 812 PPPYVYSSPPPPTYYSPSPKVEYKSPPPPYVYNSPPPPAYYSPSPKIEYKSPPPPYVYSS 871 Query: 801 PPXPFLAHXXXGXXXPPSXP 860 PP P + P P Sbjct: 872 PPPPSYSPSPKAEYKSPPPP 891 Score = 35.1 bits (77), Expect = 0.061 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P PP PP PP P P PP P PP P Sbjct: 14 PPPPLYDSPTPKVDYKSPP--PPYVYSSPP--PPLSYSPSPKVDYKSPPPPYVYSSPPPP 69 Query: 813 F 815 + Sbjct: 70 Y 70 Score = 35.1 bits (77), Expect = 0.061 Identities = 21/78 (26%), Positives = 23/78 (29%), Gaps = 2/78 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 58 PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 117 Query: 807 XPFLAHXXXGXXXPPSXP 860 P+ + P P Sbjct: 118 PPYYSPSPKPTYKSPPPP 135 Score = 35.1 bits (77), Expect = 0.061 Identities = 21/78 (26%), Positives = 23/78 (29%), Gaps = 2/78 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 133 PPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPP 192 Query: 807 XPFLAHXXXGXXXPPSXP 860 P+ + P P Sbjct: 193 PPYYSPSPKPTYKSPPPP 210 Score = 35.1 bits (77), Expect = 0.061 Identities = 22/80 (27%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P P PP P P PP P PPP P P Sbjct: 492 PPPYYSPSPKPSYKSPPPPYVYNSPPPPYYSPSPKVIYKSPPHPHVCVCPPPPPCYSHSP 551 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 + + P PP Sbjct: 552 KIEYKSPPTPYVYHSPPPPP 571 Score = 34.7 bits (76), Expect = 0.080 Identities = 21/78 (26%), Positives = 23/78 (29%), Gaps = 2/78 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 158 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSPP 217 Query: 807 XPFLAHXXXGXXXPPSXP 860 P+ + P P Sbjct: 218 PPYYSPSPKPVYKSPPPP 235 Score = 34.7 bits (76), Expect = 0.080 Identities = 24/86 (27%), Positives = 26/86 (30%), Gaps = 9/86 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPX------P 785 PPP P P P PP P P P PP P PPP Sbjct: 167 PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPK 226 Query: 786 PXRXPPPXPFLAHXXXGXXXPPSXPP 863 P PP P++ PS P Sbjct: 227 PVYKSPPPPYVYSSPPPPYYSPSPKP 252 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/64 (29%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXP---PXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P +P P P PPP P P PP P P Sbjct: 32 PPPYVYSSPPPPLSYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSP 91 Query: 804 PXPF 815 P P+ Sbjct: 92 PPPY 95 Score = 34.3 bits (75), Expect = 0.11 Identities = 23/79 (29%), Positives = 24/79 (30%), Gaps = 3/79 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRX-PP 803 PPP P P P P P PPP P P PP P PP Sbjct: 483 PPPYVYSSPPPPYYSPSPKPSYKSPPPPYVYNSPPPPYYSPSPKVIYKSPPHPHVCVCPP 542 Query: 804 PXPFLAHXXXGXXXPPSXP 860 P P +H P P Sbjct: 543 PPPCYSHSPKIEYKSPPTP 561 Score = 33.9 bits (74), Expect = 0.14 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 108 PPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPP 167 Query: 807 XPF 815 P+ Sbjct: 168 PPY 170 Score = 33.9 bits (74), Expect = 0.14 Identities = 23/79 (29%), Positives = 25/79 (31%), Gaps = 3/79 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX---APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P A PP P PPP P P PP P P Sbjct: 283 PPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYS-FPPPPYYSPSPKPVYKSPPPPYVYNSP 341 Query: 804 PXPFLAHXXXGXXXPPSXP 860 P P+ + P P Sbjct: 342 PPPYYSPSPKPAYKSPPPP 360 Score = 33.9 bits (74), Expect = 0.14 Identities = 26/87 (29%), Positives = 29/87 (33%), Gaps = 10/87 (11%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXX---PPLPXXXXPPP---PXP 785 PPP P P P PP P P P P PP PPP P P Sbjct: 543 PPPCYSHSPKIEYKSPPTPYVYHSPPPPPYYSPSPKPAYKSSPPPYVYSSPPPPYYSPAP 602 Query: 786 -PXRXPPPXPFLAHXXXGXXXPPSXPP 863 P PP P++ + PS P Sbjct: 603 KPVYKSPPPPYVYNSPPPPYYSPSPKP 629 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P PP PP +P PP P Sbjct: 115 SPPPPYYSPSPKPTYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPP 160 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P P PP P Sbjct: 465 SPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKPSYKSPPPP 510 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXX---PPXXXRAPLAPPPXXXPPSP 756 PPPP P P P PP PP +P P PP P Sbjct: 568 PPPPYYSPSPKPAYKSSPPPYVYSSPPPPYYSPAPKPVYKSPPPP 612 Score = 32.3 bits (70), Expect = 0.43 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P PP +P PPP PSP Sbjct: 717 SPPPPYYSPSPKPTYKSP----PPPYVYSSP--PPPPYYSPSP 753 Score = 31.9 bits (69), Expect = 0.57 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P PP PP +P PP P Sbjct: 490 SPPPPYYSPSPKPSYKSPPPPYVYNSPPPPYYSPSPKVIYKSPPHP 535 Score = 31.5 bits (68), Expect = 0.75 Identities = 23/86 (26%), Positives = 25/86 (29%), Gaps = 9/86 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPX------P 785 PPP P P P PP P P PP P PPP Sbjct: 142 PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPK 201 Query: 786 PXRXPPPXPFLAHXXXGXXXPPSXPP 863 P PP P++ PS P Sbjct: 202 PTYKSPPPPYIYSSPPPPYYSPSPKP 227 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P PP +PPP PSP Sbjct: 415 SPPPPYYSPSPKPSYKSPPPPYVYS-------SPPPPYYSPSP 450 Score = 31.5 bits (68), Expect = 0.75 Identities = 20/78 (25%), Positives = 22/78 (28%), Gaps = 2/78 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P PPP P P PP P PP Sbjct: 433 PPPYVYSSPPPPYYSPSPKLTYKSSPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 492 Query: 807 XPFLAHXXXGXXXPPSXP 860 P+ + P P Sbjct: 493 PPYYSPSPKPSYKSPPPP 510 Score = 31.1 bits (67), Expect = 0.99 Identities = 18/63 (28%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P P P PP Sbjct: 408 PPPYIYNSPPPPYYSPSPKPSYKSPPPPYVYSSPPPPYYSPSPKLTYKSSPPPYVYSSPP 467 Query: 807 XPF 815 P+ Sbjct: 468 PPY 470 Score = 31.1 bits (67), Expect = 0.99 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 TP P PPP P PP P +PPP SP Sbjct: 651 TPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSP 693 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +P P PPP P PP P A +PPP SP Sbjct: 224 SPKPVYKSPPPPYVYSSPPPPYYSPSPKPAYKSPPPPYVYSSP 266 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +P P PPP P PP P A +PPP SP Sbjct: 324 SPKPVYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSSP 366 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P PP PPP PSP Sbjct: 759 SPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSP 804 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/80 (25%), Positives = 23/80 (28%), Gaps = 4/80 (5%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX----PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 P P P P +P PP P PPP P P P P Sbjct: 533 PHPHVCVCPPPPPCYSHSPKIEYKSPPTPYVYHSPPPPPYYSPSPKPAYKSSPPPYVYSS 592 Query: 801 PPXPFLAHXXXGXXXPPSXP 860 PP P+ + P P Sbjct: 593 PPPPYYSPAPKPVYKSPPPP 612 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +P P PPP P PP P +PPP SP Sbjct: 199 SPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPPYVYSSP 241 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP---XXXPPSP 756 +P P PPP P PP P A +PPP PP P Sbjct: 274 SPKPIYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSFPPPP 319 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +P P PPP P PP P +PPP SP Sbjct: 349 SPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSP 391 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/43 (32%), Positives = 17/43 (39%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +P P PPP P PP P + +PPP SP Sbjct: 399 SPKPVYKSPPPPYIYNSPPPPYYSPSPKPSYKSPPPPYVYSSP 441 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +P P PPP P PP P +PPP SP Sbjct: 626 SPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSP 668 Score = 29.5 bits (63), Expect = 3.0 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 12/55 (21%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX-----PPXXXRAPLA-----PPPXX--XPPSP 756 +PPPP P P P P PP PP AP PPP PP P Sbjct: 667 SPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAPKPTYKSPPPPYVYSSPPPP 721 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +P P PPP P PP P +PPP SP Sbjct: 299 SPKPAYKSPPPPYVYSFPPPPYYSPSPKPVYKSPPPPYVYNSP 341 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +P P PPP P PP P +PPP SP Sbjct: 374 SPKPTYKSPPPPYVYSSPPPPYYSPSPKPVYKSPPPPYIYNSP 416 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +P P PPP P PP P +PPP SP Sbjct: 124 SPKPTYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYSSP 166 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +P P PPP P PP P +PPP SP Sbjct: 249 SPKPAYKSPPPPYVYSSPPPPYYSPSPKPIYKSPPPPYVYNSP 291 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 12/55 (21%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX-----PPXXXRAPLA-----PPPXX--XPPSP 756 +PPPP P P P P PP PP +P PPP PP P Sbjct: 215 SPPPPYYSPSPKPVYKSPPPPYVYSSPPPPYYSPSPKPAYKSPPPPYVYSSPPPP 269 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 12/55 (21%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX-----PPXXXRAPLA-----PPPXX--XPPSP 756 +PPPP P P P P PP PP +P PPP PP P Sbjct: 340 SPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPP 394 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 12/55 (21%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX-----PPXXXRAPLA-----PPPXX--XPPSP 756 +PPPP P P P P PP PP +P PPP PP P Sbjct: 390 SPPPPYYSPSPKPVYKSPPPPYIYNSPPPPYYSPSPKPSYKSPPPPYVYSSPPPP 444 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 12/55 (21%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX-----PPXXXRAPLA-----PPPXX--XPPSP 756 +PPPP P P P P PP PP +P PPP PP P Sbjct: 592 SPPPPYYSPAPKPVYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPPP 646 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 12/55 (21%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX-----PPXXXRAPLA-----PPPXX--XPPSP 756 +PPPP P P P P PP PP +P PPP PP P Sbjct: 642 SPPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPP 696 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 12/55 (21%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX-----PPXXXRAPLA-----PPPXX--XPPSP 756 +PPPP P P P P PP PP +P PPP PP P Sbjct: 692 SPPPPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPP 746 Score = 27.9 bits (59), Expect = 9.2 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 12/54 (22%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXX-----PPXXXRAPLA-----PPPXX--XPPSP 756 PPPP P P P P PP PP +P PPP PP P Sbjct: 316 PPPPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSSPPPP 369 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXX--PPXXXRAPLAPPPXXXPPSP 756 PPP PP P P P P +PPP PSP Sbjct: 838 PPPYVYNSPPPPAYYSPSPKIEYKSPPPPYVYSSPPPPSYSPSP 881 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 40.7 bits (91), Expect = 0.001 Identities = 26/85 (30%), Positives = 29/85 (34%), Gaps = 5/85 (5%) Frame = +3 Query: 573 W*XIIXLXPINHIXXXXXHXPP-PXXXXXPXPXXXXPX-APXXP---PXPXXGPPGPPPX 737 W ++ I + PP P P P P AP P P P PP P P Sbjct: 8 WVLVLIFISITIVSSAPAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPA 67 Query: 738 XXPPLPXXXXPPPPXPPXRXPPPXP 812 P P P P PP P P P Sbjct: 68 PAPTPPKPKPAPAPTPPKPKPKPAP 92 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 4/64 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX-APXXP---PXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 P P P P P AP P P P PP P P P P P P PP P Sbjct: 40 PKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKP 99 Query: 801 PPXP 812 P P Sbjct: 100 TPAP 103 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 4/64 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX-APXXP---PXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 P P P P P AP P P P PP P P P P P P PP P Sbjct: 51 PKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKP 110 Query: 801 PPXP 812 P P Sbjct: 111 APAP 114 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PP P P P P P P P P P PP P P P P P P P Sbjct: 61 PPKPKPAPAPT---PPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAP 116 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP-PSP 756 TPP P P P P P P PP P PP P P+P Sbjct: 71 TPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAP 114 Score = 36.7 bits (81), Expect = 0.020 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP-PSP 756 TPP P P P P P P PP P PP P P+P Sbjct: 60 TPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAP 103 Score = 36.7 bits (81), Expect = 0.020 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 5/65 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX-APXXP---PXPXXGPPGPPPXXXPPLPXXXXPPPPXP-PXRX 797 P P P P P AP P P P PP P P P P P P P P Sbjct: 62 PKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPK 121 Query: 798 PPPXP 812 P P P Sbjct: 122 PKPAP 126 Score = 36.7 bits (81), Expect = 0.020 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 1/60 (1%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXP-PXRXPPPXP 812 PP P P P P P P P P P PP P P P P P P P P Sbjct: 72 PPKPKPAPAPT---PPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKP 128 Score = 36.3 bits (80), Expect = 0.026 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPL-APPPXXXP-PSP 756 TPP P P P P P P PP AP AP P P P+P Sbjct: 82 TPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAP 126 Score = 35.1 bits (77), Expect = 0.061 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGP-PGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 P P P P P PP P P P PP P P P P P + P Sbjct: 73 PKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKPAP 130 Score = 34.7 bits (76), Expect = 0.080 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 6/49 (12%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXX------XPPSP 756 TPP P P P P P P PP AP PP PP+P Sbjct: 49 TPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNP 97 Score = 31.1 bits (67), Expect = 0.99 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSPXXG 765 P P P PP P PP P AP P P P G Sbjct: 84 PKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKPAPG 131 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP-PSP 756 P P P PP P P P PP AP PP P P+P Sbjct: 50 PPKPKPKPAPTPPKP---KPAPAPTPPKPKPAPAPTPPKPKPKPAP 92 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P P P PP P PP P P P P P P Sbjct: 51 PKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPP 95 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P P P PP P PP P P P P P P Sbjct: 62 PKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPP 106 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/46 (32%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP-PSP 756 P P P PP P PP P P P P P P+P Sbjct: 73 PKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTP 118 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/74 (31%), Positives = 25/74 (33%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P PP PP PP P PPPP PPP Sbjct: 159 PPPPPYYSPSPKVDYKSPP--PPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFPPPPPY 216 Query: 813 FLAHXXXGXXXPPS 854 + G PP+ Sbjct: 217 YSPSPKVGYKSPPA 230 Score = 38.7 bits (86), Expect = 0.005 Identities = 25/77 (32%), Positives = 26/77 (33%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P PP PP PPP P PPPP PPP Sbjct: 237 PPPPPYYSPSPKVNYKSPP--PPYVYSSPP-PPPYSPSPKVEFKSPPPPYIYNSPPPPSY 293 Query: 813 FLAHXXXGXXXPPSXPP 863 + PP PP Sbjct: 294 YSPSPKIDYKSPP--PP 308 Score = 37.5 bits (83), Expect = 0.011 Identities = 25/82 (30%), Positives = 27/82 (32%), Gaps = 5/82 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX----PPXPXXGPPGPPPXXXPPLPXXXXPPPPXP-PXRX 797 PPP P P +P PP P PPP P P PP P Sbjct: 203 PPPYVYSFPPPPPYYSPSPKVGYKSPPAPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSS 262 Query: 798 PPPXPFLAHXXXGXXXPPSXPP 863 PPP P+ PP PP Sbjct: 263 PPPPPYSPSPKVEFKSPP--PP 282 Score = 37.1 bits (82), Expect = 0.015 Identities = 21/61 (34%), Positives = 22/61 (36%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P PP PP PPP P PPP PPP P Sbjct: 349 PPPPPYYSPSPTVNYKSPP--PPYVYNSPP-PPPYYSPFPKVEYKSPPPPYIYNSPPPPP 405 Query: 813 F 815 + Sbjct: 406 Y 406 Score = 35.1 bits (77), Expect = 0.061 Identities = 21/66 (31%), Positives = 23/66 (34%), Gaps = 5/66 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX----PPXPXXGPPGPPPXXXPPLPXXXXPPPPXP-PXRX 797 PPP P P +P PP P PPP P P PP P Sbjct: 177 PPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFPPPPPYYSPSPKVGYKSPPAPYVYSS 236 Query: 798 PPPXPF 815 PPP P+ Sbjct: 237 PPPPPY 242 Score = 35.1 bits (77), Expect = 0.061 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P P PP P P Sbjct: 255 PPPYVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPPSYYSPSPKIDYKSPPPPYVYSSP 314 Query: 804 PXP 812 P P Sbjct: 315 PPP 317 Score = 34.7 bits (76), Expect = 0.080 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 PP P P P PP PP PPP P PPP PPP P+ Sbjct: 134 PPLTYYSPSPKVIYNSPP--PPYIYSSPP-PPPYYSPSPKVDYKSPPPPYVYSSPPPPPY 190 Score = 34.7 bits (76), Expect = 0.080 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 6/67 (8%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX------PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXR 794 PPP P P P PP P PPP P PPP Sbjct: 314 PPPPTYYSPSPRVDYKSPPPPYVYNSLPPPYVYNSPPPPPYYSPSPTVNYKSPPPPYVYN 373 Query: 795 XPPPXPF 815 PPP P+ Sbjct: 374 SPPPPPY 380 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 6/64 (9%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX----PPXPXXGPPGPPPXXXPPLP--XXXXPPPPXPPXR 794 PPP P P +P PP P PPP P P PPPP Sbjct: 280 PPPYIYNSPPPPSYYSPSPKIDYKSPPPPYVYSSPPPPTYYSPSPRVDYKSPPPPYVYNS 339 Query: 795 XPPP 806 PPP Sbjct: 340 LPPP 343 Score = 31.9 bits (69), Expect = 0.57 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 PP P P P PP PP P P PPPP PPP + Sbjct: 263 PPPPPYSPSPKVEFKSPP--PPYIYNSPPPPSYYSPSPKIDYKSPPPPYVYSSPPPPTYY 320 Query: 816 LAHXXXGXXXPPSXPP 863 PP PP Sbjct: 321 SPSPRVDYKSPP--PP 334 Score = 31.9 bits (69), Expect = 0.57 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 3/61 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P P P P P PP PP P Sbjct: 351 PPPYYSPSPTVNYKSPPPPYVYNSPPPPPYYSPFPKVEYKSPPPPYIYNSPPPPPYYSPS 410 Query: 804 P 806 P Sbjct: 411 P 411 Score = 31.1 bits (67), Expect = 0.99 Identities = 22/72 (30%), Positives = 24/72 (33%), Gaps = 10/72 (13%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPP---PXXXPPLPXXXXPPPPXPPXR 794 PPP P P AP PP P P P PP PPPP P Sbjct: 213 PPPYYSPSPKVGYKSPPAPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPPYSPSP 272 Query: 795 ----XPPPXPFL 818 PP P++ Sbjct: 273 KVEFKSPPPPYI 284 Score = 30.7 bits (66), Expect = 1.3 Identities = 21/81 (25%), Positives = 23/81 (28%), Gaps = 4/81 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX----PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 PPP P P P PP P P PP P PPP P Sbjct: 161 PPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFPPPPPYYSPS 220 Query: 801 PPXPFLAHXXXGXXXPPSXPP 863 P + + P PP Sbjct: 221 PKVGYKSPPAPYVYSSPPPPP 241 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXP-----PXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P PP +P PPP PSP Sbjct: 253 SPPPPYVYSSPPPPPYSPSPKVEFKSPPPPYIYNSP--PPPSYYSPSP 298 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P PP P PP P P P PPP Sbjct: 367 PPPYVYNSPPPP---PYYSPFPKVEYKSPPPPYIYNSPPPPPYYSPSPKITYKSPPPP 421 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXX---PPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P PP P +PPP SP Sbjct: 330 SPPPPYVYNSLPPPYVYNSPPPPPYYSPSPTVNYKSPPPPYVYNSP 375 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/77 (29%), Positives = 24/77 (31%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P P P +P P PP PP P LP PP PP P Sbjct: 123 PSPSTPSSPPSTPSTPSSPPSTPSTPSSPPSPPSPPSPSLPPSSLPPSASPPTNGTPDSE 182 Query: 813 FLAHXXXGXXXPPSXPP 863 L PPS P Sbjct: 183 TLT--PPPAPLPPSLSP 197 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 P TP P P P P PP P + PP PP+ Sbjct: 132 PSTPSTPSSPPSTPSTPSSPPSPPSPPSPSLPPSSLPPSASPPT 175 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 6/50 (12%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPX--PPXXPPXXXRAP----LAPPPXXXPPS 753 P TP P P P P PP P P L PPP PPS Sbjct: 145 PSTPSSPPSPPSPPSPSLPPSSLPPSASPPTNGTPDSETLTPPPAPLPPS 194 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 P +PP P P P P PP +PP P S Sbjct: 138 PSSPPSTPSTPSSPPSPPSPPSPSLPPSSLPPSASPPTNGTPDS 181 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/49 (44%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = -3 Query: 823 WARKGXG---GGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 + R G G G R GG G GG G GG GGPGG G GG G Sbjct: 296 YGRGGEGAYLGYPRGGGEGYGGYGGPGYGGAYESGGPGGSYEGAGGPYG 344 Score = 32.7 bits (71), Expect = 0.32 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -3 Query: 802 GGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXG 638 GG G G G RGG GG GGP G G G G G G Sbjct: 292 GGEGYGRGGEGAYLGYPRGGGEGYGGYGGPGYGGAYESGGPGGSYEGAGGPYGRG 346 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/52 (44%), Positives = 24/52 (46%) Frame = -3 Query: 817 RKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXG 662 R+G G R GG GGGG G GG GGG GG GG GA G Sbjct: 576 REGSFGSGR-GGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYGG 626 Score = 39.1 bits (87), Expect = 0.004 Identities = 27/71 (38%), Positives = 28/71 (39%), Gaps = 8/71 (11%) Frame = -3 Query: 820 ARKGXGGGX--RXGGXGGG------GXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXX 665 +R GGG R GG GG G GRGG GGG G G GG G G Sbjct: 553 SRSSFGGGKNRRSGGRFGGRDFRREGSFGSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGY 612 Query: 664 GXGXXXXXGGG 632 G G GG Sbjct: 613 GGGYGGASSGG 623 Score = 36.7 bits (81), Expect = 0.020 Identities = 24/61 (39%), Positives = 24/61 (39%), Gaps = 2/61 (3%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXG--XGGXX 689 GG GG G GG GG GGG G GG GGG GG G GG Sbjct: 566 GGRFGGRDFRREGSFGSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYG 625 Query: 688 G 686 G Sbjct: 626 G 626 Score = 36.7 bits (81), Expect = 0.020 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 G G GGG GGG GG GG G GG GG GG GG Sbjct: 583 GRGGYGGGGGGYGGGGGYGG----GGGYGGGGGYGGGYGGASSGGYGG 626 Score = 32.7 bits (71), Expect = 0.32 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -1 Query: 732 GGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G G+GG GG G GG GG GGGGG G Sbjct: 581 GSGRGG---YGGGGGGYGGGGGYGGGGGYGGGGGYGG 614 Score = 27.9 bits (59), Expect = 9.2 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRX-GGXGGGGXXXXGRGGXXXGGGPGG 716 G G P G GGG R G G G GRGG GG Sbjct: 58 GPPSGSRWAPGGSGVGVGGGGGYRADAGRPGSGSGYGGRGGGGWNNRSGG 107 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 686 GXGXXXXGXGGGXXXGGGGVXGXXXY 609 G G G GGG GGGG G Y Sbjct: 581 GSGRGGYGGGGGGYGGGGGYGGGGGY 606 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSPXXG 765 Y PPP PP P P PP PP P PPP PPS G Sbjct: 151 YCNNTDLPPPSPDFPPFSPSIPPPSPPYFPPEPPSIP--PPPPPSPPSAASG 200 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPP 788 P +P PP PP PP P P PPPP PP Sbjct: 159 PPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPPSPP 195 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +3 Query: 705 PXXGPPGPP--PXXXPPLPXXXXPPPPXPPXRXPPPXPFLA 821 P P PP P PP P P PP P PP P A Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPPSPPSAA 198 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/78 (30%), Positives = 26/78 (33%), Gaps = 3/78 (3%) Frame = +3 Query: 639 PXXXXXPXPXXXXPXAPXXPPX---PXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPX 809 P P P P PP P PP PP PP P PP P PP Sbjct: 71 PPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTP--TVKPPSVQPPTYKPPT 128 Query: 810 PFLAHXXXGXXXPPSXPP 863 P + PP+ PP Sbjct: 129 PTVKPPTTSPVKPPTTPP 146 Score = 37.1 bits (82), Expect = 0.015 Identities = 21/65 (32%), Positives = 23/65 (35%), Gaps = 5/65 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPP--XPXXGPPGPPPXXXPPL---PXXXXPPPPXPPXRX 797 PP P P +P PP P PP P PP P PP PP + Sbjct: 145 PPVQSPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTPVKPPTAPPVKP 204 Query: 798 PPPXP 812 P P P Sbjct: 205 PTPPP 209 Score = 36.3 bits (80), Expect = 0.026 Identities = 21/63 (33%), Positives = 23/63 (36%), Gaps = 7/63 (11%) Frame = +3 Query: 696 PPXPXXGPPG-PPPXXXPPLPXXXXP------PPPXPPXRXPPPXPFLAHXXXGXXXPPS 854 PP P PP PP PP P P PP PP + PP P PP+ Sbjct: 109 PPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPPT 168 Query: 855 XPP 863 P Sbjct: 169 TTP 171 Score = 36.3 bits (80), Expect = 0.026 Identities = 26/82 (31%), Positives = 29/82 (35%), Gaps = 7/82 (8%) Frame = +3 Query: 639 PXXXXXPXPXXXXPX-APXXPPX--PXXGPPGPPPXXXPPL----PXXXXPPPPXPPXRX 797 P P P P +P PP P PP PP PP P P P PP Sbjct: 121 PPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPPTTTP-PVKPPTTT 179 Query: 798 PPPXPFLAHXXXGXXXPPSXPP 863 PP P + PP+ PP Sbjct: 180 PPVQPPTYNPPTTPVKPPTAPP 201 Score = 36.3 bits (80), Expect = 0.026 Identities = 22/78 (28%), Positives = 26/78 (33%), Gaps = 2/78 (2%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGP--PPXXXPPLPXXXXPPPPXPPXRXPPPX 809 PP P +P P P P PP PP+ PP PP PP Sbjct: 133 PPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTT 192 Query: 810 PFLAHXXXGXXXPPSXPP 863 P + PP+ PP Sbjct: 193 P-VKPPTAPPVKPPTPPP 209 Score = 35.9 bits (79), Expect = 0.035 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P P P PP P P P PP P+ PP P P Sbjct: 36 PTLPSPSPATKPPSPALKPPTPSYKPPTLPTTPIKPPTTKPPVKP 80 Score = 32.7 bits (71), Expect = 0.32 Identities = 23/83 (27%), Positives = 25/83 (30%), Gaps = 6/83 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPP-----LPXXXXPPP-PXPPXR 794 P P P P P P P PP PP +P PP PP + Sbjct: 39 PSPSPATKPPSPALKPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPVKPPVSTPPIK 98 Query: 795 XPPPXPFLAHXXXGXXXPPSXPP 863 PP P PPS P Sbjct: 99 LPPVQPPTYKPPTPTVKPPSVQP 121 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/48 (33%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXX---RAPLAPPPXXXPPSP 756 P TP P PP P P PP + P PP PP+P Sbjct: 65 PTTPIKPPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTP 112 Score = 31.1 bits (67), Expect = 0.99 Identities = 25/83 (30%), Positives = 27/83 (32%), Gaps = 7/83 (8%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPG---PPPXXXPPLPXXXXPP--PPX--PPXR 794 PP P P P P P PP P P PP PP PP PP + Sbjct: 95 PPIKLPPVQPPTYKPPTPTVKP-PSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ 153 Query: 795 XPPPXPFLAHXXXGXXXPPSXPP 863 P P + PP PP Sbjct: 154 PPTYKPPTSPVKPPTTTPPVKPP 176 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPP-XXXRAPLAPPPXXXPPSP 756 P TP P PP P PP + P PP PP+P Sbjct: 84 PVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPPTYKPPTP 129 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXP--PXXXRAPLAPPPXXXPP 750 P T PP PP P P P P P + P+ PP P Sbjct: 43 PATKPPSPALKPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTP 87 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P T PP P P P P PP P+ PP P P Sbjct: 141 PPTTPPVQSPPVQPPTYKPPTSPVKPP-TTTPPVKPPTTTPPVQP 184 Score = 27.9 bits (59), Expect = 9.2 Identities = 21/82 (25%), Positives = 22/82 (26%), Gaps = 4/82 (4%) Frame = +1 Query: 631 PPPPXXXPP--PXPXXXXPXPPXXPP--XXXRAPLAPPPXXXPPSPXXGXXXXXXXXXXX 798 PP P PP P P P PP + P PP P P Sbjct: 109 PPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPPT 168 Query: 799 XXXXXXWPTXVXAXXPXLRNPP 864 PT P NPP Sbjct: 169 TTPPVKPPTTTPPVQPPTYNPP 190 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGG-GPGGPXXGXGGXXGAXG 677 G GGG G GGG G GG GG G GG G GG G G Sbjct: 36 GAGGGEWGGAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGGG 81 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -1 Query: 783 EXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 E GG G GG GG GG GG G G GG GGGGG G Sbjct: 33 EWGGAGGGEWGGAEG--GGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGGGRRG 84 Score = 35.9 bits (79), Expect = 0.035 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 823 WARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 W GG GG GGG G GG GGG G G GG G Sbjct: 42 WGGAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEG---GGGGRRG 84 Score = 34.7 bits (76), Expect = 0.080 Identities = 22/63 (34%), Positives = 22/63 (34%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G G GG GGG GG GGG GG G G G G G GG Sbjct: 27 GYEGEEEWGGAGGGEWGGAEGGGAWGGGGGGGGAWGGEGEGGG----EWGGGGEGGGGGR 82 Query: 631 XXW 623 W Sbjct: 83 RGW 85 Score = 34.7 bits (76), Expect = 0.080 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGG 716 GG E G W G GGG GG G GG G GG GGG G Sbjct: 38 GGGEWGGAEGGGAWGGGG-GGGGAWGGEGEGGGEWGG-GGEGGGGGRRG 84 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PP PP PPP PP P PPPP + PPP P Sbjct: 303 PPPQKSIPPPPPP---PPPPLLQQPPPPPSVSKAPPPPP 338 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPX--PPXXPPXXXRAPLAPPPXXXPPS 753 PPP PPP P P P PP +AP PPP P S Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPPKS 345 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPP 788 P P P P PP P P PPP P PPPP PP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPP---PPPPPPPP 343 Score = 35.5 bits (78), Expect = 0.046 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPP--XXXPPLPXXXXPPPPXPPXRXPPP 806 P PP P PP PPP PP P PPP PP PPP Sbjct: 304 PPQKSIPPPP---PPPPPPLLQQPPPPPSVSKAPPPPPP--PPPP 343 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/46 (39%), Positives = 21/46 (45%) Frame = +3 Query: 726 PPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PP PP P PPPP P + PPP P ++ PP PP Sbjct: 304 PPQKSIPPPP----PPPPPPLLQQPPPPPSVS---KAPPPPPPPPP 342 Score = 31.9 bits (69), Expect = 0.57 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPP 702 P PPPP PP P PP PP Sbjct: 313 PPPPPPPLLQQPPPPPSVSKAPPPPPP 339 Score = 31.1 bits (67), Expect = 0.99 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPP 702 P PPP PPP P PP PP Sbjct: 314 PPPPPPLLQQPPPPPSVSKAPPPPPPP 340 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 699 PXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXR 794 P P PP PPP PP PP P + Sbjct: 25 PSPLPLPPPPPPPLKPPSSGSATTKPPINPSK 56 >At3g49300.1 68416.m05388 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 86 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 720 PGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PGP P P P PPPP PP PPP Sbjct: 54 PGPDPKHDPTKPGYGFPPPPPPPLSPPPP 82 >At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical to cDNA glycine-rich protein 3 short isoform (GRP3S) GI:4206766 Length = 116 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -1 Query: 783 EXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGG 637 E GGG GGG GGG GG GG G GG GG GGG Sbjct: 38 EQHGGGFGDNGGGRYQGGGGHGG--HGGGGYQGGGGRYQGGGGRQGGGG 84 Score = 32.3 bits (70), Expect = 0.43 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 5/55 (9%) Frame = -3 Query: 811 GXGGGXRXGGX--GGGGXXXXGRGGXXXGGG---PGGPXXGXGGXXGAXGXXXXG 662 G G G GG GGGG G GG GGG GG G GG G G Sbjct: 41 GGGFGDNGGGRYQGGGGHGGHGGGGYQGGGGRYQGGGGRQGGGGSYCRHGCCYKG 95 Score = 29.1 bits (62), Expect = 4.0 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = -1 Query: 765 PXXXGGGXXXXGGGQGGP-XXXGGXXXGPGGXXXXXGGXXXGGGGGXXGXXXIY 607 P GGG GGG GG G GG GG GGGG G Y Sbjct: 37 PEQHGGGFGDNGGG----RYQGGGGHGGHGGGGYQGGGGRYQGGGGRQGGGGSY 86 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 2/66 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P P P PP P P PPPP PP Sbjct: 103 PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPS 162 Query: 807 XPFLAH 824 L H Sbjct: 163 YTTLHH 168 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/69 (33%), Positives = 24/69 (34%), Gaps = 7/69 (10%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPP-----XP 785 + PPP P P P PP P P PP P P PPPP P Sbjct: 69 YSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPP 128 Query: 786 PXRXPPPXP 812 P PP P Sbjct: 129 PVYKSPPPP 137 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/69 (33%), Positives = 24/69 (34%), Gaps = 7/69 (10%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAP--XXPPXPXXGPPGPPPXXXPPLPXXXXPPPP-----XP 785 + PPP P P P P P P P PP P P PPPP P Sbjct: 85 YSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPP 144 Query: 786 PXRXPPPXP 812 P PP P Sbjct: 145 PVYKSPPPP 153 Score = 38.7 bits (86), Expect = 0.005 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 7/67 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAP--XXPPXPXXGPPGPPPXXXPPLPXXXXPPPP-----XPPX 791 PPP P P P P P P P PP P P PPPP PP Sbjct: 31 PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPV 90 Query: 792 RXPPPXP 812 PP P Sbjct: 91 YKSPPPP 97 Score = 37.9 bits (84), Expect = 0.009 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 2/60 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P P P PP P P PPPP + PPP Sbjct: 47 PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPV--YKSPPP 104 Score = 37.9 bits (84), Expect = 0.009 Identities = 23/69 (33%), Positives = 24/69 (34%), Gaps = 7/69 (10%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPP-----XP 785 + PPP P P P PP P PP PP P PPPP P Sbjct: 53 YSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPP 112 Query: 786 PXRXPPPXP 812 P PP P Sbjct: 113 PVYKSPPPP 121 Score = 31.1 bits (67), Expect = 0.99 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPP PPP P P P +PPP P P Sbjct: 38 SPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPP 80 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX---PPXXXRAPLAPPPXXXPP 750 +PPPP P P P PP PP ++P P PP Sbjct: 29 SPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPP 72 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX---PPXXXRAPLAPPPXXXPP 750 +PPPP P P P PP PP ++P P PP Sbjct: 45 SPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPP 88 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX---PPXXXRAPLAPPPXXXPP 750 +PPPP P P P PP PP ++P P PP Sbjct: 101 SPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPP 144 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX---PPXXXRAPLAPPPXXXPP 750 +PPPP P P P PP PP ++P P PP Sbjct: 117 SPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPP 160 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PP P PP PP P PPP + PPP Sbjct: 30 PPPPVKHYSPPPVYKSPPPPVKHYSPPPV--YKSPPP 64 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 2/66 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P P P PP P P PPPP PP Sbjct: 103 PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPS 162 Query: 807 XPFLAH 824 L H Sbjct: 163 YTTLHH 168 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/69 (33%), Positives = 24/69 (34%), Gaps = 7/69 (10%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPP-----XP 785 + PPP P P P PP P P PP P P PPPP P Sbjct: 69 YSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPP 128 Query: 786 PXRXPPPXP 812 P PP P Sbjct: 129 PVYKSPPPP 137 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/69 (33%), Positives = 24/69 (34%), Gaps = 7/69 (10%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAP--XXPPXPXXGPPGPPPXXXPPLPXXXXPPPP-----XP 785 + PPP P P P P P P P PP P P PPPP P Sbjct: 85 YSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPP 144 Query: 786 PXRXPPPXP 812 P PP P Sbjct: 145 PVYKSPPPP 153 Score = 38.7 bits (86), Expect = 0.005 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 7/67 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAP--XXPPXPXXGPPGPPPXXXPPLPXXXXPPPP-----XPPX 791 PPP P P P P P P P PP P P PPPP PP Sbjct: 31 PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPV 90 Query: 792 RXPPPXP 812 PP P Sbjct: 91 YKSPPPP 97 Score = 37.9 bits (84), Expect = 0.009 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 2/60 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P P P PP P P PPPP + PPP Sbjct: 47 PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPV--YKSPPP 104 Score = 37.9 bits (84), Expect = 0.009 Identities = 23/69 (33%), Positives = 24/69 (34%), Gaps = 7/69 (10%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPP-----XP 785 + PPP P P P PP P PP PP P PPPP P Sbjct: 53 YSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPP 112 Query: 786 PXRXPPPXP 812 P PP P Sbjct: 113 PVYKSPPPP 121 Score = 31.1 bits (67), Expect = 0.99 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPP PPP P P P +PPP P P Sbjct: 38 SPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPP 80 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX---PPXXXRAPLAPPPXXXPP 750 +PPPP P P P PP PP ++P P PP Sbjct: 29 SPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPP 72 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX---PPXXXRAPLAPPPXXXPP 750 +PPPP P P P PP PP ++P P PP Sbjct: 45 SPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPP 88 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX---PPXXXRAPLAPPPXXXPP 750 +PPPP P P P PP PP ++P P PP Sbjct: 101 SPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPP 144 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX---PPXXXRAPLAPPPXXXPP 750 +PPPP P P P PP PP ++P P PP Sbjct: 117 SPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPP 160 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PP P PP PP P PPP + PPP Sbjct: 30 PPPPVKHYSPPPVYKSPPPPVKHYSPPPV--YKSPPP 64 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 39.5 bits (88), Expect = 0.003 Identities = 26/78 (33%), Positives = 28/78 (35%), Gaps = 3/78 (3%) Frame = +3 Query: 639 PXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP---XPPXRXPPPX 809 P P P P A PP P PP P PP+P PPPP PP PP Sbjct: 173 PQVQQYPQPSGYPP-ASGYPPQPSAYPP-PSTSGYPPIPSAYPPPPPSSAYPPQPYPPQP 230 Query: 810 PFLAHXXXGXXXPPSXPP 863 + PP PP Sbjct: 231 SYYPQGPYPGQYPP--PP 246 Score = 37.9 bits (84), Expect = 0.009 Identities = 22/61 (36%), Positives = 24/61 (39%), Gaps = 4/61 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXX-PPXPXXGPPGPPPXXXPPLPXXXXPP--PPXP-PXRXPP 803 PP P P P + PP P PP PP PP P P P P P + PP Sbjct: 185 PPASGYPPQPSAYPPPSTSGYPPIPSAYPPPPPSSAYPPQPYPPQPSYYPQGPYPGQYPP 244 Query: 804 P 806 P Sbjct: 245 P 245 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 PP P PPP P P PP + A PP PP P Sbjct: 191 PPQPSAYPPPSTSGYPPIPSAYPPPPPSS--AYPPQPYPPQP 230 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 + PP P P P P P PP P P P PPP Sbjct: 197 YPPPSTSGYPPIPSAYPPPPPSSAYPPQPYPPQPSYYPQGPYPGQYPPPP 246 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/60 (30%), Positives = 19/60 (31%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 + P P P P PP P PP PP P P P P PPP Sbjct: 190 YPPQPSAYPPPSTSGYPPIPSAYPPPPPSS--AYPPQPYPPQP-SYYPQGPYPGQYPPPP 246 >At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi|20465684|gb|AY096677.1| Length = 158 Score = 39.5 bits (88), Expect = 0.003 Identities = 28/76 (36%), Positives = 28/76 (36%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG G GGG GG GGG G GG G G G G GG G Sbjct: 63 GGVAGGVGGVAGVLPVGGVGGGI--GGLGGGVGGLGGLGGLGGGSGLGHGVGGIGGDPG- 119 Query: 682 XGXXXXGXGXXXXXGG 635 G G G GG Sbjct: 120 IGSGIGGLGGAGGLGG 135 Score = 30.7 bits (66), Expect = 1.3 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = -3 Query: 811 GXGGGXRXG-GXGG-GGXXXXGRG-GXXXGGGPGGPXXGXGGXXGAXGXXXXG 662 G GGG G G GG GG G G G G G G G GG G G G Sbjct: 100 GLGGGSGLGHGVGGIGGDPGIGSGIGGLGGAGGLGGIGGVGGLGGIGGGSDCG 152 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GG GG GGG G GG PG G GG GG G Sbjct: 87 GLGGGVGGLGGLGGLGGGSGLGHGVGGIGGDPGIGSGIGGLGGAGGLGGIGG 138 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 39.5 bits (88), Expect = 0.003 Identities = 25/58 (43%), Positives = 25/58 (43%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 GGG GG GGG G G GGG GG G GG G G G G GGG Sbjct: 58 GGGHGHGGHNGGG----GHGLDGYGGGHGGHYGGGGGHYGGGG----GHGGGGHYGGG 107 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 771 GGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG GGG GGG G GG G G GG GGGG G Sbjct: 45 GGHGGHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGG 94 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG G GG G G GG GG GGGG G Sbjct: 51 GGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGG 101 Score = 37.5 bits (83), Expect = 0.011 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXXGG-GXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GG GG G GGG GG GG G GG GG GGGG G Sbjct: 62 GHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGG--GHGGGGHYGGGGHHGG 112 Score = 37.1 bits (82), Expect = 0.015 Identities = 26/62 (41%), Positives = 26/62 (41%), Gaps = 2/62 (3%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPG--GPXXGXGGXXGAXGXXXXGXGXXXXXG 638 G GG G GGGG G GG GGG G G G GG G G G G G Sbjct: 46 GHGGHGGGGHYGGGGH---GHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGG--GHGG 100 Query: 637 GG 632 GG Sbjct: 101 GG 102 Score = 36.3 bits (80), Expect = 0.026 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Frame = -1 Query: 777 GGGGPXXXGG---GXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG GG G GGG G GG GG GG GGGG G Sbjct: 51 GGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYG 105 Score = 35.9 bits (79), Expect = 0.035 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 5/67 (7%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGX--GGGXRXGGXGGGGXXXXGRGGXXXGGG---PGGPXXGXG 698 GG GG G GGG G GGG G GG GGG GG G G Sbjct: 48 GGHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGG 107 Query: 697 GXXGAXG 677 G G G Sbjct: 108 GHHGGGG 114 Score = 35.5 bits (78), Expect = 0.046 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPG 719 GG G G GGG GG G GG G GG GGG G Sbjct: 69 GGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGGGHG 116 Score = 34.7 bits (76), Expect = 0.080 Identities = 22/61 (36%), Positives = 23/61 (37%) Frame = -3 Query: 814 KGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 +G GG G GG G GG GG GG G G G G G G GG Sbjct: 41 EGYHGGHGGHGGGG----HYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGG 96 Query: 634 G 632 G Sbjct: 97 G 97 Score = 31.1 bits (67), Expect = 0.99 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGG 676 G GG GGG GGG GG GG GG Sbjct: 80 GHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGG 113 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXG 685 GGGG GGG GG GG GG G Sbjct: 86 GGGGGHYGGGGGHGGGGHYGGGGHHGGGGHG 116 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 39.5 bits (88), Expect = 0.003 Identities = 25/78 (32%), Positives = 26/78 (33%), Gaps = 2/78 (2%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPX-PXXGPPGPPPXXXPPLPXXXXP-PPPXPPXRXPPPX 809 PP P AP PP P PP PP P P P PP P PP Sbjct: 134 PPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVK 193 Query: 810 PFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 194 PPVYPPTKAPVKPPVSPP 211 Score = 39.1 bits (87), Expect = 0.004 Identities = 29/93 (31%), Positives = 33/93 (35%), Gaps = 6/93 (6%) Frame = +3 Query: 603 NHIXXXXXHXPPPXXXXXPX---PXXXXPXAPXXPPX-PXXGPPGPPPXXXPPLPXXXXP 770 +H H P P P P AP PP P PP PP P P P Sbjct: 48 HHPHPPHHHHPHPHPHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPP 107 Query: 771 --PPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PP PP + PP P + PP+ PP Sbjct: 108 VKPPVSPPAK-PPVKPPVYPPTKAPVKPPTKPP 139 Score = 38.3 bits (85), Expect = 0.007 Identities = 25/79 (31%), Positives = 28/79 (35%), Gaps = 3/79 (3%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPX-PXXGPPGPPPXXXPPLPXXXXPP--PPXPPXRXPPP 806 PP P AP PP P PP PP PP+ PP P P PP Sbjct: 82 PPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAK-PPVKPPVYPPTKAPVKPPTKPPV 140 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P + PP+ PP Sbjct: 141 KPPVYPPTKAPVKPPTKPP 159 Score = 37.9 bits (84), Expect = 0.009 Identities = 25/79 (31%), Positives = 26/79 (32%), Gaps = 3/79 (3%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPX-PXXGPPGPPPXXXPPLPXXXXP--PPPXPPXRXPPP 806 PP P P PP P PP PP P P P PP PP + PP Sbjct: 86 PPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVK-PPV 144 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P PP PP Sbjct: 145 YPPTKAPVKPPTKPPVKPP 163 Score = 36.7 bits (81), Expect = 0.020 Identities = 25/79 (31%), Positives = 27/79 (34%), Gaps = 3/79 (3%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPX-PXXGPPGPPPXXXPPLPXXXXP--PPPXPPXRXPPP 806 PP P AP PP P PP PP P P P PP PP + P Sbjct: 114 PPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVK 173 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P PP+ PP Sbjct: 174 PP-TKPPVKPPVSPPAKPP 191 Score = 35.9 bits (79), Expect = 0.035 Identities = 27/92 (29%), Positives = 28/92 (30%), Gaps = 3/92 (3%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPX-PXXGPPGPPPXXXPPLPXXXXPP 773 P +H H PP P P PP P PP P PP PP Sbjct: 53 PHHHHPHPHPHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVK-PPTKPPVKPP 111 Query: 774 --PPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PP P PP P PP PP Sbjct: 112 VSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPP 143 Score = 34.7 bits (76), Expect = 0.080 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 2/61 (3%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPX-PXXGPPGPPPXXXPPLPXXXXP-PPPXPPXRXPPPX 809 PP P P PP P PP PP P P P PP P PP Sbjct: 158 PPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSPPTKPPVT 217 Query: 810 P 812 P Sbjct: 218 P 218 Score = 33.9 bits (74), Expect = 0.14 Identities = 24/79 (30%), Positives = 25/79 (31%), Gaps = 3/79 (3%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXX-GPPGPPPXXXPPLPXXXXP--PPPXPPXRXPPP 806 PP P P PP PP PP P P P PP PP + PP Sbjct: 106 PPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVK-PPV 164 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P PP PP Sbjct: 165 YPPTKAPVKPPTKPPVKPP 183 Score = 33.9 bits (74), Expect = 0.14 Identities = 24/79 (30%), Positives = 26/79 (32%), Gaps = 3/79 (3%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPX-PXXGPPGPPPXXXPPLPXXXXP--PPPXPPXRXPPP 806 PP P P PP P PP P P P P PP PP + PP Sbjct: 138 PPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVK-PPV 196 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P PP+ PP Sbjct: 197 YPPTKAPVKPPVSPPTKPP 215 Score = 33.5 bits (73), Expect = 0.19 Identities = 24/82 (29%), Positives = 27/82 (32%), Gaps = 6/82 (7%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPX--PXXGPPGPP--PXXXPPLPXXXXPP--PPXPPXRX 797 PP P P PP P P PP P PP+ PP PP P Sbjct: 142 PPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTK 201 Query: 798 PPPXPFLAHXXXGXXXPPSXPP 863 P P ++ PP PP Sbjct: 202 APVKPPVSPPTKPPVTPPVYPP 223 Score = 33.1 bits (72), Expect = 0.25 Identities = 22/78 (28%), Positives = 24/78 (30%), Gaps = 2/78 (2%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPX-PXXGPPGPPPXXXPPLPXXXXPPP-PXPPXRXPPPX 809 PP P P PP P P PP P P P P P PP Sbjct: 102 PPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVK 161 Query: 810 PFLAHXXXGXXXPPSXPP 863 P + PP+ PP Sbjct: 162 PPVYPPTKAPVKPPTKPP 179 Score = 31.9 bits (69), Expect = 0.57 Identities = 23/79 (29%), Positives = 25/79 (31%), Gaps = 3/79 (3%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXX-GPPGPPPXXXPPLPXXXXP--PPPXPPXRXPPP 806 PP P P PP PP PP P P P PP PP + PP Sbjct: 126 PPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVK-PPV 184 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P PP+ P Sbjct: 185 SPPAKPPVKPPVYPPTKAP 203 Score = 31.1 bits (67), Expect = 0.99 Identities = 24/82 (29%), Positives = 26/82 (31%), Gaps = 6/82 (7%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPX-PXXGPPGPPPXXXPPLPXXXXP--PP---PXPPXRX 797 PP P P PP P PP P P P P PP P P Sbjct: 118 PPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTK 177 Query: 798 PPPXPFLAHXXXGXXXPPSXPP 863 PP P ++ PP PP Sbjct: 178 PPVKPPVSPPAKPPVKPPVYPP 199 Score = 29.9 bits (64), Expect = 2.3 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = +1 Query: 622 PXTPP--PPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPP---PXXXPPSP 756 P PP PP P P PP PP +AP+ PP P P SP Sbjct: 139 PVKPPVYPPTKAPVKPPTKPPVKPPVYPPT--KAPVKPPTKPPVKPPVSP 186 Score = 28.7 bits (61), Expect = 5.3 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPP--PPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PP PP P P PP PP +P A PP P P Sbjct: 155 PTKPPVKPPVYPPTKAPVKPPTKPPVKPPV---SPPAKPPVKPPVYP 198 Score = 28.7 bits (61), Expect = 5.3 Identities = 19/50 (38%), Positives = 22/50 (44%), Gaps = 5/50 (10%) Frame = +1 Query: 622 PXTPPP-PXXXPPPXPXXXXPX-PPXXPPXXXRAPLAPP---PXXXPPSP 756 P PP P PP P P PP PP +AP+ PP P P +P Sbjct: 171 PVKPPTKPPVKPPVSPPAKPPVKPPVYPPT--KAPVKPPVSPPTKPPVTP 218 >At1g24490.1 68414.m03084 60 kDa inner membrane family protein similar to chloroplast membrane protein (ALBINO3) (GI:3927828) [Arabidopsis thaliana] Length = 1013 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 753 GGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG G P GG P G GGGGG G Sbjct: 402 GGGSPSPGGGSGSPPSTGGGSGSPPSTGGGGGSPSKGGGGGKSG 445 Score = 29.9 bits (64), Expect = 2.3 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = -3 Query: 787 GGXGGG--GXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 GG G G G G GGG G P GG G+ G G GGG Sbjct: 389 GGSGNGTNSTSTSGGGSPSPGGGSGSP-PSTGGGSGSPPSTGGGGGSPSKGGGG 441 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 639 PXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 P P P A P P P PP P P PPP PP PPP Sbjct: 48 PPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPP 103 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXP 860 P PP P PP PPP PP PPP P + PPS P Sbjct: 44 PATSPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTP-PSSPPPSITPPPSPP 97 Score = 35.1 bits (77), Expect = 0.061 Identities = 22/65 (33%), Positives = 24/65 (36%), Gaps = 5/65 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPX-XPPXPXXGPPGPPPXXXP-PLPXXXXP---PPPXPPXRX 797 PPP P P P +P P P P G P P P P P PPP + Sbjct: 78 PPPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPPSLFPPPSLVNQL 137 Query: 798 PPPXP 812 P P P Sbjct: 138 PDPRP 142 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPP PP PP PP + PPP P P Sbjct: 59 SPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQP 101 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLA-PPPXXXPPS 753 P + PPP PPP P P P P + P P PPS Sbjct: 82 PPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPPS 126 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPP---XXXRAPLAPPPXXXPP 750 P +PP P P P PP PP P +PPP PP Sbjct: 48 PPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPP 93 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 4/61 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXP----PLPXXXXPPPPXPPXRXPP 803 PP P P P + PP P P PPP P P+ P PP PP Sbjct: 73 PPNTTPPPTPPSSPPPSITPPPSPPQ--PQPPPQSTPTGDSPVVIPFPKPQLPPPSLFPP 130 Query: 804 P 806 P Sbjct: 131 P 131 Score = 31.1 bits (67), Expect = 0.99 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 4/54 (7%) Frame = +3 Query: 663 PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP----PXPPXRXPPPXP 812 P P +P P PP P P PPP PP PPP P Sbjct: 43 PPATSPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSP 96 Score = 31.1 bits (67), Expect = 0.99 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 1/44 (2%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP-PSP 756 TPPP PP P PP P P P P P P Sbjct: 77 TPPPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKP 120 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +1 Query: 634 PPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPP-PXXXPPSPXXG 765 PPP P P P PP PP P +PP P P S G Sbjct: 68 PPPNQPPNTTPP---PTPPSSPPPSITPPPSPPQPQPPPQSTPTG 109 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP 747 P PP PPP P P P PP P PPP P Sbjct: 68 PPPNQPPNTTPPPTP-PSSPPPSITPPPSPPQP-QPPPQSTP 107 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 39.1 bits (87), Expect = 0.004 Identities = 24/73 (32%), Positives = 26/73 (35%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 PP P P +P PP PPGPPP PPPP P PP P Sbjct: 200 PPLPPLPPTTGLTLPHSPFPPP-----PPGPPPKEQD-FVRPPLPPPPQLPQSSQPPPPG 253 Query: 816 LAHXXXGXXXPPS 854 L+ P S Sbjct: 254 LSGSQGDGRFPES 266 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 PPP P P P P PPGPPP PPLP PPP Sbjct: 359 PPPLDMHPPHPGMFV--GHLIPRPPYGPPPGPPPMMRPPLP--PGPPP 402 Score = 32.3 bits (70), Expect = 0.43 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +3 Query: 687 PXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P PP PP P +P PPP PP PP P Sbjct: 356 PPPPPPLDMHPPHPGMFVGHLIPRPPYGPPPGPPPMMRPPLP 397 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 4/42 (9%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPP----XXXRAPLAPPP 735 P PP P P P PP PP R PL PPP Sbjct: 200 PPLPPLPPTTGLTLPHSPFPPPPPGPPPKEQDFVRPPLPPPP 241 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 7/58 (12%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXX-------GPPGPPPXXXPPLPXXXXPPPPXP 785 PPP P P P PP P PP PP PP+ PP P P Sbjct: 348 PPPGMLRFPPPP---PPLDMHPPHPGMFVGHLIPRPPYGPPPGPPPMMRPPLPPGPPP 402 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSPXXG 765 P +P PP PP PP PP PPP S G Sbjct: 214 PHSPFPPPPPGPPPKEQDFVRPPLPPPPQLPQSSQPPPPGLSGSQGDG 261 Score = 29.1 bits (62), Expect = 4.0 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXX-PPLPXXXXPPP-PXPPXRXPPPXPFLAHXXXGXXXPPS 854 PP PP PPP PP P P PP PP P + PPS Sbjct: 349 PPGMLRFPPPPPPLDMHPPHPGMFVGHLIPRPPYGPPPGPPPMMRPPLPPGPPPS 403 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +3 Query: 732 PXXXPPLPXXXXPPPPXP-PXRXPPPXPFLAH-XXXGXXXPPSXPP 863 P PP PPPP P P P F+ H PP PP Sbjct: 344 PDVHPPPGMLRFPPPPPPLDMHPPHPGMFVGHLIPRPPYGPPPGPP 389 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = +3 Query: 663 PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P P PP P P PP PP+P P P PP P P P Sbjct: 314 PLLPTPPTPTLPPIPTI-PTLPPLPVLPPVPIVNPPSLPPPPPSFPVPLP 362 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/62 (35%), Positives = 23/62 (37%), Gaps = 1/62 (1%) Frame = +3 Query: 636 PPXXXXXPXPXXXX-PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PP P P P P PP P PP PP P P P PP P PP P Sbjct: 319 PPTPTLPPIPTIPTLPPLPVLPPVPIVNPPSLPP----PPPSFPVPLPPVPGLPGIPPVP 374 Query: 813 FL 818 + Sbjct: 375 LI 376 Score = 37.1 bits (82), Expect = 0.015 Identities = 24/73 (32%), Positives = 25/73 (34%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 P N + PP P P P PP P PP P PPLP P Sbjct: 287 PPNPLIPSPPSLPPIPLIPTPPTLPTIPLLPT-PPTPTL-PPIPTIPTLPPLPVLPPVPI 344 Query: 777 PXPPXRXPPPXPF 815 PP PPP F Sbjct: 345 VNPPSLPPPPPSF 357 Score = 36.3 bits (80), Expect = 0.026 Identities = 22/65 (33%), Positives = 24/65 (36%), Gaps = 2/65 (3%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPX-PXXGPPGPPPXXXPPLPXX-XXPPPPXPPXRXPPPX 809 PP P P P P PP P PP P PP+P PP P P P Sbjct: 334 PPLPVLPPVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVPLIPGIPPAPLIPGIPPLSP 393 Query: 810 PFLAH 824 F +H Sbjct: 394 SFSSH 398 Score = 35.9 bits (79), Expect = 0.035 Identities = 26/82 (31%), Positives = 27/82 (32%), Gaps = 6/82 (7%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPG--PPPXXXPPLPXXXXPP----PPXPPXRX 797 PP P P P P P P P P P +P PP PP P Sbjct: 273 PPNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIPTPPTLPTIPLLPTPPTPTLPPIPTIPT 332 Query: 798 PPPXPFLAHXXXGXXXPPSXPP 863 PP P L PPS PP Sbjct: 333 LPPLPVL--PPVPIVNPPSLPP 352 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 TPP P P P P P P P PPP P P Sbjct: 318 TPPTPTLPPIPTIPTLPPLPVLPPVPIVNPPSLPPPPPSFPVP 360 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 4/48 (8%) Frame = +3 Query: 687 PXXPPXPXXGPPGPPPXXX----PPLPXXXXPPPPXPPXRXPPPXPFL 818 P PP P PP P P PPLP P P P P P L Sbjct: 183 PSFPP-PLQDPPNPSPLPNLPIVPPLPNLPVPKLPVPDLPLPLVPPLL 229 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPP--PXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PP P PP P P P P P P P PP+P Sbjct: 337 PVLPPVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVPLIPGIPPAP 383 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P P P PP P P PP PL P P PP P Sbjct: 262 PPNPLNPPSIIPPNPLIPSIPTPTLPPN----PLIPSPPSLPPIP 302 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXX-PXPPXXP--PXXXRAPLAPPPXXXPPS 753 P PPPP P P P P P P P APL P PS Sbjct: 348 PSLPPPPPSFPVPLPPVPGLPGIPPVPLIPGIPPAPLIPGIPPLSPS 394 Score = 27.9 bits (59), Expect = 9.2 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P P P PP P P PP PP PL P P P P Sbjct: 276 PLIPSIPTPTLPPNPLI--PSPPSLPPI----PLIPTPPTLPTIP 314 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +3 Query: 699 PXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 P P P GPPP +P PPPP PP PPP Sbjct: 11 PAPGNYPQGPPPPVG--VPPQYYPPPPPPPPPPPPP 44 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 684 APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXR 794 AP P P G PP PP P PPPP PP + Sbjct: 12 APGNYPQGPPPPVGVPPQYYPPPPPP--PPPPPPPRK 46 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPP 702 P PPPP PP P PP PP Sbjct: 17 PQGPPPPVGVPPQYYPPPPPPPPPPPP 43 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 652 PPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSPXXG 765 P P P PP P P PPP PP G Sbjct: 11 PAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPPPRKVG 48 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P PPG PP P PPP P P P Sbjct: 183 PPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGG 242 Query: 813 F 815 F Sbjct: 243 F 243 Score = 38.7 bits (86), Expect = 0.005 Identities = 28/86 (32%), Positives = 30/86 (34%), Gaps = 9/86 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPP----PXXXPPLPXXXXPPPPXPPX 791 PPP P P P PP GPP P P PP PPPP Sbjct: 167 PPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGM 226 Query: 792 R-XPPPXPFLAHXXXGXXXP-PSXPP 863 + PPP P + G P P PP Sbjct: 227 QGPPPPRPGMPPAPGGFAPPRPGMPP 252 Score = 36.3 bits (80), Expect = 0.026 Identities = 27/81 (33%), Positives = 27/81 (33%), Gaps = 5/81 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXX-PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXP---PPPXPPXRXPP 803 PP P P P PP P P P PP P PPP R PP Sbjct: 161 PPGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPP 220 Query: 804 PXPFLAHXXXGXXXP-PSXPP 863 P P H G P P PP Sbjct: 221 PPP---HGMQGPPPPRPGMPP 238 Score = 33.1 bits (72), Expect = 0.25 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +3 Query: 663 PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 P P PP P G GPP PP P PPP PPP + Sbjct: 156 PPIIRPPGQMLPPPPFGGQ-GPPMGRGPPPPYGMRPPP--QQFSGPPPPQY 203 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P PPG PP P PPP P P P Sbjct: 183 PPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGG 242 Query: 813 F 815 F Sbjct: 243 F 243 Score = 38.7 bits (86), Expect = 0.005 Identities = 28/86 (32%), Positives = 30/86 (34%), Gaps = 9/86 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPP----PXXXPPLPXXXXPPPPXPPX 791 PPP P P P PP GPP P P PP PPPP Sbjct: 167 PPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGM 226 Query: 792 R-XPPPXPFLAHXXXGXXXP-PSXPP 863 + PPP P + G P P PP Sbjct: 227 QGPPPPRPGMPPAPGGFAPPRPGMPP 252 Score = 36.3 bits (80), Expect = 0.026 Identities = 27/81 (33%), Positives = 27/81 (33%), Gaps = 5/81 (6%) Frame = +3 Query: 636 PPXXXXXPXPXXXX-PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXP---PPPXPPXRXPP 803 PP P P P PP P P P PP P PPP R PP Sbjct: 161 PPGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPP 220 Query: 804 PXPFLAHXXXGXXXP-PSXPP 863 P P H G P P PP Sbjct: 221 PPP---HGMQGPPPPRPGMPP 238 Score = 33.1 bits (72), Expect = 0.25 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +3 Query: 663 PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 P P PP P G GPP PP P PPP PPP + Sbjct: 156 PPIIRPPGQMLPPPPFGGQ-GPPMGRGPPPPYGMRPPP--QQFSGPPPPQY 203 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/58 (36%), Positives = 22/58 (37%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P PP PP P P PP+P P P P P P Sbjct: 50 PPPVMS--PMPMMTPPPMPMTPPPMPMTPP-PMPMAPPPMPMASPPMMPMTPSTSPSP 104 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAP-LAPPPXXXPPSP 756 P TPPP PPP P P P PP P +P P P P Sbjct: 66 PMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSPLTVPDMP 111 Score = 35.9 bits (79), Expect = 0.035 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRA-PLAPPPXXXPPSP 756 TPPP PPP P P P PP + P+ P PSP Sbjct: 61 TPPPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSP 104 Score = 34.7 bits (76), Expect = 0.080 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P P P PPP P P P PP P+APPP P Sbjct: 52 PVMSPMPMMTPPPMPMTPPPMPMTPPP----MPMAPPPMPMASPP 92 Score = 32.3 bits (70), Expect = 0.43 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPP---PPXPPXRXPPPXPFLAHXXXGXXXPPSXP 860 PP G PP P+P PP P P PPP P +A PP P Sbjct: 39 PPMSSGGGSSVPPPVMSPMPMMTPPPMPMTPPPMPMTPPPMP-MAPPPMPMASPPMMP 95 Score = 30.7 bits (66), Expect = 1.3 Identities = 21/77 (27%), Positives = 23/77 (29%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P P P P PP P PP P P PP+ P P P P Sbjct: 56 PMPMMTPPPMPMTPPPMPMTPPPMPM-APP-PMPMASPPMMPMTPSTSPSPLTVPDMPSP 113 Query: 813 FLAHXXXGXXXPPSXPP 863 + P PP Sbjct: 114 PMPSGMESSPSPGPMPP 130 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 P PPP PPP P P P PP P PPP Sbjct: 148 PPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PP P PP P P P P PP P PPP P Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPP 184 Score = 33.1 bits (72), Expect = 0.25 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGP----PPXXXPPLPXXXXPPPPXPP 788 P P PP PP P PP PP P PPP PP Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPP-PPSSLEPPPPPP 185 Score = 32.3 bits (70), Expect = 0.43 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXP 785 P P P PP P P P P PP P PPPP P Sbjct: 146 PPPPESPPPESLPPPSPE-SPSPPSP--EPPPPSSLEPPPPPP 185 >At5g35190.1 68418.m04170 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 328 Score = 38.7 bits (86), Expect = 0.005 Identities = 23/80 (28%), Positives = 25/80 (31%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP PP Sbjct: 199 PPPYVYNSPSPPYYSPSPKVDYKSPPPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPP 258 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P P+ + P PP Sbjct: 259 PPPYYSPSPEVSYKSPPPPP 278 Score = 38.7 bits (86), Expect = 0.005 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P PP PPP P L PPP PPP P Sbjct: 249 PPPYVYSSPPPP---PYYSPSPEVSYKSPP-PPPYYSPSLEVSYKSPPPLFVYNFPPPPP 304 Query: 813 F 815 F Sbjct: 305 F 305 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 3/59 (5%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 PPP P P P PP P PPP P P PP PP P Sbjct: 224 PPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPEVSYKSPPPPPYYSP 282 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 99 PPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYNSPP 158 Query: 807 XPF 815 P+ Sbjct: 159 PPY 161 Score = 31.9 bits (69), Expect = 0.57 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 4/62 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXX-GPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 PPP P P P PP P P PP P PPPP P Sbjct: 124 PPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSLSPKVDYKSPPPPYVYNSPP 183 Query: 801 PP 806 PP Sbjct: 184 PP 185 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/63 (28%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 P P P P P P P PPP P P PP P PP Sbjct: 74 PKPYLFNSPPPPYYSPSPKEDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYNSPP 133 Query: 807 XPF 815 P+ Sbjct: 134 PPY 136 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 81 SPPPPYYSPSPKEDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPP 126 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP +P PPP PSP Sbjct: 231 SPPPPYFSPSPKVDYKSP----PPPYVYSSP--PPPPYYSPSP 267 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +1 Query: 631 PPPPXXXPPPX-PXXXXPXPPXXPPXXXRAPLAPPP---XXXPPSP 756 PPPP P P P PP P + +PPP PP P Sbjct: 258 PPPPYYSPSPEVSYKSPPPPPYYSPSLEVSYKSPPPLFVYNFPPPP 303 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 38.7 bits (86), Expect = 0.005 Identities = 28/88 (31%), Positives = 29/88 (32%), Gaps = 11/88 (12%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP------PXPP-- 788 PPP P P P +P P PP P PPL PPP P PP Sbjct: 44 PPPSK---PSPSMSPPPSPSLPLSSSPPPPPPHKHSPPPLSQSLSPPPLITVIHPPPPRF 100 Query: 789 ---XRXPPPXPFLAHXXXGXXXPPSXPP 863 PPP P PS PP Sbjct: 101 YYFESTPPPPPLSPDGKGSPPSVPSSPP 128 Score = 31.1 bits (67), Expect = 0.99 Identities = 18/54 (33%), Positives = 21/54 (38%), Gaps = 9/54 (16%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAP------LAPPP---XXXPPSP 756 P + P P PPP P P PP +P L+PPP PP P Sbjct: 45 PPSKPSPSMSPPPSPSLPLSSSPPPPPPHKHSPPPLSQSLSPPPLITVIHPPPP 98 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXP--PXRXPPPXP 812 P P PP P PPP P + PPPP P R PPP P Sbjct: 14 PLPPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPP 60 Score = 37.9 bits (84), Expect = 0.009 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 8/57 (14%) Frame = +1 Query: 610 YXXXPXTPPP--------PXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 Y P PPP P PPP P PP PP R APPP PP P Sbjct: 10 YSLVPLPPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRR-RAPPPPPPPPLP 65 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +3 Query: 687 PXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P PP P PPP P + PPPP PP P P Sbjct: 30 PPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRPCSRP 71 Score = 35.5 bits (78), Expect = 0.046 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 5/57 (8%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXX-----GPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P AP PP P PP PP PPL PPPP PP P P P Sbjct: 18 PPPPLMRRRAPLPPPPPPPLMRRRAPPPPP----PPLMRRRAPPPPPPP---PLPRP 67 Score = 35.1 bits (77), Expect = 0.061 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = +3 Query: 717 PPGPPPXXXPPLPXXXXPPPPXPPXRXPPPX-PFLAHXXXGXXXPPSXPP 863 PP PPP P PPPP R PPP P L PP PP Sbjct: 16 PPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRR--APPPPPPPP 63 Score = 32.3 bits (70), Expect = 0.43 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +1 Query: 622 PXTPPPP-----XXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 P PPPP PPP P PP PP P + PP Sbjct: 30 PPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRPCSRPP 72 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 38.7 bits (86), Expect = 0.005 Identities = 29/88 (32%), Positives = 30/88 (34%), Gaps = 11/88 (12%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGG-----------XXXXGRGGXXXGGGPGG 716 GG GG + G G G R GG GG GG GGG GG Sbjct: 98 GGGRGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGGGGG 157 Query: 715 PXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G GG G G G G GGG Sbjct: 158 --YGGGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 37.1 bits (82), Expect = 0.015 Identities = 28/84 (33%), Positives = 28/84 (33%), Gaps = 8/84 (9%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGX-RXGGXGGGGXXXXGRGGXXXGGG-------PGGPXXG 704 G GG G GGG GG GGGG GRGG GG PG Sbjct: 84 GNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARD 143 Query: 703 XGGXXGAXGXXXXGXGXXXXXGGG 632 G G G G GGG Sbjct: 144 CSEGGGGYGGGGGGYGGGGGYGGG 167 Score = 35.9 bits (79), Expect = 0.035 Identities = 21/44 (47%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -3 Query: 805 GGGXRXGGXG-GGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXG 677 GGG GG G GGG G GG GGG GG G GG + G Sbjct: 148 GGGYGGGGGGYGGGGGYGGGGGGYGGGGRGG--GGGGGSCYSCG 189 Score = 35.1 bits (77), Expect = 0.061 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = -3 Query: 778 GGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G G G G GG GG G GG G+ G G G GGG Sbjct: 76 GPDGAPVQGNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGG 124 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXGXXXIY 607 G G G GG+GG G G GG GG G GGG G Y Sbjct: 76 GPDGAPVQGNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCY 132 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 753 GGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGG GGG GG GG G GG GG GGGGG Sbjct: 147 GGGGY--GGGGGG--YGGGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 771 GGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 G P GGG GG G G GG GG GGGGG Sbjct: 135 GEPGHMARDCSEGGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGG 181 Score = 33.1 bits (72), Expect = 0.25 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 787 GGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXG 662 GG GGG G GG GGG G G GG G G Sbjct: 148 GGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGGGSCYSCG 189 Score = 32.7 bits (71), Expect = 0.32 Identities = 23/58 (39%), Positives = 23/58 (39%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXG 638 G G G GGG GRGG GGG GG G GG G G G G G Sbjct: 76 GPDGAPVQGNSGGGS--SGGRGG--FGGGRGG-GRGSGGGYGGGGGGYGGRGGGGRGG 128 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGG 676 GGGG GGG GG GG GG G GG Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGG 180 Score = 31.1 bits (67), Expect = 0.99 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 753 GGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GG GG G GG GG GGGG G Sbjct: 148 GGGYGGGGGGYGGGGGYGGGGGGYGG-----GGR---GGGGGGG 183 Score = 29.9 bits (64), Expect = 2.3 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = -1 Query: 774 GGGPXXXGGG---XXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G G GGG GGG+GG G GG GGGGG G Sbjct: 106 GSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGGGGGYG 159 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGG 743 G GGG R GG GGG G G Sbjct: 170 GYGGGGRGGGGGGGSCYSCGESG 192 Score = 28.7 bits (61), Expect = 5.3 Identities = 21/71 (29%), Positives = 23/71 (32%) Frame = -2 Query: 821 GQKRARWGXAGGWXXGGGXPXXGEGGXXXXXXXXXXXXXXXGXXGGXGXXXXGXGGGXXX 642 G + + G GG GG G GG GG G G GGG Sbjct: 103 GGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYG--GGGGGYGG 160 Query: 641 GGGGVXGXXXY 609 GGG G Y Sbjct: 161 GGGYGGGGGGY 171 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -1 Query: 765 PXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 P GGG GG GG GG G GG GG GGGGG G Sbjct: 4 PMRGGGGFRGRGGRDGG----GGGRFGGGGGRFGGGGGRFGGGGGRFG 47 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = -3 Query: 814 KGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 +G GG GG GGG G GG GGG GG G GG G Sbjct: 6 RGGGGFRGRGGRDGGGGGRFGGGGGRFGGG-GGRFGGGGGRFG 47 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = -3 Query: 817 RKGXGGGXRXGGXG---GGGXXXXGRGGXXXGGGPGGP 713 R G GGG GG G GGG G GG G GP Sbjct: 17 RDGGGGGRFGGGGGRFGGGGGRFGGGGGRFGGFRDEGP 54 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 6/55 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXG----PPGPPP--XXXPPLPXXXXPPPP 779 P P P P P PP P G PPGPPP PP P PP P Sbjct: 68 PSPQYSPPPPPSQSSPPRSRCPPVPTTGCCNQPPGPPPSTMYSPPYPYFYTPPYP 122 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/49 (32%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXX---PPPPXPPXRXPPPXPF 815 P +P P P PP PP+P PP P P PP P+ Sbjct: 67 PPSPQYSPPPPPSQSSPPRSRCPPVPTTGCCNQPPGPPPSTMYSPPYPY 115 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P PP P PP PP P P PP P PP P Sbjct: 61 PYGNPPPPSPQYSPPPPPSQSSP--PRSRCPPVPTTGCCNQPPGP 103 Score = 31.1 bits (67), Expect = 0.99 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPX---PPXRXPPPXPFLAHXXXGXXXPPS 854 P P G PP PP P PPPP PP PP P PPS Sbjct: 54 PRLQRYSPYGNPP---PPSPQYSPPPPPSQSSPPRSRCPPVPTTGCCNQPPGPPPS 106 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 PP P PPP P P PP PP PPS Sbjct: 67 PPSPQYSPPPPPSQSSPPRSRCPPVPTTGCCNQPP-GPPPS 106 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = -3 Query: 799 GXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 G + GG GGGG +G GGG GG G GG G Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 33.5 bits (73), Expect = 0.19 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGP 682 GGGGP G GGG GG GG GP Sbjct: 109 GGGGPANNNKGQKIGGGGGGGGGGGGGGGGGP 140 Score = 31.9 bits (69), Expect = 0.57 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -1 Query: 729 GGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG+GG GG G GG GGGGG G Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 750 GGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG GGG G G G GG GG GGGGG G Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGG-----GGGGGGGGGGGGG 139 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGG 767 GG GG + G GGG GG GGGG Sbjct: 106 GGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 814 KGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGG 716 KG GGG G G GG GGG GG Sbjct: 104 KGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGG 136 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = -3 Query: 754 GRGGXXXGGGPG----GPXXGXGGXXGAXGXXXXGXG 656 G+GG GGGP G G GG G G G G Sbjct: 103 GKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGG 767 GG GG +K GGG GG GGGG Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGG 136 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGP 713 G GGG G G GG GGG GGP Sbjct: 108 GGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGP 140 >At4g08400.1 68417.m01388 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 513 Score = 38.3 bits (85), Expect = 0.007 Identities = 24/79 (30%), Positives = 25/79 (31%), Gaps = 2/79 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P R PPP Sbjct: 209 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYYRSPPP 268 Query: 807 XPFLAHXXXGXXXPPSXPP 863 + PP PP Sbjct: 269 PYYSPSPKVDYKSPP--PP 285 Score = 35.5 bits (78), Expect = 0.046 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 3/61 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P P PP P PPPP PP Sbjct: 234 PPPYVYSSPPPPYYSPSPKVNYKSPPPPYYRSPPPPYYSPSPKVDYKSPPPPYVYSSPPP 293 Query: 804 P 806 P Sbjct: 294 P 294 Score = 35.5 bits (78), Expect = 0.046 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXX-PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPX 809 PPP P P P P P PPP P P PP P PP Sbjct: 259 PPPYYRSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPP 318 Query: 810 PF 815 P+ Sbjct: 319 PY 320 Score = 35.1 bits (77), Expect = 0.061 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 159 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 218 Query: 807 XPF 815 P+ Sbjct: 219 PPY 221 Score = 35.1 bits (77), Expect = 0.061 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 283 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 342 Query: 807 XPF 815 P+ Sbjct: 343 PPY 345 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 134 PPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 193 Query: 807 XPF 815 P+ Sbjct: 194 PPY 196 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 184 PPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 243 Query: 807 XPF 815 P+ Sbjct: 244 PPY 246 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 308 PPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 367 Query: 807 XPF 815 P+ Sbjct: 368 PPY 370 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 333 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPP 392 Query: 807 XPF 815 P+ Sbjct: 393 PPY 395 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 109 PPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPP 168 Query: 807 XPF 815 P+ Sbjct: 169 PPY 171 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 358 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYIYNSPP 417 Query: 807 XPF 815 P+ Sbjct: 418 PPY 420 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 408 PPPYIYNSPPPPYYSPSPKVNYKTPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPP 467 Query: 807 XPF 815 P+ Sbjct: 468 PPY 470 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 433 PPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPNVDYKSPPPPYVYSSPP 492 Query: 807 XPF 815 P+ Sbjct: 493 TPY 495 Score = 33.9 bits (74), Expect = 0.14 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 383 PPPYVYNSPPPPYYSPSPKVDYKSPPPPYIYNSPPPPYYSPSPKVNYKTPPPPYVYSSPP 442 Query: 807 XPF 815 P+ Sbjct: 443 PPY 445 Score = 33.5 bits (73), Expect = 0.19 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP PP Sbjct: 258 PPPPYYRSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 317 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 318 PPYYSPTPKVDYKSPP--PP 335 Score = 32.3 bits (70), Expect = 0.43 Identities = 21/75 (28%), Positives = 23/75 (30%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 PP P P P PP PP P P P PP P PP P+ Sbjct: 92 PPPPYYSPSPKVDYKSLP--PPYVYSSPP---PPYYSPSPKVNYKSPPPPYVYSSPPPPY 146 Query: 816 LAHXXXGXXXPPSXP 860 + G P P Sbjct: 147 YSPSPKGDYKSPPPP 161 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 241 SPPPPYYSPSPKVNYKSPPPPYYRSPPPPYYSPSPKVDYKSPPPP 285 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/46 (32%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P + PP P Sbjct: 465 SPPPPYYSPSPNVDYKSPPPPYVYSSPPTPYYSPSSKVTYKSPPPP 510 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 166 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPP 211 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 290 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPP 335 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 116 SPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPP 161 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 365 SPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPP 410 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 415 SPPPPYYSPSPKVNYKTPPPPYVYSSPPPPYYSPSPKVNYKSPPPP 460 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 4/64 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXX-GPPGPPPXXXPPLPXXXX---PPPPXPPXRXP 800 P P P AP P P P PPP PP P PPPP P Sbjct: 86 PSPTDSSSSTSISPNPPAPIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIP 145 Query: 801 PPXP 812 PP P Sbjct: 146 PPPP 149 Score = 32.3 bits (70), Expect = 0.43 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 P TP PP PP P P PP P+ PPP Sbjct: 113 PSTPNPPPEFSPPPPDLDTTTAP--PPPSTDIPIPPPP 148 Score = 31.9 bits (69), Expect = 0.57 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 4/64 (6%) Frame = +3 Query: 639 PXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPX----PPXRXPPP 806 P P P P PP P PP P PPP PP PP Sbjct: 66 PFPNPNPNPNPNPPVLGSSPPSPTDSSSSTSISPNPPAPIVNPNPPPPSTPNPPPEFSPP 125 Query: 807 XPFL 818 P L Sbjct: 126 PPDL 129 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXP---PPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PP P P PP P +P PP SP Sbjct: 123 SPPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASPPLTPPSSVVTSP 168 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P P PP P PP +P PPP P PP P Sbjct: 111 PPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPP--PPPAPVSASPPLTP 160 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 631 PPPPXXXP-PPXPXXXXPXPP-XXPPXXXRAPLAPPP 735 PP P P PP P P P PP APPP Sbjct: 101 PPAPIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPP 137 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 38.3 bits (85), Expect = 0.007 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 1/61 (1%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXG-XGGXXGAXGXXXXGXGXXXXXGG 635 G GGG GG GG +GG GGG G P G GG G G G G Sbjct: 267 GAGGGKGAGGGAKGGPGNQNQGGGKNGGG-GHPQDGKNGGGGGGPNAGKKGNGGGGPMAG 325 Query: 634 G 632 G Sbjct: 326 G 326 Score = 37.1 bits (82), Expect = 0.015 Identities = 26/78 (33%), Positives = 29/78 (37%), Gaps = 1/78 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGX-GGGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 GG G A+ G G + GG GGGG G+ GGG GGP G G G Sbjct: 264 GGGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKN----GGGGGGPNAGKKGNGG 319 Query: 685 AXGXXXXGXGXXXXXGGG 632 G GGG Sbjct: 320 GGPMAGGVSGGFRPMGGG 337 Score = 36.7 bits (81), Expect = 0.020 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGGG GGG GG +GGP GG G GGGGG Sbjct: 264 GGGGA---GGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGGGG 309 Score = 34.3 bits (75), Expect = 0.11 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 3/49 (6%) Frame = -1 Query: 771 GGPXXXGG-GXXXXGGG--QGGPXXXGGXXXGPGGXXXXXGGXXXGGGG 634 GGP GG G GGG GG GG GPG GG GGGG Sbjct: 250 GGPAKNGGKGAPAAGGGGAGGGKGAGGGAKGGPGN--QNQGGGKNGGGG 296 Score = 33.1 bits (72), Expect = 0.25 Identities = 23/63 (36%), Positives = 24/63 (38%) Frame = -3 Query: 820 ARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXX 641 A+ G G GG G GG G G GGPG G GG G G G Sbjct: 253 AKNGGKGAPAAGGGGAGGGKGAGGGAK---GGPGNQNQG-GGKNGGGGHPQDGKN--GGG 306 Query: 640 GGG 632 GGG Sbjct: 307 GGG 309 Score = 33.1 bits (72), Expect = 0.25 Identities = 21/59 (35%), Positives = 22/59 (37%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 G GG P +KG GGG G GG G GG P G G GG G Sbjct: 301 GKNGGGGGGPNA--GKKGNGGGGPMAGGVSGGFRPMGGGGPQNMSMPMGGQMGMGGPMG 357 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQ-GGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GG G G GGG+ GG G GG G GGGG G Sbjct: 273 GAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGGGPMAG 325 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -3 Query: 784 GXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 G GGGG + G GGG GG G GG A Sbjct: 103 GGGGGGNNNNNKKGQKNGGGGGG--GGGGGNSNA 134 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG G GGG GGG GG GP GG GG G Sbjct: 280 GGPGNQNQGGGKN-GGGGHPQDGKNGGGGGGPNAGKKGNGGGGPMAGGVSGG 330 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/42 (42%), Positives = 20/42 (47%) Frame = +3 Query: 699 PXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAH 824 P G G PP PP P PPPP P PPP P +A+ Sbjct: 220 PQSAVGANGLPPPPPPP-PHQAQPPPPPPSGLFPPPPPPMAN 260 Score = 31.9 bits (69), Expect = 0.57 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 P PPPP PP P PP PP PP Sbjct: 231 PPPPPPPHQAQPPPPPPSGLFPPPPPPMANNGFRPMPP 268 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 T P P P PP PP + P PP PP P Sbjct: 213 TKPEPNKPQSAVGANGLPPPPPPPPHQAQPPPPPPSGLFPPPP 255 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 3/39 (7%) Frame = +1 Query: 622 PXTPPPP---XXXPPPXPXXXXPXPPXXPPXXXRAPLAP 729 P PPPP PPP P P PP P+ P Sbjct: 230 PPPPPPPPHQAQPPPPPPSGLFPPPPPPMANNGFRPMPP 268 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 687 PXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P PP P P PPP P PPPP P P Sbjct: 231 PPPPPPPHQAQPPPPP----PSGLFPPPPPPMANNGFRPMPP 268 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGG GGG GGG G GG G GG GG GGG G Sbjct: 66 GGGGNYQGGGGNYQGGG-GRYQGGGGRYQGGGGRYQGGGGRQGGGGSG 112 Score = 37.5 bits (83), Expect = 0.011 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 2/62 (3%) Frame = -3 Query: 811 GXGGGXRXGGXG--GGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXG 638 G GG G G GGG G GG GGG G G GG G G G G Sbjct: 45 GDNGGNYNNGGGYQGGGGNYQGGGGNYQGGG--GNYQGGGGRYQGGGGRYQGGGGRYQGG 102 Query: 637 GG 632 GG Sbjct: 103 GG 104 Score = 36.7 bits (81), Expect = 0.020 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = -3 Query: 805 GGGXRXGGXG--GGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 GGG + GG GGG G GG GGG G G GG G G G GG Sbjct: 54 GGGYQGGGGNYQGGGGNYQGGGGNYQGGG--GRYQGGGGRYQGGGGRYQGGGGRQGGGG 110 Score = 35.5 bits (78), Expect = 0.046 Identities = 24/70 (34%), Positives = 25/70 (35%), Gaps = 3/70 (4%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXG---GGGXXXXGRGGXXXGGGPGGPXXGXGGX 692 GG +GG GGG GG G GGG G GG GGG G GG Sbjct: 55 GGYQGGGGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGRYQGGGGRQGGGGSGGS 114 Query: 691 XGAXGXXXXG 662 G G Sbjct: 115 YCRHGCCYRG 124 Score = 32.3 bits (70), Expect = 0.43 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 729 GGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXGXXXIY 607 G GG GG G GG GG GGGG G Y Sbjct: 45 GDNGGNYNNGGGYQGGGGNYQGGGGNYQGGGGNYQGGGGRY 85 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGG 697 GGGG GGG GGG+ G GG Sbjct: 87 GGGGRYQGGGGRYQGGGGRQGGGGSGG 113 Score = 28.7 bits (61), Expect = 5.3 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGG---QGGPXXXGGXXXGPGGXXXXXGGXXXGGGG 634 GGG GGG GGG QGG GG G GG G G G Sbjct: 80 GGGGRYQGGGGRYQGGGGRYQGGGGRQGG--GGSGGSYCRHGCCYRGYNG 127 Score = 27.9 bits (59), Expect = 9.2 Identities = 19/69 (27%), Positives = 21/69 (30%), Gaps = 2/69 (2%) Frame = -2 Query: 821 GQKRARWGXAGGWXXGGGXPXXGEGGXXXXXXXXXXXXXXXGXXGGXGXXXXGX--GGGX 648 G + GG+ GGG G G GG G GGG Sbjct: 45 GDNGGNYNNGGGYQGGGGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGRYQGGGG 104 Query: 647 XXGGGGVXG 621 GGGG G Sbjct: 105 RQGGGGSGG 113 Score = 27.9 bits (59), Expect = 9.2 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 753 GGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GG GG QGG GG G GG GG GGGG Sbjct: 48 GGNYNNGGGYQGG----GGNYQG-GGGNYQGGGGNYQGGGG 83 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 38.3 bits (85), Expect = 0.007 Identities = 25/76 (32%), Positives = 26/76 (34%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P AP PP P PP P LP PPPP P P Sbjct: 37 PPP-----PQQHSQPPVAPLVPPGPPYAPPAQIPSSL--LPTNLPPPPPFRPGMQFTPVA 89 Query: 813 FLAHXXXGXXXPPSXP 860 + G P S P Sbjct: 90 NFQNPSSGVPPPGSMP 105 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +1 Query: 628 TPPPPX-XXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 TPPPP PP P PP PP + L P PP Sbjct: 36 TPPPPQQHSQPPVAPLVPPGPPYAPPAQIPSSLLPTNLPPPP 77 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/39 (35%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +3 Query: 687 PXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP-XPPXRXP 800 P P P PP P PP+ P PP PP + P Sbjct: 27 PNPNPNPSLTPPPPQQHSQPPVAPLVPPGPPYAPPAQIP 65 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP--XPPXRXPPP 806 P P P PP PPP PP P PP P PP PPP Sbjct: 856 PSVLQPPLQPQSQPPEPPPEMMPPPPQALPPPLPHSHPPLVPPPP 900 Score = 34.3 bits (75), Expect = 0.11 Identities = 24/70 (34%), Positives = 26/70 (37%), Gaps = 6/70 (8%) Frame = +3 Query: 627 HXPPPXXXXXPX---PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXP---PPPXPP 788 + PPP P P P PP P PP PP PPLP P PPP P Sbjct: 846 YPPPPLGHSLPSVLQPPLQPQSQPPEPP-PEMMPP-PPQALPPPLPHSHPPLVPPPPFSP 903 Query: 789 XRXPPPXPFL 818 P P + Sbjct: 904 LLSPRLPPMV 913 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPP 732 PPPP PPP P P P P +P PP Sbjct: 878 PPPPQALPPPLPHSHPPLVPPPPFSPLLSPRLPP 911 Score = 31.9 bits (69), Expect = 0.57 Identities = 25/85 (29%), Positives = 26/85 (30%), Gaps = 8/85 (9%) Frame = +3 Query: 633 PPPXXXXXPX-PXXXXPXA-PXXPPXPXXGPPGPPPXXXPPLPXXXXPP------PPXPP 788 PP P P P + P P PPP LP PP PP PP Sbjct: 814 PPAQQVSGPFMPPPVHPVSQPQGPQVQQFDQLYPPPPLGHSLPSVLQPPLQPQSQPPEPP 873 Query: 789 XRXPPPXPFLAHXXXGXXXPPSXPP 863 PP P PP PP Sbjct: 874 PEMMPPPPQALPPPLPHSHPPLVPP 898 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 634 PPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP 747 PPP PPP P P PP L PPP P Sbjct: 872 PPPEMMPPPPQALPPPLPHSHPP------LVPPPPFSP 903 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = +3 Query: 684 APXXPPXPXXGPPGPPPXXXPPLPXXXXPP-PPXPPXRXPPPXPFLAHXXXGXXXPPSXP 860 AP PP P PPP PP PP PPP P G PP P Sbjct: 221 APLPPPPGRAALPPPPPLPMAVRKGVAAPPLPPPGTAALPPPPPLPMAAGKGVAAPPPPP 280 Query: 861 P 863 P Sbjct: 281 P 281 Score = 33.5 bits (73), Expect = 0.19 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 2/62 (3%) Frame = +3 Query: 684 APXXPPXPXXGP-PGPPPXXXPPLPXXXXPPPPXPPX-RXPPPXPFLAHXXXGXXXPPSX 857 AP PP P P PP P PP P PPP P G PP Sbjct: 193 APPPPPPPGNAAIPVEPPLTMSAEKESYAPLPPPPGRAALPPPPPLPMAVRKGVAAPPLP 252 Query: 858 PP 863 PP Sbjct: 253 PP 254 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXR 794 PPP P AP PP P PPP PPPP P R Sbjct: 233 PPPPPL--PMAVRKGVAAPPLPPPGTAALPPPPPLPMAAGKGVAAPPPPPPGAR 284 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PP P PP PPP P PPP PP P P P Sbjct: 1126 PPLPHESPPSPPPQ-----PPSSPPPPSSPPQLAPAPPP 1159 Score = 34.7 bits (76), Expect = 0.080 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = +3 Query: 663 PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXX 842 P P PP P PP PP P P P PP PPP LA Sbjct: 1122 PAGSPPLPHESPPSPPPQPPSSPP--PPSSPPQLAPAPPPSDHCLPPPTAPLA-PAQSIA 1178 Query: 843 XPPS 854 PPS Sbjct: 1179 LPPS 1182 Score = 33.1 bits (72), Expect = 0.25 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPP 788 P P P P PP P PP P P PPP P Sbjct: 1127 PLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAP 1170 Score = 32.3 bits (70), Expect = 0.43 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 655 PPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 PP P P PP PP P +PP P P Sbjct: 1126 PPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPP 1159 Score = 31.5 bits (68), Expect = 0.75 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P P +P P P P PPP LP P P PP Sbjct: 1126 PPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPPSDHC-LPPPTAPLAPAQSIALPP 1181 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/43 (44%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAP-LAPPPXXXPPS 753 +PP P PP P P PP PP P LAP P PPS Sbjct: 1125 SPPLPHESPPSPP----PQPPSSPPPPSSPPQLAPAP---PPS 1160 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P P PPP P P PP PP AP PP P P Sbjct: 1126 PPLPHESPPSPPPQP-PSSPPPPSSPPQL--APAPPPSDHCLPPP 1167 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 6/50 (12%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPP-----XXXRAPLAP-PPXXXPPS 753 P +PPP PP P P PP APLAP PPS Sbjct: 1133 PPSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAPLAPAQSIALPPS 1182 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 37.9 bits (84), Expect = 0.009 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 814 KGXGGGXRXGGXGG-GGXXXXGRGGXXXGGGPGGPXXGXGG 695 +G GGG GG GG GG G GG GGG GG G GG Sbjct: 85 RGSGGGG--GGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGG 123 Score = 37.5 bits (83), Expect = 0.011 Identities = 19/34 (55%), Positives = 19/34 (55%) Frame = -3 Query: 817 RKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGG 716 R G GGG R GG GGG G GG GGG GG Sbjct: 94 RGGSGGGYRSGG--GGGYSGGGGGGYSGGGGGGG 125 Score = 35.9 bits (79), Expect = 0.035 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGG 695 G GGG R G GGG G GG GGG G G GG Sbjct: 88 GGGGGGRGG--SGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 34.7 bits (76), Expect = 0.080 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 784 GXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXG 677 G GGGG G GG GG GG G GG G Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGG 121 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 793 RXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXG 677 R G GGGG G GG GGG G G GG G G Sbjct: 85 RGSGGGGGGRGGSG-GGYRSGGGGGYSGGGGGGYSGGGG 122 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -1 Query: 747 GXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GGG+GG GG G GG GG GGGG G Sbjct: 86 GSGGGGGGRGGSG--GGYRSGGGGGYSGGGGGGYSGGGGGGG 125 Score = 32.7 bits (71), Expect = 0.32 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 753 GGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGG GG GG GG GG GG GGGGG Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGG---GGGGG 125 Score = 31.1 bits (67), Expect = 0.99 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGG 676 GGGG GG GGG G GG G GG Sbjct: 89 GGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGG 122 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGG 676 GGGG GGG GGG GG G GG Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGG 123 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 751 RGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGGXXW 623 RG GGG GG G G G G G GGG W Sbjct: 85 RGSGGGGGGRGGSGGGYRSGGGG-GYSGGGGGGYSGGGGGGGW 126 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGG 676 GGGG G G GG GG GG GG Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGG 121 Score = 28.7 bits (61), Expect = 5.3 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 768 GPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 G GGG GGG GG G GG GG GGGGG Sbjct: 86 GSGGGGGGRGGSGGGYRS--GGGGGYSGGGG-----GGYSGGGGGG 124 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGXGGGG 767 G GG G GGG GG GGGG Sbjct: 95 GGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGG 715 GGGG GGG GGG GG Sbjct: 105 GGGGYSGGGGGGYSGGGGGGG 125 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 37.9 bits (84), Expect = 0.009 Identities = 26/73 (35%), Positives = 28/73 (38%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 PP P P P +P PP P PPP PLP PPP PP PP P Sbjct: 27 PPPAASSPPPTTT-PSSP--PPSPSTNSTSPPPSS--PLPPSL--PPPSPPGSLTPPLPQ 79 Query: 816 LAHXXXGXXXPPS 854 + PPS Sbjct: 80 PSPSAPITPSPPS 92 Score = 37.5 bits (83), Expect = 0.011 Identities = 24/81 (29%), Positives = 25/81 (30%), Gaps = 4/81 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPP----XPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 PPP P + PP P PP PP PPLP P P P Sbjct: 34 PPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLP----QPSPSAPITPS 89 Query: 801 PPXPFLAHXXXGXXXPPSXPP 863 PP P P PP Sbjct: 90 PPSPTTPSNPRSPPSPNQGPP 110 Score = 37.1 bits (82), Expect = 0.015 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXX-PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP 779 P P P P P P PP P GPP P P P P PP Sbjct: 80 PSPSAPITPSPPSPTTPSNPRSPPSPNQGPPNTPSGSTPRTPSNTKPSPP 129 Score = 34.7 bits (76), Expect = 0.080 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 3/63 (4%) Frame = +3 Query: 684 APXXPPXPXXGPPGPP--PXXXPPLPXXXXPPPPXPPXRXPP-PXPFLAHXXXGXXXPPS 854 AP P PP PP P P PPP P PP P PPS Sbjct: 4 APSPGTTPSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPS 63 Query: 855 XPP 863 PP Sbjct: 64 LPP 66 Score = 34.7 bits (76), Expect = 0.080 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAP-PPXXXPPSP 756 TPPP PPP P P P +P PP PPSP Sbjct: 26 TPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSP 69 Score = 33.9 bits (74), Expect = 0.14 Identities = 20/76 (26%), Positives = 22/76 (28%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P PP P P P P P P P + PP P Sbjct: 54 PPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSPNQGPPNTP 113 Query: 813 FLAHXXXGXXXPPSXP 860 + PS P Sbjct: 114 SGSTPRTPSNTKPSPP 129 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPP-PXXXPPSP 756 P +PPP P P PP PP L PP P P +P Sbjct: 40 PSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAP 85 Score = 31.9 bits (69), Expect = 0.57 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 6/66 (9%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP--PXXXPPLPXXXX--PPP--PXPPXR 794 P P P P + P P P P P PP P PPP P PP Sbjct: 5 PSPGTTPSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSL 64 Query: 795 XPPPXP 812 PP P Sbjct: 65 PPPSPP 70 Score = 31.9 bits (69), Expect = 0.57 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 5/53 (9%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP-----XXXPPSPXXG 765 P +P PP PP P P P P P P P PPSP G Sbjct: 56 PSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSPNQG 108 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P +P PPP PP PP PL P P +P Sbjct: 44 PPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITP 88 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 726 PPPXXXPPLPXXXXPPPPXPP 788 PPP PP P PPPP PP Sbjct: 217 PPPK--PPSPPRKPPPPPPPP 235 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXX--PPPXPXXXXPXPPXXPPXXXRAPL-APPPXXXPPSP 756 +PPP PPP P PP P P +PP PP P Sbjct: 33 SPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLP 78 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 TP P PP P P P P +PPP Sbjct: 10 TPSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPP 45 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAP-PPXXXPPS 753 P + P P PPP P P P AP+ P PP PS Sbjct: 55 PPSSPLPPSLPPPSP--PGSLTPPLPQPSPSAPITPSPPSPTTPS 97 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/41 (31%), Positives = 15/41 (36%) Frame = +1 Query: 634 PPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 PPP PP P PP + + P PPSP Sbjct: 217 PPPKPPSPPRKPPPPPPPPAFMSSSGGSDYSDLPVLPPPSP 257 Score = 28.3 bits (60), Expect = 7.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 768 PPPPXPPXRXPPPXP 812 P PP PP + PPP P Sbjct: 219 PKPPSPPRKPPPPPP 233 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 37.9 bits (84), Expect = 0.009 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G GGG GG G G G GGG GG G G GA G G G G Sbjct: 57 GGGGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAG 116 Score = 35.5 bits (78), Expect = 0.046 Identities = 22/51 (43%), Positives = 23/51 (45%) Frame = -1 Query: 783 EXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 + GGGG GGG GG GG GG G GG GG GGG G Sbjct: 55 DLGGGGGISGGGGFGAGGGWIGG--SVGGFGGGIGG---GFGGGGFGGGAG 100 Score = 34.7 bits (76), Expect = 0.080 Identities = 28/78 (35%), Positives = 29/78 (37%), Gaps = 2/78 (2%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPG-GPXXGXG-GXXG 686 G +GG A KG GG G GG G G G GG G G G G G G Sbjct: 110 GVDGGAGKGVDGGAGKGFDGGVGKGVDGGAGKGFDGGVGKGFEGGIGKGIEGGVGKGFDG 169 Query: 685 AXGXXXXGXGXXXXXGGG 632 G G G GGG Sbjct: 170 GAGKGVDG-GAIGGIGGG 186 Score = 32.7 bits (71), Expect = 0.32 Identities = 25/79 (31%), Positives = 26/79 (32%), Gaps = 2/79 (2%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRG--GXXXGGGPGGPXXGXGGXX 689 GG GG G GGG GG G G G+G G G GG G G Sbjct: 72 GGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDGGAGKGFDGGV 131 Query: 688 GAXGXXXXGXGXXXXXGGG 632 G G G G G Sbjct: 132 GKGVDGGAGKGFDGGVGKG 150 Score = 31.9 bits (69), Expect = 0.57 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = -3 Query: 784 GXGGGGXXXXGRGGXXXGGG-PGGPXXG-XGGXXGAXGXXXXGXGXXXXXGGG 632 G GGG G GG GGG GG G GG G G G G GG Sbjct: 54 GDLGGGGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGG 106 Score = 31.1 bits (67), Expect = 0.99 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 3/62 (4%) Frame = -3 Query: 811 GXGGGX---RXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXX 641 G GGG GG GGG G GG G G G G G G G Sbjct: 69 GAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDGGAGKGFD 128 Query: 640 GG 635 GG Sbjct: 129 GG 130 Score = 31.1 bits (67), Expect = 0.99 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 G G GG GGG GG GG G G G GG G Sbjct: 69 GAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAG 116 Score = 31.1 bits (67), Expect = 0.99 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGG 716 G EGG KG GG G GG G G GGG GG Sbjct: 150 GFEGGIGKGIEGGVGKGFDGGAGKGVDGGAIGGIGGGAGKEIGGGIGG 197 Score = 29.9 bits (64), Expect = 2.3 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 G +GG KG GG G GG G G GGG G G G G Sbjct: 142 GFDGGVGKGFEGGIGKGIEGGVGKGFDGGAGKGVDGGAIGGIGGGAGKEIGGGIGGGG 199 >At4g15460.1 68417.m02363 glycine-rich protein Length = 148 Score = 37.5 bits (83), Expect = 0.011 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GG GGG GGG GG G GG GG GGGGG Sbjct: 54 GGAHASVGGGHASGGGGHAS--VGGGHASGGGGHAVEGGGHAGGGGGG 99 Score = 36.3 bits (80), Expect = 0.026 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -1 Query: 786 VEXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGG 634 V GGGG GGG GG GG G GG GG GGGG Sbjct: 35 VAKGGGGGAHGGGGVHVSVGG-AHASVGGGHASGGGGHASVGGGHASGGGG 84 Score = 35.5 bits (78), Expect = 0.046 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGGG GGG GGG G G GG GG G GGG Sbjct: 67 GGGGHASVGGGHASGGGGHA-VEGGGHAGGGGGGHGEEEGGHGIGRGGG 114 Score = 30.7 bits (66), Expect = 1.3 Identities = 24/77 (31%), Positives = 24/77 (31%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 G GG A GGG GGGG G GG GGG G G Sbjct: 42 GAHGGGGVHVSVGGAHASVGGGH---ASGGGGHASVG-GGHASGGGGHAVEGGGHAGGGG 97 Query: 682 XGXXXXGXGXXXXXGGG 632 G G GGG Sbjct: 98 GGHGEEEGGHGIGRGGG 114 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGG 640 GGGG GGG GGG G GG G GG GG Sbjct: 81 GGGGHAVEGGGHAG-GGGGGHGEEEGGHGIGRGGGMVHRPATRNGG 125 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGG 695 GGG GG GG G G G GG P GG Sbjct: 89 GGGHAGGGGGGHGEEEGGHGIGRGGGMVHRPATRNGG 125 >At2g04190.1 68415.m00404 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 411 Score = 37.5 bits (83), Expect = 0.011 Identities = 23/64 (35%), Positives = 24/64 (37%), Gaps = 3/64 (4%) Frame = -3 Query: 814 KGXGGGXRXGGXG---GGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXX 644 +G GGG R G G G G G G GPG G GG G G G Sbjct: 41 RGYGGGPRVHGPGYGIGSRGPDPGPGFFFGGAGPGPGYGGGGGHGPGYGGGGDGRGYGSE 100 Query: 643 XGGG 632 GGG Sbjct: 101 TGGG 104 Score = 37.1 bits (82), Expect = 0.015 Identities = 27/67 (40%), Positives = 27/67 (40%), Gaps = 7/67 (10%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRG---GXXXGGGP--GGPXXGXG--GXXGAXGXXXXGXGX 653 G G G G GGGG GRG G GGGP GP G G G G G G Sbjct: 15 GKGVGSCVFGGGGGGPAFGGRGGGPGRGYGGGPRVHGPGYGIGSRGPDPGPGFFFGGAGP 74 Query: 652 XXXXGGG 632 GGG Sbjct: 75 GPGYGGG 81 Score = 32.3 bits (70), Expect = 0.43 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 8/60 (13%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXG--------GXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGGP G G G GGP G G GPG G GGGG G Sbjct: 26 GGGGPAFGGRGGGPGRGYGGGPRVHGPGYGIGSRGPDPGPGFFFGGAGPGPGYGGGGGHG 85 Score = 30.7 bits (66), Expect = 1.3 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQG-GPXXX-GGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGP G G G GP GG GPG G GGGG G Sbjct: 44 GGGPRVHGPGYGIGSRGPDPGPGFFFGGAGPGPGYGGGGGHGPGYGGGGDGRG 96 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 37.5 bits (83), Expect = 0.011 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 G GGG GG G G G G GGG GG G GG G G G G GG Sbjct: 52 GLGGGAGLGGLGIGAGIGAG-AGLGLGGGGGGLGGGGGGLLGGGG---FGGGAGGGLGG 106 Score = 36.3 bits (80), Expect = 0.026 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG G G GG G G G G GG GGG GG G G GA Sbjct: 41 GGGGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGA 100 Query: 682 XG 677 G Sbjct: 101 GG 102 Score = 35.9 bits (79), Expect = 0.035 Identities = 25/63 (39%), Positives = 25/63 (39%), Gaps = 5/63 (7%) Frame = -3 Query: 805 GGGXRXGGXG---GGGXXXXGRG-GXXXGGGPG-GPXXGXGGXXGAXGXXXXGXGXXXXX 641 GGG G G GGG G G G G G G G G GG G G G G Sbjct: 41 GGGGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGA 100 Query: 640 GGG 632 GGG Sbjct: 101 GGG 103 Score = 35.5 bits (78), Expect = 0.046 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG G G G GG G G G GG GGGGG G Sbjct: 41 GGGGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLG 92 Score = 35.5 bits (78), Expect = 0.046 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXG 704 G GG A G G G GG GGGG G GG GGG GG G Sbjct: 56 GAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGG--FGGGAGGGLGG 106 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = -1 Query: 774 GGGPXXXGGGXXXX-GGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG G G G G G GG G GG GG GG GG G Sbjct: 54 GGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGGLG 105 Score = 31.9 bits (69), Expect = 0.57 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGG 676 G G GGG GGG GG GG G GG Sbjct: 69 GAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGG 102 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXG-GXXXGPGGXXXXXGGXXXGGGGGXXG 622 G G GGG G G G G G G GG GG GGGG G Sbjct: 46 GDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGG 98 >At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear antigen EBNA-1 (GI:3342234) {Cercopithecine herpesvirus 15} Length = 118 Score = 37.1 bits (82), Expect = 0.015 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXG-GGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 GGG G G GG G G G GG G G GG G G G G G Sbjct: 5 GGGSGSSGSGSGGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDG 63 Score = 36.3 bits (80), Expect = 0.026 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G G G GG G G GG G G GG G GG G G G GGG Sbjct: 22 GSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRG------DGRGDGRGIGGG 73 Score = 35.1 bits (77), Expect = 0.061 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 1/70 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXG-GGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 GG G G G GG GG G GG G GG G G GG G GG G Sbjct: 5 GGGSGSSGSGSGGSVSGGSGSGGSGSGGSGSGG---SGSGGRANGRGNGGRGSGRGGGRG 61 Query: 685 AXGXXXXGXG 656 G G Sbjct: 62 DGRGDGRGIG 71 Score = 32.7 bits (71), Expect = 0.32 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXG-GGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXGXXXI 610 G GG G G G GG+ GG G GG G G GGG G I Sbjct: 24 GSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRGIGGGGRGRGRI 80 Score = 32.3 bits (70), Expect = 0.43 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG G G G GG G GG G G G GG G G Sbjct: 6 GGSGSSGSGSGGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRG 57 Score = 32.3 bits (70), Expect = 0.43 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXG 638 G G G R G G GG GG G G G G G G G G G Sbjct: 37 GSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRGIGGGGRGRGRIPAAFMGRGRGRGRG 94 Score = 31.9 bits (69), Expect = 0.57 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXG 656 G G G G G G GRG G G GG G G G G Sbjct: 27 GSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRGIGGGGRGRG 78 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -1 Query: 753 GGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG G G GG G G G GG GG G Sbjct: 5 GGGSGSSGSGSGGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRG 48 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 3/54 (5%) Frame = -1 Query: 774 GGGPXXXG---GGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG G GG G G GG G G G G G G G G Sbjct: 5 GGGSGSSGSGSGGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGG 58 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 G G GG G G GG GG G GG G GGG Sbjct: 12 GSGSGGSVSGGSGSGGSGSGG-SGSGGSGSGGRANGRGNGGRGSGRGGG 59 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 37.1 bits (82), Expect = 0.015 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 4/64 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXX----PPLPXXXXPPPPXPPXRXP 800 PPP P P P P P P PPP PP PPPP P Sbjct: 42 PPPPQVFVPEPLFSEPPPPPKAPVNVSLSPPPPPRSPSTSTPPRLGNRNPPPPASPSGQE 101 Query: 801 PPXP 812 P P Sbjct: 102 PTTP 105 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 +PPPP P P P PP P L+PPP PS Sbjct: 41 SPPPPQVF-VPEPLFSEPPPP--PKAPVNVSLSPPPPPRSPS 79 >At2g28670.1 68415.m03485 disease resistance-responsive family protein / fibroin-related contains similarity to silk fibroin heavy chain [Bombyx mori] gi|765323|gb|AAB31861; contains disease resistance response protien domain Pfam:FP03018 Length = 447 Score = 37.1 bits (82), Expect = 0.015 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGP G G GG GP GG GP G GGGG G Sbjct: 134 GGGP---GAGSALGGGAGAGPALGGGAGAGPALGGGAGAGSALGGGGAGAG 181 Score = 34.7 bits (76), Expect = 0.080 Identities = 26/79 (32%), Positives = 26/79 (32%), Gaps = 3/79 (3%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRG-GXXXGGGPG-GPXXGXG-GX 692 GG G G GG G G G G G GGG G GP G G G Sbjct: 110 GGGSGSLPTTGSATGAGAGTGSALGGGPGAGSALGGGAGAGPALGGGAGAGPALGGGAGA 169 Query: 691 XGAXGXXXXGXGXXXXXGG 635 A G G G GG Sbjct: 170 GSALGGGGAGAGPALGGGG 188 Score = 34.7 bits (76), Expect = 0.080 Identities = 26/78 (33%), Positives = 26/78 (33%), Gaps = 1/78 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPG-GPXXGXGGXXG 686 GG G A GGG G GGG G G GGG G GP G GG Sbjct: 135 GGPGAGSALGGGAGAGPALGGGAGAGPALGGG---AGAGSALGGGGAGAGPALGGGGAGA 191 Query: 685 AXGXXXXGXGXXXXXGGG 632 G GGG Sbjct: 192 GPALGGGVAGSGSALGGG 209 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPG-GXXXXXGGXXXGGGGGXXG 622 GGG G G GG GP GG G G G GGGG G Sbjct: 144 GGGA---GAGPALGGGAGAGPALGGGAGAGSALGGGGAGAGPALGGGGAGAG 192 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 6/52 (11%) Frame = -1 Query: 774 GGGPXXXGG---GXXXXGGGQGGPXXXGGXXXGPG---GXXXXXGGXXXGGG 637 G GP GG G GGG G GG G G G G GGG Sbjct: 158 GAGPALGGGAGAGSALGGGGAGAGPALGGGGAGAGPALGGGVAGSGSALGGG 209 >At4g08410.1 68417.m01390 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 707 Score = 36.7 bits (81), Expect = 0.020 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P PP P PPP P P PP P PP Sbjct: 452 PPPYVYSSPPPPYYSPSPKVDYKPPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSFPP 511 Query: 807 XPF 815 P+ Sbjct: 512 PPY 514 Score = 35.5 bits (78), Expect = 0.046 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 2/65 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 527 PPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYIYSSPP 586 Query: 807 XPFLA 821 P+ A Sbjct: 587 PPYYA 591 Score = 35.1 bits (77), Expect = 0.061 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 177 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 236 Query: 807 XPF 815 P+ Sbjct: 237 PPY 239 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 152 PPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 211 Query: 807 XPF 815 P+ Sbjct: 212 PPY 214 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 202 PPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 261 Query: 807 XPF 815 P+ Sbjct: 262 PPY 264 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 227 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPP 286 Query: 807 XPF 815 P+ Sbjct: 287 PPY 289 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 277 PPPYVYGSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPP 336 Query: 807 XPF 815 P+ Sbjct: 337 PPY 339 Score = 34.7 bits (76), Expect = 0.080 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 4/62 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXP-PLPXXXXPPPPXPPXRXP 800 PPP P P P PP P PPP P P PPPP P Sbjct: 327 PPPYVYGSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSTP 386 Query: 801 PP 806 PP Sbjct: 387 PP 388 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXX-PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPX 809 PP P P P P P PPP P P PPP P PP Sbjct: 428 PPYIYSSTPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKPPPPPYVYSSPPP 487 Query: 810 PF 815 P+ Sbjct: 488 PY 489 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 502 PPPYVYSFPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPP 561 Query: 807 XPF 815 P+ Sbjct: 562 PPY 564 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 577 PPPYIYSSPPPPYYAPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 636 Query: 807 XPF 815 P+ Sbjct: 637 PPY 639 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 602 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPP 661 Query: 807 XPF 815 P+ Sbjct: 662 PPY 664 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 127 PPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPP 186 Query: 807 XPF 815 P+ Sbjct: 187 PPY 189 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 4/62 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXP-PLPXXXXPPPPXPPXRXP 800 PPP P P P PP P PPP P P PPPP P Sbjct: 252 PPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYVYSSPP 311 Query: 801 PP 806 PP Sbjct: 312 PP 313 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 4/62 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXP-PLPXXXXPPPPXPPXRXP 800 PPP P P P PP P PPP P P PPPP P Sbjct: 302 PPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYVYSSPP 361 Query: 801 PP 806 PP Sbjct: 362 PP 363 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 552 PPPYVYSSPPPPYYSPSPKVEYKSPPPPYIYSSPPPPYYAPSPKVDYKSPPPPYVYSSPP 611 Query: 807 XPF 815 P+ Sbjct: 612 PPY 614 Score = 33.9 bits (74), Expect = 0.14 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP PP Sbjct: 352 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSTPPPYYSPSPKVDYKSPPPPYVYSSPP 411 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 412 PPYYSPSPKVDYKSPP--PP 429 Score = 33.9 bits (74), Expect = 0.14 Identities = 23/81 (28%), Positives = 25/81 (30%), Gaps = 4/81 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX----PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 PPP P +P PP P PPP P PPPP P Sbjct: 426 PPPPYIYSSTPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKPPPPPYVYSSP 485 Query: 801 PPXPFLAHXXXGXXXPPSXPP 863 PP + PP PP Sbjct: 486 PPPYYSPSPKVDYKSPP--PP 504 Score = 33.5 bits (73), Expect = 0.19 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 477 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSFPPPPYYSPSPKVDYKSPPPPYVYSSPP 536 Query: 807 XPF 815 P+ Sbjct: 537 PPY 539 Score = 32.3 bits (70), Expect = 0.43 Identities = 21/75 (28%), Positives = 23/75 (30%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 PP P P P PP PP P P P PP P PP P+ Sbjct: 110 PPPPYYSPSPKVDYKSLP--PPYVYSSPP---PPYYSPSPKVNYKSPPPPYVYSSPPPPY 164 Query: 816 LAHXXXGXXXPPSXP 860 + G P P Sbjct: 165 YSPSPKGDYKSPPPP 179 Score = 32.3 bits (70), Expect = 0.43 Identities = 22/79 (27%), Positives = 24/79 (30%), Gaps = 3/79 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P P P P P PP P P Sbjct: 402 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYIYSSTPLPYYSPS-PKVDYKSPPPPYVYSSP 460 Query: 804 PXPFLAHXXXGXXXPPSXP 860 P P+ + PP P Sbjct: 461 PPPYYSPSPKVDYKPPPPP 479 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 184 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPP 229 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 134 SPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPP 179 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 259 SPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPP 304 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 309 SPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPP 354 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 459 SPPPPYYSPSPKVDYKPPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 504 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 525 SPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSP 569 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 534 SPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPP 579 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 584 SPPPPYYAPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 629 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX--PPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 625 SPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSP 669 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/62 (27%), Positives = 18/62 (29%), Gaps = 1/62 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXX-PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPX 809 PP P P P P P PPP P P PP P P Sbjct: 378 PPYVYSSTPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYIYSSTPL 437 Query: 810 PF 815 P+ Sbjct: 438 PY 439 Score = 27.9 bits (59), Expect = 9.2 Identities = 17/63 (26%), Positives = 18/63 (28%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P P PP Sbjct: 627 PPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVDYKSSPPQYVYSSPP 686 Query: 807 XPF 815 P+ Sbjct: 687 TPY 689 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPPP PPP P + L PPP PP P Sbjct: 71 PSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPP 115 Score = 35.5 bits (78), Expect = 0.046 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 P P P PP P P PPPP PP PPP Sbjct: 68 PPSPSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPP 117 Score = 33.9 bits (74), Expect = 0.14 Identities = 20/71 (28%), Positives = 24/71 (33%) Frame = +2 Query: 575 VVXYTSXTNKSYXFXXPXXPPPPPXXXPPXXXXXPPGPXXXXXXXXXXXXXXXXXXXPPP 754 +V ++S + P P PPP PP PP PPP Sbjct: 52 LVHFSSKETPLHLHHNPPSPSPPP--PPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPP 109 Query: 755 XXXGPPPPXST 787 PPPP ST Sbjct: 110 PPPPPPPPSST 120 Score = 32.7 bits (71), Expect = 0.32 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 5/67 (7%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPP-----PPXPPXRXPPPXPFLAHXXXGXX 842 P +P PP P PP PP PP PP PPP P Sbjct: 68 PPSPSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPPSSTWDFWDPF 127 Query: 843 XPPSXPP 863 PP PP Sbjct: 128 IPP--PP 132 Score = 31.9 bits (69), Expect = 0.57 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 7/47 (14%) Frame = +1 Query: 637 PPXXXPPPXPXXXXPXPPXXP-------PXXXRAPLAPPPXXXPPSP 756 PP PPP P P PP P + + PPP PP P Sbjct: 68 PPSPSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPP 114 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 36.7 bits (81), Expect = 0.020 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 5/65 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXX----PXAPXXPPXPXXGPPGPPPXXXPPL-PXXXXPPPPXPPXRX 797 PPP P P P A PP P PP PPL P PP PP Sbjct: 166 PPPQVPVKPHPKVPVISPDPPATLPPPKVPVISPDPPTTLPPPLVPVINLPPVTSPPQFK 225 Query: 798 PPPXP 812 PP P Sbjct: 226 LPPLP 230 Score = 32.7 bits (71), Expect = 0.32 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 3/60 (5%) Frame = +3 Query: 633 PPPXXXXXPXPXXXX---PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P P P P P P P P PPP P PP Sbjct: 158 PPPQVPVMPPPQVPVKPHPKVPVISPDPPATLPPPKVPVISPDPPTTLPPPLVPVINLPP 217 Score = 32.3 bits (70), Expect = 0.43 Identities = 16/55 (29%), Positives = 19/55 (34%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXP 860 P P P PP P P PPP P + P P ++ PP P Sbjct: 141 PVQPSSFCPKPPTAPVMPPPQVPVMPPPQVPVKPHPKVPVISPDPPATLPPPKVP 195 Score = 31.9 bits (69), Expect = 0.57 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 6/54 (11%) Frame = +3 Query: 663 PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP------PXPPXRXPPP 806 P P P PP P P P P PPP P PP PPP Sbjct: 155 PVMPPPQVPVMPPPQVPVKPHPKVPVISPDPPATLPPPKVPVISPDPPTTLPPP 208 Score = 31.1 bits (67), Expect = 0.99 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 +P PP PPP P PP P + PP PP Sbjct: 182 SPDPPATLPPPKVPVISPDPPTTLPPPLVPVINLPPVTSPP 222 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/68 (27%), Positives = 21/68 (30%), Gaps = 2/68 (2%) Frame = +3 Query: 663 PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXP--PPPXPPXRXPPPXPFLAHXXXG 836 P P P P P P PP P P P P P PP P ++ Sbjct: 144 PSSFCPKPPTAPVMPPPQVPVMPPPQVPVKPHPKVPVISPDPPATLPPPKVPVISPDPPT 203 Query: 837 XXXPPSXP 860 PP P Sbjct: 204 TLPPPLVP 211 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 36.7 bits (81), Expect = 0.020 Identities = 23/78 (29%), Positives = 25/78 (32%), Gaps = 2/78 (2%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPL--PXXXXPPPPXPPXRXPPPX 809 PP P P P PP P PP PP+ P PP PP PP Sbjct: 94 PPPVVVRPPPIIRPPPVVYPPPIVRPPPITRPPIIIPPIQPPPVTTPPGLLPPITTPPGL 153 Query: 810 PFLAHXXXGXXXPPSXPP 863 G P + PP Sbjct: 154 LPPVTTPPGLLPPVTTPP 171 Score = 36.7 bits (81), Expect = 0.020 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 3/60 (5%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGP-PPXXXPP--LPXXXXPPPPXPPXRXPP 803 PPP P P PP P PPG PP PP LP PP PP PP Sbjct: 113 PPPIVRPPPITRPPIIIPPIQPP-PVTTPPGLLPPITTPPGLLPPVTTPPGLLPPVTTPP 171 Score = 35.1 bits (77), Expect = 0.061 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P PPP PPP PP PP P PP PP Sbjct: 109 PVVYPPPIVRPPPITRPPIIIPPIQPPPVTTPPGLLPPITTPP 151 Score = 34.7 bits (76), Expect = 0.080 Identities = 22/64 (34%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = +3 Query: 678 PXAPXXPPXPXXGPP--GPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPP 851 P PP PP PPP PP P PP PP PP P G P Sbjct: 89 PPVVRPPPVVVRPPPIIRPPPVVYPP-PIVRPPPITRPPIIIPPIQPPPVTTPPGLLPPI 147 Query: 852 SXPP 863 + PP Sbjct: 148 TTPP 151 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +1 Query: 634 PPPXXXPPPX--PXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 PPP PPP P PP P P+ PPP PP Sbjct: 101 PPPIIRPPPVVYPPPIVRPPPITRPPIIIPPIQPPPVTTPP 141 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGP 713 GG GG P KG G GG GGG G GG GGG P Sbjct: 44 GGGGGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGG---GGGKSPP 90 Score = 33.1 bits (72), Expect = 0.25 Identities = 27/83 (32%), Positives = 28/83 (33%), Gaps = 6/83 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPX---PXXGPPGP-PPXXXPP--LPXXXXPPPPXPPXR 794 PPP P PP P PPG PP PP LP PP PP Sbjct: 119 PPPITRPPIIIPPIQPPPVTTPPGLLPPITTPPGLLPPVTTPPGLLPPVTTPPGLLPPII 178 Query: 795 XPPPXPFLAHXXXGXXXPPSXPP 863 PPP + PP PP Sbjct: 179 NPPP---VTVPPPSSGYPPYGPP 198 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P PPP PP P P PP P+ PP PP Sbjct: 90 PVVRPPPVVVRPP-PIIRPPPVVYPPPIVRPPPITRPPIIIPP 131 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P PPP PP P PP P P+ PP PP Sbjct: 115 PIVRPPPITRPPIIIPPIQP-PPVTTPPGLLPPITTPPGLLPP 156 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 787 GGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXG 656 GG GGG GG GGG P G GG G G G Sbjct: 45 GGGGGGSKPPPHHGG--KGGGKPPPHGGKGGGPPHHGGGGGGGG 86 Score = 28.7 bits (61), Expect = 5.3 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -1 Query: 765 PXXXGGGXXXXGGGQGGPXXXGGXXXG-PGGXXXXXGGXXXGGGGGXXG 622 P GGG GGG P GG G P GG GGGG G Sbjct: 40 PPQHGGGG---GGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGG 85 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/46 (32%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +1 Query: 622 PXTPPPPXXXP---PPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P PPP P PP PP P P+ PP PP Sbjct: 131 PIQPPPVTTPPGLLPPITTPPGLLPPVTTPPGLLPPVTTPPGLLPP 176 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P T PP P P P P PP + PPP PP Sbjct: 146 PITTPPGLLPPVTTPPGLLP-PVTTPPGLLPPIINPPPVTVPP 187 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = +1 Query: 622 PXTPPPPXXXPP--PXPXXXXP--XPPXXPPXXXRAPLAPPPXXXPP 750 P PP PP P P P PP P P+ PP PP Sbjct: 120 PPITRPPIIIPPIQPPPVTTPPGLLPPITTPPGLLPPVTTPPGLLPP 166 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 36.7 bits (81), Expect = 0.020 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 TPPPP P P P PP P P PPP Sbjct: 242 TPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPP 277 Score = 35.9 bits (79), Expect = 0.035 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXR 794 P P PP P PPP P L PPP PP + Sbjct: 243 PPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPPLK 281 Score = 35.1 bits (77), Expect = 0.061 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSPXXG 765 TPPPP PPP P PP PP A L+ PP G Sbjct: 258 TPPPP---PPPKLKNNGPSPPPPPPLKKTAALSSSASKKPPPAPRG 300 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = +3 Query: 699 PXPXXGPPGPPPXXXPPLPXXXXPPPPXPP-----XRXPPPXP 812 P P PP PPP P+ PPPP PP PPP P Sbjct: 239 PDPTPPPPPPPPI---PVKQSATPPPPPPPKLKNNGPSPPPPP 278 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/59 (30%), Positives = 19/59 (32%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PP P P P PP P GP P PP P + PPP P Sbjct: 243 PPPPPPPPIPVKQSA-TPPPPPPPKLKNNGPSPP--PPPPLKKTAALSSSASKKPPPAP 298 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGG 716 GGG GG GGGG G GG G G GG Sbjct: 187 GGGGSFGGGGGGGAGSYGGGGAGAGSGGGG 216 Score = 31.5 bits (68), Expect = 0.75 Identities = 19/53 (35%), Positives = 21/53 (39%) Frame = -3 Query: 853 EGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGG 695 +G P R+G G G GGGG G G GGG G G GG Sbjct: 168 KGKKSLPSFDQGRQGSRYGGGGGSFGGGG---GGGAGSYGGGGAGAGSGGGGG 217 Score = 29.9 bits (64), Expect = 2.3 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = -1 Query: 783 EXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 + G G GGG GGG GG GG G G GGGGG Sbjct: 177 DQGRQGSRYGGGGGSFGGGGGGGAGSYGGGGAGAGS----------GGGGG 217 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 36.3 bits (80), Expect = 0.026 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -3 Query: 811 GXGGGXRXGGXG--GGGXXXXGRGGXXXGGGPGG 716 G GGG GG G GGG G GG GGG GG Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGG 155 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = -3 Query: 820 ARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGG 695 A + GGG G GGGG G G GGG GG G GG Sbjct: 117 APRAYGGGGGYSG-GGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 33.9 bits (74), Expect = 0.14 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 765 PXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGG 634 P GGG GGG G GG G GG GG GGGG Sbjct: 118 PRAYGGGGGYSGGGGG----YGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 32.3 bits (70), Expect = 0.43 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQ-GGPXXXGGXXXGPGG 676 GGGG GGG GGG GG GG G GG Sbjct: 123 GGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -3 Query: 778 GGGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 GGGG G GG GGG GG G GG G Sbjct: 122 GGGGGYSGGGGG--YGGGGGGYGGGGGGYGG 150 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 778 GGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXG 677 GGGG G G GGG GG G GG G Sbjct: 123 GGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -1 Query: 753 GGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGG GGG GG GG G GG GG GGGG Sbjct: 124 GGGYSGGGGGYGG----GGGGYGGGGGGYGGGG---DGGGG 157 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 36.3 bits (80), Expect = 0.026 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PP P P PP GP PPP PP P PP PPP Sbjct: 264 PPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPPPYGAPPQNNMGGPRPPQNYGGTPPP 321 Score = 34.7 bits (76), Expect = 0.080 Identities = 23/75 (30%), Positives = 24/75 (32%), Gaps = 2/75 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP--XPPXRXPPP 806 PPP P PP P G PPP P + PPPP R PPP Sbjct: 241 PPPQRPPMGGPPPPPHIGGSAPPPPHMGGSAPPP---PHMGQNYGPPPPNNMGGPRHPPP 297 Query: 807 XPFLAHXXXGXXXPP 851 G PP Sbjct: 298 YGAPPQNNMGGPRPP 312 Score = 31.1 bits (67), Expect = 0.99 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +1 Query: 631 PPPPXXX---PPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSPXXG 765 PPPP PPP PP PP P PPP PP G Sbjct: 262 PPPPHMGGSAPPPPHMGQNYGPP--PPNNMGGPRHPPPYGAPPQNNMG 307 >At3g05220.2 68416.m00570 heavy-metal-associated domain-containing protein similar to farnesylated protein 1 (GI:23304411) {Hordeum vulgare subsp. spontaneum}; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 478 Score = 36.3 bits (80), Expect = 0.026 Identities = 23/63 (36%), Positives = 25/63 (39%), Gaps = 2/63 (3%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGP--XXGXGGXXG 686 G GG + KG GGG G G G+GG GPGGP G GG G Sbjct: 305 GGGGGGNKGNHNHSAKGIGGGPMGPGGPMGPGGPMGQGGPMGMMGPGGPMSMMGPGGPMG 364 Query: 685 AXG 677 G Sbjct: 365 PMG 367 Score = 34.3 bits (75), Expect = 0.11 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 2/64 (3%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGG--GPGGPXXGXGGXX 689 GG GG KG GGG G G G GG GPGGP G GG Sbjct: 288 GGGHGGLDIDELMKHSKGGGGGGNKGNHNHSAKGIGG-GPMGPGGPMGPGGP-MGQGGPM 345 Query: 688 GAXG 677 G G Sbjct: 346 GMMG 349 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGGG G G GGP GG GPGG G G GG Sbjct: 305 GGGGGGNKGNHNHSAKGIGGGPMGPGGPM-GPGGPMGQGGPMGMMGPGG 352 Score = 30.3 bits (65), Expect = 1.7 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 4/53 (7%) Frame = -1 Query: 777 GGGGPXXXGG--GXXXXGGGQG--GPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 G GGP GG G GG GP G G GG G GGGG Sbjct: 334 GPGGPMGQGGPMGMMGPGGPMSMMGPGGPMGPMGGQGGSYPAVQGLPMSGGGG 386 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = -3 Query: 811 GXGGGXRXGGX--GGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 G GG GG GG G GG GPGGP GG G+ Sbjct: 328 GPGGPMGPGGPMGQGGPMGMMGPGGPMSMMGPGGPMGPMGGQGGS 372 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = -1 Query: 720 GGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXGXXXIYDLLV 595 GG GG GP G GGGGG G +++ V Sbjct: 145 GGHHGNGGGPKGPNEIMMMMNGFKGGGGGGKKGGGGGFEIPV 186 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -1 Query: 753 GGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG G GG GPGG G GG G G Sbjct: 306 GGGGGNKGNHNHSAKGIGGGPMGPGGPMGPGGPMGQGGPMGMMG 349 >At3g05220.1 68416.m00569 heavy-metal-associated domain-containing protein similar to farnesylated protein 1 (GI:23304411) {Hordeum vulgare subsp. spontaneum}; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 577 Score = 36.3 bits (80), Expect = 0.026 Identities = 23/63 (36%), Positives = 25/63 (39%), Gaps = 2/63 (3%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGP--XXGXGGXXG 686 G GG + KG GGG G G G+GG GPGGP G GG G Sbjct: 404 GGGGGGNKGNHNHSAKGIGGGPMGPGGPMGPGGPMGQGGPMGMMGPGGPMSMMGPGGPMG 463 Query: 685 AXG 677 G Sbjct: 464 PMG 466 Score = 34.3 bits (75), Expect = 0.11 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 2/64 (3%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGG--GPGGPXXGXGGXX 689 GG GG KG GGG G G G GG GPGGP G GG Sbjct: 387 GGGHGGLDIDELMKHSKGGGGGGNKGNHNHSAKGIGG-GPMGPGGPMGPGGP-MGQGGPM 444 Query: 688 GAXG 677 G G Sbjct: 445 GMMG 448 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGGG G G GGP GG GPGG G G GG Sbjct: 404 GGGGGGNKGNHNHSAKGIGGGPMGPGGPM-GPGGPMGQGGPMGMMGPGG 451 Score = 30.3 bits (65), Expect = 1.7 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 4/53 (7%) Frame = -1 Query: 777 GGGGPXXXGG--GXXXXGGGQG--GPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 G GGP GG G GG GP G G GG G GGGG Sbjct: 433 GPGGPMGQGGPMGMMGPGGPMSMMGPGGPMGPMGGQGGSYPAVQGLPMSGGGG 485 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = -3 Query: 811 GXGGGXRXGGX--GGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 G GG GG GG G GG GPGGP GG G+ Sbjct: 427 GPGGPMGPGGPMGQGGPMGMMGPGGPMSMMGPGGPMGPMGGQGGS 471 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = -1 Query: 720 GGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXGXXXIYDLLV 595 GG GG GP G GGGGG G +++ V Sbjct: 244 GGHHGNGGGPKGPNEIMMMMNGFKGGGGGGKKGGGGGFEIPV 285 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -1 Query: 753 GGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG G GG GPGG G GG G G Sbjct: 405 GGGGGNKGNHNHSAKGIGGGPMGPGGPMGPGGPMGQGGPMGMMG 448 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 36.3 bits (80), Expect = 0.026 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PP P P P P P P P PP PP+ PPPP PP Sbjct: 50 PPLSEPSTPPPDSQLPPLPSILP-PLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPP 106 Score = 34.7 bits (76), Expect = 0.080 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P PP PP PP P PP P P Sbjct: 58 PPPDSQLPPLPSILPPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAP 115 Score = 33.9 bits (74), Expect = 0.14 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 7/59 (11%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXXGPPGP--PPXXXPPLPXXXXP---PPPXP--PXRXPPPXP 812 P P P P P GP P PP PP P P PP P P PP P Sbjct: 124 PPPSQDLQSPPPSSPSPNVGPTNPESPPLQSPPAPPASDPTNSPPASPLDPTNPPPIQP 182 Score = 33.5 bits (73), Expect = 0.19 Identities = 23/75 (30%), Positives = 25/75 (33%), Gaps = 3/75 (4%) Frame = +3 Query: 591 LXPINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXP 770 L P+ I PPP P P P P PP P P PP P Sbjct: 64 LPPLPSILPPLTDSPPPPSDSSP-PVDSTPSPP--PPTSNESPSPPEDSETPPAPPNESN 120 Query: 771 ---PPPXPPXRXPPP 806 PPP + PPP Sbjct: 121 DNNPPPSQDLQSPPP 135 Score = 32.3 bits (70), Expect = 0.43 Identities = 25/81 (30%), Positives = 26/81 (32%), Gaps = 4/81 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXP--PLPXXXXPPPP--XPPXRXP 800 PPP P P PP P PP P P P PP P PP Sbjct: 21 PPPET---PSENSALPPVDSSPPSPPADSSSTPPLSEPSTPPPDSQLPPLPSILPPLTDS 77 Query: 801 PPXPFLAHXXXGXXXPPSXPP 863 PP P + PS PP Sbjct: 78 PPPP--SDSSPPVDSTPSPPP 96 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/49 (32%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPX-PPXXPPXXXRAPLAPPPXXXPPSPXXG 765 P PP P P P P PP AP +P P P +P G Sbjct: 163 PTNSPPASPLDPTNPPPIQPSGPATSPPANPNAPPSPFPTVPPKTPSSG 211 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 705 PXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 P PP PP PP P PP PP P PS PP Sbjct: 8 PSSSPPAPPADTAPP-PETPSENSALPPVDSSPPSPPADSSSTPPLSEPSTPP 59 Score = 30.3 bits (65), Expect = 1.7 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 7/67 (10%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXP-------PXPXXGPPGPPPXXXPPLPXXXXPPPPXPPX 791 PPP P P P P P P PPP P P P PP Sbjct: 95 PPPTSNESPSPPEDSETPPAPPNESNDNNPPPSQDLQSPPP--SSPSPNVGPTNPESPPL 152 Query: 792 RXPPPXP 812 + PP P Sbjct: 153 QSPPAPP 159 Score = 29.5 bits (63), Expect = 3.0 Identities = 20/69 (28%), Positives = 20/69 (28%), Gaps = 9/69 (13%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAP-----XXPPXPXXGPPGPP----PXXXPPLPXXXXPPPPXP 785 PPP P P P PP PP PP PP PPP P Sbjct: 79 PPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPNESNDNNPPPSQDLQSPPPSSP 138 Query: 786 PXRXPPPXP 812 P P Sbjct: 139 SPNVGPTNP 147 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 6/51 (11%) Frame = +1 Query: 622 PXTPPPPXXXPP-----PXPXXXXPXPPXXPPXXXRAPLAPPP-XXXPPSP 756 P TPPP PP P P P P P PPP PSP Sbjct: 55 PSTPPPDSQLPPLPSILPPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSP 105 Score = 28.7 bits (61), Expect = 5.3 Identities = 20/73 (27%), Positives = 21/73 (28%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 PP P P P PP PP P P P PP PP P Sbjct: 12 PPAPPADTAPPPETPSENSALPPVDSSPPS-PPADSSSTPPLSEPSTP-PPDSQLPPLPS 69 Query: 816 LAHXXXGXXXPPS 854 + PPS Sbjct: 70 ILPPLTDSPPPPS 82 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 2/44 (4%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP--XXXPPSP 756 P PP P P P PP P PP PPSP Sbjct: 156 PAPPASDPTNSPPASPLDPTNPPPIQPSGPATSPPANPNAPPSP 199 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/47 (31%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAP--PPXXXPPSP 756 P PP P P PP P P P PP PP+P Sbjct: 112 PPAPPNESNDNNPPPSQDLQSPPPSSPSPNVGPTNPESPPLQSPPAP 158 >At5g28480.1 68418.m03462 hypothetical protein Length = 1230 Score = 35.9 bits (79), Expect = 0.035 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 2/61 (3%) Frame = -3 Query: 853 EGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGP--XXGXGGXXGAX 680 + G P G GG GG GG G GG G G GGP G GG GA Sbjct: 415 DDGEGGPSGGDGEGGPSGGDGEGGPSGG----DGEGGPSGGDGEGGPNGADGEGGPNGAD 470 Query: 679 G 677 G Sbjct: 471 G 471 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/55 (36%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = -1 Query: 783 EXGGGGPXXXGG-GXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 + G GGP G G G G+GGP G GP G G G GG G Sbjct: 415 DDGEGGPSGGDGEGGPSGGDGEGGP-SGGDGEGGPSGGDGEGGPNGADGEGGPNG 468 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -3 Query: 775 GGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 GG G GG G G GGP G G + G G GG Sbjct: 419 GGPSGGDGEGGPSGGDGEGGPSGGDGEGGPSGGDGEGGPNGADGEGG 465 Score = 28.3 bits (60), Expect = 7.0 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXXGG-GXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GGP G G G G+GGP GG G GG G G G G Sbjct: 426 GEGGPSGGDGEGGPSGGDGEGGP--SGG--DGEGGPNGADGEGGPNGADGEVG 474 >At2g12100.1 68415.m01300 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At5g28270, At2g05450, At1g45090, At2g16180, At2g06750 Length = 1224 Score = 35.9 bits (79), Expect = 0.035 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 2/61 (3%) Frame = -3 Query: 853 EGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGP--XXGXGGXXGAX 680 + G P G GG GG GG G GG G G GGP G GG GA Sbjct: 428 DDGEGGPSGGDGEGGPSGGDGEGGPSGG----DGEGGPSGGDGEGGPNGADGEGGPNGAD 483 Query: 679 G 677 G Sbjct: 484 G 484 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/55 (36%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = -1 Query: 783 EXGGGGPXXXGG-GXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 + G GGP G G G G+GGP G GP G G G GG G Sbjct: 428 DDGEGGPSGGDGEGGPSGGDGEGGP-SGGDGEGGPSGGDGEGGPNGADGEGGPNG 481 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -3 Query: 775 GGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 GG G GG G G GGP G G + G G GG Sbjct: 432 GGPSGGDGEGGPSGGDGEGGPSGGDGEGGPSGGDGEGGPNGADGEGG 478 Score = 28.3 bits (60), Expect = 7.0 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXXGG-GXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GGP G G G G+GGP GG G GG G G G G Sbjct: 439 GEGGPSGGDGEGGPSGGDGEGGP--SGG--DGEGGPNGADGEGGPNGADGEVG 487 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 35.9 bits (79), Expect = 0.035 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Frame = -1 Query: 774 GGGPXXXGG-----GXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGG 634 GGG GG G GGG GG GG G GG G GGGG Sbjct: 143 GGGAGGYGGNSSYSGNAGGGGGYGGNSSYGGNAGGYGGNPPYSGNAVGGGGG 194 Score = 35.1 bits (77), Expect = 0.061 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGP-XXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG G GGG GG G P GG G GG G GGGGG G Sbjct: 117 GGRGFGGPGGGYGASDGGYGAPAGGYGGGAGGYGGNSSYSGN--AGGGGGYGG 167 Score = 33.1 bits (72), Expect = 0.25 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = -3 Query: 814 KGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXG 656 +G G G R G GGG G GG GG G GG G G G Sbjct: 112 RGSGFGGRGFGGPGGGYGASDGGYGAPAGGYGGGAGGYGGNSSYSGNAGGGGG 164 Score = 32.7 bits (71), Expect = 0.32 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGG-GXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 GG G G GG GG GG G G GGG G G GG G Sbjct: 147 GGYGGNSSYSGNAGGGGGYGGNSSYGGNAGGYGGNPPYSGNAVGGGGGYGSNFGGGGGYG 206 Query: 685 AXG 677 G Sbjct: 207 VAG 209 Score = 31.1 bits (67), Expect = 0.99 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGG-PXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG GG GG P G G GG GG GGG G G Sbjct: 160 GGGGGYGGNSSYGGNAGGYGGNPPYSGNAVGGGGGYGSNFGG---GGGYGVAG 209 Score = 30.7 bits (66), Expect = 1.3 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -3 Query: 799 GXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 G GG G GG G G GG G P G GG G G G GG Sbjct: 113 GSGFGGRGFGG---PGGGYGASDGGYGAPAGGYGGGAGGYGGNSSYSGNAGGGGG 164 Score = 29.5 bits (63), Expect = 3.0 Identities = 24/82 (29%), Positives = 26/82 (31%), Gaps = 6/82 (7%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRX---GGXGGGGXXXXGRGGXXXGGGPGG--PXXGXG 698 G +GG P + G G G GGGG GG GG P G Sbjct: 129 GASDGGYGAPAGGYGGGAGGYGGNSSYSGNAGGGGGYGGNSSYGGNAGGYGGNPPYSGNA 188 Query: 697 -GXXGAXGXXXXGXGXXXXXGG 635 G G G G G GG Sbjct: 189 VGGGGGYGSNFGGGGGYGVAGG 210 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = -1 Query: 771 GGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXGXXXIY 607 GG GG GG GG G G GG G GG G G Y Sbjct: 133 GGYGAPAGGYGGGAGGYGGNSSYSGNAGGGGG---YGGNSSYGGNAGGYGGNPPY 184 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 35.9 bits (79), Expect = 0.035 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 717 PPGPPPXXXPPLPXXXXPPPPXPP 788 PP PPP PP P PPPP PP Sbjct: 93 PPSPPPPSPPP-PSQACPPPPLPP 115 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/52 (32%), Positives = 19/52 (36%) Frame = +3 Query: 663 PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFL 818 P P PP P PP PPP P P PP PPP ++ Sbjct: 81 PIKCTPCLQNIPP-PSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPPPSTYI 131 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 PP P PP P P PP P ++ PPP Sbjct: 93 PPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPPP 127 Score = 32.7 bits (71), Expect = 0.32 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 PPP P P P PP PP + PPP Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPP 126 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 687 PXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 P PP P P PP PP PPP PP Sbjct: 98 PPSPPPPSQACPPPPLPPSPPKKSYCPPPPSTYIYMTGPP 137 >At1g45090.1 68414.m05169 Ulp1 protease family protein similar to At5g28270, At2g12100, At2g05450, At2g16180, At2g06750; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 1210 Score = 35.9 bits (79), Expect = 0.035 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 2/61 (3%) Frame = -3 Query: 853 EGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGP--XXGXGGXXGAX 680 + G P G GG GG GG G GG G G GGP G GG GA Sbjct: 419 DDGEGGPSGGDGEGGPSGGDGEGGPSGG----DGEGGPSGGDGEGGPNGADGEGGPNGAD 474 Query: 679 G 677 G Sbjct: 475 G 475 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/55 (36%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = -1 Query: 783 EXGGGGPXXXGG-GXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 + G GGP G G G G+GGP G GP G G G GG G Sbjct: 419 DDGEGGPSGGDGEGGPSGGDGEGGP-SGGDGEGGPSGGDGEGGPNGADGEGGPNG 472 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -3 Query: 775 GGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 GG G GG G G GGP G G + G G GG Sbjct: 423 GGPSGGDGEGGPSGGDGEGGPSGGDGEGGPSGGDGEGGPNGADGEGG 469 Score = 28.3 bits (60), Expect = 7.0 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXXGG-GXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GGP G G G G+GGP GG G GG G G G G Sbjct: 430 GEGGPSGGDGEGGPSGGDGEGGP--SGG--DGEGGPNGADGEGGPNGADGEVG 478 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 35.9 bits (79), Expect = 0.035 Identities = 23/73 (31%), Positives = 25/73 (34%), Gaps = 4/73 (5%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRX----GGXGGGGXXXXGRGGXXXGGGPGGPXXGXGG 695 GG G W G G + GG GGGG G+G GGG G G GG Sbjct: 371 GGDAGAITQVMQGWGGGGAGAVTQVMQGCGGGGGGGDGGGGQGTGIGGGGGGEQGTGVGG 430 Query: 694 XXGAXGXXXXGXG 656 G G Sbjct: 431 GGDTCTQVTHGGG 443 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGG 634 GGGG GGG GG GG G GG G GGGG Sbjct: 385 GGGGAGAVTQVMQGCGGGGGGGDGGGGQGTGIGGGGGGEQGTGVGGGG 432 Score = 33.9 bits (74), Expect = 0.14 Identities = 28/82 (34%), Positives = 30/82 (36%), Gaps = 5/82 (6%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXG--RGGXXXGGGPGGPXXGXGGX- 692 GG GG G GGG + G GGGG GG GG P G GG Sbjct: 401 GGGGGGDGGGGQGTGIGGGGGGEQGTGVGGGGDTCTQVTHGG---GGAPLTMIGGGGGEQ 457 Query: 691 --XGAXGXXXXGXGXXXXXGGG 632 G+ G G G GGG Sbjct: 458 GVTGSDGGGGRGRGGGKVAGGG 479 Score = 33.1 bits (72), Expect = 0.25 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -3 Query: 784 GXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G GGGG GRGG GG GG G+ G G GG Sbjct: 271 GRGGGGDKTNGRGGEGREEDNGGGRGAEGGGRGSTGEGVTDGGGRTGNKGG 321 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -3 Query: 814 KGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGG 695 + GGG R G GGG G GG GG GG Sbjct: 59 RSKGGGRRKTGDGGGDPVVISGGENHASGGMGGTSATRGG 98 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXGXXXI 610 GGGG G G GG G G G GG G GG G I Sbjct: 273 GGGGDKTNGRGGEGREEDNGGGRGAEGGGRGSTGEGVTDGGGRTGNKGGNGGSIKI 328 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGG P GG GG GG G GG G GGG Sbjct: 71 GGGDPVVISGGENHASGGMGGT----SATRGGGGEPVIPGAPPPNRGGG 115 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -3 Query: 802 GGXRXGGXGG-GGXXXXGRGGXXXGGGPGGPXXGXG 698 GG R G GG GG G G GG GG G G Sbjct: 312 GGGRTGNKGGNGGSIKIGVGTNGITGGTGGGEAGAG 347 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = -1 Query: 765 PXXXGGGXXXXG-GGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGG 634 P GGG G GG+G GG GG G GGG Sbjct: 270 PGRGGGGDKTNGRGGEGREEDNGGGRGAEGGGRGSTGEGVTDGGG 314 Score = 28.3 bits (60), Expect = 7.0 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 8/57 (14%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXG--------GGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGGG G G G GG G P G G G GG G GGG Sbjct: 417 GGGGGGEQGTGVGGGGDTCTQVTHGGGGAPLTMIGGGGGEQGVTGSDGGGGRGRGGG 473 >At4g22740.2 68417.m03281 glycine-rich protein Length = 356 Score = 35.5 bits (78), Expect = 0.046 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGP 713 G G G GG GGG GRG GGP GP Sbjct: 11 GGGFGGPFGGFGGGSFGGFGRGSFGGFGGPNGP 43 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 753 GGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GGP G GG G GG GG G Sbjct: 4 GGGRDPFGGGFGGPFGGFG-----GGSFGGFGRGSFGGFGGPNG 42 >At4g22740.1 68417.m03280 glycine-rich protein Length = 356 Score = 35.5 bits (78), Expect = 0.046 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGP 713 G G G GG GGG GRG GGP GP Sbjct: 11 GGGFGGPFGGFGGGSFGGFGRGSFGGFGGPNGP 43 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 753 GGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GGP G GG G GG GG G Sbjct: 4 GGGRDPFGGGFGGPFGGFG-----GGSFGGFGRGSFGGFGGPNG 42 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 35.5 bits (78), Expect = 0.046 Identities = 28/70 (40%), Positives = 28/70 (40%), Gaps = 1/70 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGG-PGGPXXGXGGXXG 686 GG GG P G GG GG GGG G G GGG P G G GG G Sbjct: 314 GGMPGGF--PGGMGGMGGMPGGF-PGGMGGGMPAGMGGGMPGMGGGMPAG--MGGGGMPG 368 Query: 685 AXGXXXXGXG 656 A G G G Sbjct: 369 AGGGMPGGGG 378 Score = 33.9 bits (74), Expect = 0.14 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 2/60 (3%) Frame = -3 Query: 805 GGGXRXGGXGG--GGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 GGG G GG GG GG GG PGG G GG G G G G G G Sbjct: 290 GGGFPGGMPGGFPGGMPGGFPGGM--GGMPGGFPGGMGGMGGMPGGFPGGMGGGMPAGMG 347 Score = 33.1 bits (72), Expect = 0.25 Identities = 26/77 (33%), Positives = 26/77 (33%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG G GG GG GG G G GG PGG G G Sbjct: 291 GGFPGGMPGGFPGGMPGGFPGGM--GGMPGGFPGGMGGMGGMPGGFPGGMGGGMPAGMGG 348 Query: 682 XGXXXXGXGXXXXXGGG 632 G G G GGG Sbjct: 349 -GMPGMGGGMPAGMGGG 364 Score = 32.7 bits (71), Expect = 0.32 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGG 716 G GG G GGG G GGGG G G GG PGG Sbjct: 336 GGMGGGMPAGMGGGMPGMGGGM-PAGMGGGGMPGAGGGMPGGGGMPGG 382 Score = 32.7 bits (71), Expect = 0.32 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXG 643 GGG P GGG GGG GG G GG GG G Sbjct: 339 GGGMPAGMGGGMPGMGGGMPA-GMGGGGMPGAGGGMPGGGGMPGG 382 Score = 31.9 bits (69), Expect = 0.57 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = -1 Query: 771 GGPXXXGGGXXXXGGGQGG--PXXXGGXXXGPGGXXXXX--GGXXXGGGGGXXG 622 GG GG GG GG P GG G GG GG G GGG G Sbjct: 322 GGMGGMGGMPGGFPGGMGGGMPAGMGGGMPGMGGGMPAGMGGGGMPGAGGGMPG 375 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 35.5 bits (78), Expect = 0.046 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 PPP P P PP P PP PPP P L PPP Sbjct: 10 PPPLPPRLELRRQRAPP-PQPPPPPPPPPPPPPPRLGPRLRLRLLPPP 56 Score = 33.9 bits (74), Expect = 0.14 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 P P P PPP PP P PPPP PP R P Sbjct: 9 PPPPLPPRLELRRQRAPPPQPPPPPP----PPPPPPPPRLGP 46 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +3 Query: 726 PPPXXXPP---LPXXXXPPPPXPPXRXPPPXP 812 PPP PP L PPP PP PPP P Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPPPPP 39 Score = 31.9 bits (69), Expect = 0.57 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 T PPP PP PP PP P PPP P Sbjct: 6 TIPPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPPPRLGP 46 Score = 31.9 bits (69), Expect = 0.57 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP 779 PPP P PP P PP PPP P PPP Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPPPRLGPRLRLRLLPPP 56 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 P PPPP PPP P PP P R L PPP Sbjct: 26 PPQPPPPPPPPPP------PPPPRLGP-RLRLRLLPPP 56 >At3g32400.1 68416.m04142 formin homology 2 domain-containing protein / FH2 domain-containing protein common family members: At2g43800, At3g25500, At5g48360, At4g15200, At3g05470, At3g07540, At5g07780, At5g07650 [Arabidopsis thaliana]; Length = 488 Score = 35.5 bits (78), Expect = 0.046 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P PPPP P P PP PP A PP PP Sbjct: 13 PPPPPPPLLQPHHSALSSSPLPPPLPPKKLLATTNTPPPPPPP 55 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 35.5 bits (78), Expect = 0.046 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P PPPP P PP PP A PPP PP Sbjct: 602 PPPPPPPPLQSHRSALSSSPLPPPLPPKKLLATTNPPPPPPPP 644 Score = 33.5 bits (73), Expect = 0.19 Identities = 23/84 (27%), Positives = 24/84 (28%), Gaps = 7/84 (8%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP-------XPPX 791 PPP P P PP PPP PPL P PP Sbjct: 606 PPPPLQSHRSALSSSPLPPPLPPKKLLATTNPPPPPPPPLHSNSRMGAPTSSLVLKSPPV 665 Query: 792 RXPPPXPFLAHXXXGXXXPPSXPP 863 PP L+ G P PP Sbjct: 666 PPPPAPAPLSRSHNGNIPPVPGPP 689 Score = 28.7 bits (61), Expect = 5.3 Identities = 19/71 (26%), Positives = 19/71 (26%), Gaps = 4/71 (5%) Frame = +3 Query: 663 PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPP----XRXPPPXPFLAHXX 830 P P PP P PL PPPP PP P P Sbjct: 536 PQSPTPVHSNGPPSAEAAVTSSPLPPLKPLRILSRPPPPPPPPPISSLRSTPSPSSTSNS 595 Query: 831 XGXXXPPSXPP 863 PP PP Sbjct: 596 IATQGPPPPPP 606 Score = 28.3 bits (60), Expect = 7.0 Identities = 23/73 (31%), Positives = 25/73 (34%), Gaps = 13/73 (17%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXX--GPPGPPPXXXPPLPXXXXP------PPPXPP 788 PPP P +P GPP PPP PPL PPP PP Sbjct: 571 PPPPPPPPPISSLRSTPSPSSTSNSIATQGPPPPPPP--PPLQSHRSALSSSPLPPPLPP 628 Query: 789 XR-----XPPPXP 812 + PPP P Sbjct: 629 KKLLATTNPPPPP 641 >At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi domain-containing protein similar to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}, SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1013 Score = 35.5 bits (78), Expect = 0.046 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -3 Query: 787 GGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 GG GG GRGG GGG GG G G G G G GGG Sbjct: 4 GGYRGGRGDGRGRGGRGYGGGGGG---GEQGRDRGYGGGEQGRGRGSERGGG 52 Score = 28.3 bits (60), Expect = 7.0 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 5/53 (9%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXG-----GGGXXXXGRGGXXXGGGPG 719 GG GG R G GGG G G GGG GRG GG G Sbjct: 4 GGYRGGRGDGRGRGGR-GYGGGGGGGEQGRDRGYGGGEQGRGRGSERGGGNRG 55 >At1g11130.1 68414.m01274 leucine-rich repeat family protein / protein kinase family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to leucine-rich repeat transmembrane protein kinase 2 [Zea mays] gi|3360291|gb|AAC27895 Length = 768 Score = 35.5 bits (78), Expect = 0.046 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +3 Query: 717 PPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF--LAHXXXGXXXPPSXP 860 PP PP PP P P PP PP PF A PPS P Sbjct: 249 PPPPPVVDPPPATHRAPPVPRIPPVSGVPPAPFAPFAPLQPQQHPPPSPP 298 Score = 35.1 bits (77), Expect = 0.061 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 6/48 (12%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXP----PXXXRAPLAP--PPXXXPPSP 756 PPPP PPP P P P P AP AP P PPSP Sbjct: 250 PPPPVVDPPPATHRAPPVPRIPPVSGVPPAPFAPFAPLQPQQHPPPSP 297 Score = 33.1 bits (72), Expect = 0.25 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Frame = +3 Query: 633 PPPXXXXXPXP-XXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P PP PP P P P PPP PP PP Sbjct: 249 PPPPPVVDPPPATHRAPPVPRIPPVSGV-PPAPFAPFAPLQPQQH--PPPSPPLVWSPP 304 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 35.5 bits (78), Expect = 0.046 Identities = 24/60 (40%), Positives = 24/60 (40%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G GGG G GGG G G G G GG G GG G G G G GGG Sbjct: 121 GVGGGVGGLGGVGGGVGGLGGVGGLGGAGLGG-VGGVGGGIGKAG-GIGGLGGLGGAGGG 178 Score = 33.9 bits (74), Expect = 0.14 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G GG GG G GG G GG GG GG G G G G GGG Sbjct: 138 GLGGVGGLGGAGLGGVGGVG-GGIGKAGGIGGLGGLGGAGGGLGGVGGLGKAGGIGVGGG 196 Score = 32.7 bits (71), Expect = 0.32 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGG-XXXGPGGXXXXXGGXXXGGGGGXXG 622 G GG GG GGG GG GG G GG GG GG G G Sbjct: 118 GLGGVGGGVGGLGGVGGGVGGLGGVGGLGGAGLGGVGGVGGGIGKAGGIGGLG 170 Score = 32.7 bits (71), Expect = 0.32 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GG G G GG GG GG G GGG G G Sbjct: 133 GGGVGGLGGVGGLGGAGLGGVGGVGGGIGKAGGIGGLGGLGGAGGGLGGVG 183 Score = 31.1 bits (67), Expect = 0.99 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G GG GGG GG GG GG G GG G GGG G Sbjct: 149 GLGGVGGVGGGIGK-AGGIGGLGGLGGAGGGLGGVGGLGKAGGIGVGGGIGG 199 Score = 31.1 bits (67), Expect = 0.99 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXG 677 GG GG GG G G GG GG G G GG G G Sbjct: 164 GGIGGLGGLGGAGGGLGGVGGLGKAGGIG-VGGGIGGGHGVVG 205 >At5g66400.1 68418.m08374 dehydrin (RAB18) nearly identical to SP|P30185 Dehydrin Rab18 {Arabidopsis thaliana} Length = 186 Score = 35.1 bits (77), Expect = 0.061 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXG 656 GGG G GGG G G G G GG G GG G G G Sbjct: 32 GGGGYGTGGGGGATGGQGYGTGGQGYGSGGQGYGTGGQGYGTGTGTEGFG 81 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = -1 Query: 771 GGPXXXGGGXXXXGGGQ--GGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G P GG GGG G GG G GG GG G G G G Sbjct: 28 GNPMGGGGYGTGGGGGATGGQGYGTGGQGYGSGGQGYGTGGQGYGTGTGTEG 79 >At5g49080.1 68418.m06074 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 609 Score = 35.1 bits (77), Expect = 0.061 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 74 PPPYVYSSPPPPYYTPSPKVDYKSPPPPYEYSSPPPPYYSPSPKIDYKSPPPPYVYSSPP 133 Query: 807 XPF 815 P+ Sbjct: 134 LPY 136 Score = 35.1 bits (77), Expect = 0.061 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 199 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 258 Query: 807 XPF 815 P+ Sbjct: 259 PPY 261 Score = 35.1 bits (77), Expect = 0.061 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 324 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 383 Query: 807 XPF 815 P+ Sbjct: 384 PPY 386 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 149 PPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 208 Query: 807 XPF 815 P+ Sbjct: 209 PPY 211 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 174 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 233 Query: 807 XPF 815 P+ Sbjct: 234 PPY 236 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 224 PPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPLPYVYSSPP 283 Query: 807 XPF 815 P+ Sbjct: 284 PPY 286 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 299 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 358 Query: 807 XPF 815 P+ Sbjct: 359 PPY 361 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 349 PPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 408 Query: 807 XPF 815 P+ Sbjct: 409 PPY 411 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 374 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 433 Query: 807 XPF 815 P+ Sbjct: 434 PPY 436 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 399 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPP 458 Query: 807 XPF 815 P+ Sbjct: 459 PPY 461 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 449 PPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 508 Query: 807 XPF 815 P+ Sbjct: 509 PPY 511 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 474 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 533 Query: 807 XPF 815 P+ Sbjct: 534 PPY 536 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 499 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPP 558 Query: 807 XPF 815 P+ Sbjct: 559 PPY 561 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 424 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPP 483 Query: 807 XPF 815 P+ Sbjct: 484 PPY 486 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 524 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPP 583 Query: 807 XPF 815 P+ Sbjct: 584 PPY 586 Score = 33.9 bits (74), Expect = 0.14 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP PP Sbjct: 249 PPPYVYSSPPPPYYSPSPKVDYKSPPLPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 308 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 309 PPYYSPSPKVDYKSPP--PP 326 Score = 31.9 bits (69), Expect = 0.57 Identities = 18/62 (29%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXX-PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPX 809 PP P P P P P PPP P P PP P PP Sbjct: 125 PPYVYSSPPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPP 184 Query: 810 PF 815 P+ Sbjct: 185 PY 186 Score = 31.5 bits (68), Expect = 0.75 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 6/67 (8%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPP------PPXPPXR 794 PPP P P P P PP P PPLP P PP P Sbjct: 99 PPPYEYSSPPPPYYSPS----PKIDYKSPPPPYVYSSPPLPYYSPSPKVDYKSPPPPYVY 154 Query: 795 XPPPXPF 815 PP P+ Sbjct: 155 SSPPPPY 161 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/64 (28%), Positives = 19/64 (29%), Gaps = 1/64 (1%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXX-PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 H P P P P P P PPP P P PP P P Sbjct: 48 HSKPYIYNSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYTPSPKVDYKSPPPPYEYSSP 107 Query: 804 PXPF 815 P P+ Sbjct: 108 PPPY 111 Score = 30.7 bits (66), Expect = 1.3 Identities = 22/81 (27%), Positives = 24/81 (29%), Gaps = 4/81 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX----PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 PPP P +P PP P PPP P PPP P Sbjct: 123 PPPPYVYSSPPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSP 182 Query: 801 PPXPFLAHXXXGXXXPPSXPP 863 PP + PP PP Sbjct: 183 PPPYYSPSPKVDYKSPP--PP 201 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/63 (28%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 P P P P P P P PPP P P PP P PP Sbjct: 274 PLPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 333 Query: 807 XPF 815 P+ Sbjct: 334 PPY 336 Score = 29.9 bits (64), Expect = 2.3 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 PP P P P PP PP PP P PPP PPP + Sbjct: 57 PPPPYYSPSPKVNYKSPP--PPYVYSSPP--PPYYTPSPKVDYKSPPPPYEYSSPPPPYY 112 Query: 816 LAHXXXGXXXPPSXPP 863 PP PP Sbjct: 113 SPSPKIDYKSPP--PP 126 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 206 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPP 251 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 331 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPP 376 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 156 SPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 201 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXP--PXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 247 SPPPPYVYSSPPPPYYSPSPKVDYKSPPLPYVYSSPPPPYYSPSP 291 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 281 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 326 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 406 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 451 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 456 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 501 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 506 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 551 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX--PPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 547 SPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 591 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P PP P PP P P P PPP Sbjct: 549 PPPYVYNSPPPPYYSPS----PKVDYKSPPPPYVYSSPP-PPYYSPSPKVTYKSLPPPYV 603 Query: 813 FLA 821 + A Sbjct: 604 YKA 606 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP +PPP PSP Sbjct: 56 SPPPPYYSPSPKVNYKSPPPPYVYS-------SPPPPYYTPSP 91 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +1 Query: 622 PXTPPPPXXXPPP---XPXXXXPXPPXXPPXXXRAPLAPPPXXXP 747 P PPP PPP P P P PP AP PP P Sbjct: 33 PPATPPPVATPPPVATPPPAATPAPATPPPAATPAPATTPPSVAP 77 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 684 APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 AP P P PPP PP P PP P PPP Sbjct: 23 APAPTPTATPPPATPPPVATPP-PVATPPPAATPAPATPPP 62 Score = 31.1 bits (67), Expect = 0.99 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 P P P P P A PP PP P P P P PP P P Sbjct: 24 PAPTPTATPPPATPPPVAT--PPPVATPPPAATPAPATPPPAATPAPATTPPSVAPSP 79 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXX--PPXXXRAPLAPPPXXXP 747 P P PP P PP PP AP PPP P Sbjct: 26 PTPTATPPPATPPPVATPPPVATPPPAATPAPATPPPAATP 66 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +1 Query: 634 PPPXXXPPPX--PXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P P PPP P P P PP A PP P+P Sbjct: 26 PTPTATPPPATPPPVATPPPVATPPPAATPAPATPPPAATPAP 68 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +1 Query: 628 TPPPPX-XXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 TPPP P P P P PP +P A P PP+P Sbjct: 48 TPPPAATPAPATPPPAATPAPATTPPSVAPSP-ADVPTASPPAP 90 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/44 (29%), Positives = 14/44 (31%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 P P P PP PP P P A PP P+ Sbjct: 51 PAATPAPATPPPAATPAPATTPPSVAPSPADVPTASPPAPEGPT 94 >At5g06640.1 68418.m00750 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 689 Score = 35.1 bits (77), Expect = 0.061 Identities = 24/80 (30%), Positives = 25/80 (31%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX---APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P A PP P PPP P PPP PP Sbjct: 379 PPPYVYSSPPPQYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVAYKSPPPPYVYSSPP 438 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 439 PPYYSPSPKVDYKSPP--PP 456 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 104 PPPNVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 163 Query: 807 XPF 815 P+ Sbjct: 164 PPY 166 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 129 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYNSPP 188 Query: 807 XPF 815 P+ Sbjct: 189 PPY 191 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/65 (29%), Positives = 21/65 (32%), Gaps = 2/65 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 204 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPP 263 Query: 807 XPFLA 821 P+ + Sbjct: 264 PPYFS 268 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 229 PPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYFSPSPKVEYKSPPPPYVYNSPP 288 Query: 807 XPF 815 P+ Sbjct: 289 PPY 291 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 279 PPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 338 Query: 807 XPF 815 P+ Sbjct: 339 PPY 341 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 354 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPQYYSPSPKVAYKSPPPPYVYSSPP 413 Query: 807 XPF 815 P+ Sbjct: 414 PPY 416 Score = 34.7 bits (76), Expect = 0.080 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 3/64 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX---APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P A PP P PPP P P PP P P Sbjct: 404 PPPYVYSSPPPPYYSPSPKVAYKSPPPPYVYS-SPPPPYYSPSPKVDYKSPPPPYVYSSP 462 Query: 804 PXPF 815 P P+ Sbjct: 463 PPPY 466 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 429 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 488 Query: 807 XPF 815 P+ Sbjct: 489 PPY 491 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 454 PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 513 Query: 807 XPF 815 P+ Sbjct: 514 PPY 516 Score = 34.7 bits (76), Expect = 0.080 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 4/62 (6%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXP-PLPXXXXPPPPXPPXRXP 800 PPP P P P PP P PPP P P PPPP P Sbjct: 479 PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYHSPSPKVNYKSPPPPYVYSSHP 538 Query: 801 PP 806 PP Sbjct: 539 PP 540 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 154 PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKIEYKSPPPPYVYSSPP 213 Query: 807 XPF 815 P+ Sbjct: 214 PPY 216 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 179 PPPYVYNSPPPPYYSPSPKIEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPP 238 Query: 807 XPF 815 P+ Sbjct: 239 PPY 241 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 254 PPPYVYSSPPPPYFSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPP 313 Query: 807 XPF 815 P+ Sbjct: 314 PPY 316 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 304 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 363 Query: 807 XPF 815 P+ Sbjct: 364 PPY 366 Score = 34.3 bits (75), Expect = 0.11 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP PP Sbjct: 329 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 388 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 389 PQYYSPSPKVAYKSPP--PP 406 Score = 34.3 bits (75), Expect = 0.11 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP PP Sbjct: 504 PPPYVYSSPPPPYHSPSPKVNYKSPPPPYVYSSHPPPYYSPSPKVNYKSPPPPYVYSSPP 563 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 564 PPYYSPSPKVNYKSPP--PP 581 Score = 32.3 bits (70), Expect = 0.43 Identities = 23/77 (29%), Positives = 24/77 (31%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P PP PP PP P PPP PPP Sbjct: 86 PPPPSYYSPSPKVNYKSPP--PPNVYNSPP--PPYYSPSPKVDYKSPPPPYVYSSPPPPY 141 Query: 813 FLAHXXXGXXXPPSXPP 863 + PP PP Sbjct: 142 YSPSPKVDYKSPP--PP 156 Score = 31.1 bits (67), Expect = 0.99 Identities = 18/62 (29%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXX-PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPX 809 PP P P P P P PPP P P PP P PP Sbjct: 530 PPYVYSSHPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPP 589 Query: 810 PF 815 P+ Sbjct: 590 PY 591 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/63 (28%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P P P PP Sbjct: 554 PPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPMVDYKSTPPPYVYSFPP 613 Query: 807 XPF 815 P+ Sbjct: 614 LPY 616 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +3 Query: 684 APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 AP P PP PP P P PP P PP P+ Sbjct: 75 APHPKPYVYISPP--PPSYYSPSPKVNYKSPPPPNVYNSPPPPY 116 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/64 (29%), Positives = 20/64 (31%), Gaps = 3/64 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P PP P PPP P P PP P P Sbjct: 604 PPPYVYSFPPLPYYSPSPKVDYKSPPLPYVYS-SPPPLYYSPSPKVHYKSPPPPYVYNSP 662 Query: 804 PXPF 815 P P+ Sbjct: 663 PPPY 666 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 111 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 156 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 211 SPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPP 256 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 311 SPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 356 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 361 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPQYYSPSPKVAYKSPPPP 406 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 436 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPP 481 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 552 SPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSP 596 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXP--PXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 102 SPPPPNVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 146 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 161 SPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKIEYKSPPPP 206 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXP--PXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 202 SPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSP 246 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 236 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYFSPSPKVEYKSPPPP 281 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 35.1 bits (77), Expect = 0.061 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGG 695 G GGG G GGGG R G GGG GG G GG Sbjct: 69 GSGGGGGGRGYGGGGR----REGGGYGGGDGGSYGGGGG 103 Score = 34.7 bits (76), Expect = 0.080 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -3 Query: 787 GGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXG 677 G GGGG G GG GGG GG G GG G G Sbjct: 69 GSGGGGGGRGYGGGGRREGGGYGG---GDGGSYGGGG 102 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 732 GGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGG GG GG GG GG GGGGG Sbjct: 71 GGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 104 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGG 676 GGGG GGG GGG GG GG G GG Sbjct: 73 GGGGRG-YGGGGRREGGGYGG--GDGGSYGGGGG 103 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 35.1 bits (77), Expect = 0.061 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP PPP P P PPP PP P Sbjct: 119 SPPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPP 161 Score = 34.7 bits (76), Expect = 0.080 Identities = 22/66 (33%), Positives = 24/66 (36%), Gaps = 11/66 (16%) Frame = +3 Query: 699 PXPXXGPPGPPPXXXPPLPXXXX---------PPPPXPPXRXPPPXPFLAHXXXG--XXX 845 P P PP PPP PP+ PPPP PP P P + G Sbjct: 120 PPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITPPVTTTTTGHHHHR 179 Query: 846 PPSXPP 863 PP PP Sbjct: 180 PPPPPP 185 Score = 32.7 bits (71), Expect = 0.32 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSX 857 P P PP G P P PPPP PP PP A PP Sbjct: 97 PPPPPPPPLSAITTTGHHHHRRSPPPPP--PPPPPPPTITPPVTTTTAGHHHHRRSPPPP 154 Query: 858 PP 863 PP Sbjct: 155 PP 156 Score = 32.7 bits (71), Expect = 0.32 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 +PPPP PPP P P P PPP P Sbjct: 150 SPPPPPPPPPPPPTITPPVTTTTTGHHHHRPPPPPPATTTP 190 Score = 31.1 bits (67), Expect = 0.99 Identities = 21/70 (30%), Positives = 22/70 (31%), Gaps = 13/70 (18%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXP--------PXPXXGPPGPPPXXXPPLPXXXXP-----P 773 PPP P P P P P PP PPP PP+ P Sbjct: 121 PPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITPPVTTTTTGHHHHRP 180 Query: 774 PPXPPXRXPP 803 PP PP P Sbjct: 181 PPPPPATTTP 190 Score = 29.1 bits (62), Expect = 4.0 Identities = 20/74 (27%), Positives = 21/74 (28%), Gaps = 13/74 (17%) Frame = +2 Query: 596 TNKSYXFXXPXXPPPPP-------------XXXPPXXXXXPPGPXXXXXXXXXXXXXXXX 736 TN + P PPPPP PP PP P Sbjct: 88 TNSGHHQLRPPPPPPPPLSAITTTGHHHHRRSPPPPPPPPPPPPTITPPVTTTTAGHHHH 147 Query: 737 XXXPPPXXXGPPPP 778 PPP PPPP Sbjct: 148 RRSPPPPPPPPPPP 161 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/54 (29%), Positives = 17/54 (31%), Gaps = 5/54 (9%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLP-----XXXXPPPP 779 PPP P P P PP PPP P+ PPPP Sbjct: 152 PPPPPPPPPPPTITPPVTTTTTGHHHHRPPPPPPATTTPITNTSDHHQLHPPPP 205 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 35.1 bits (77), Expect = 0.061 Identities = 19/37 (51%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Frame = +3 Query: 717 PPGPPPXXX--PPLPXXXXPPPPXPPXRXP--PPXPF 815 PP PPP PPLP PPPP PP + P P PF Sbjct: 12 PPPPPPRLLVLPPLP----PPPPPPPPQLPFGPKLPF 44 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 726 PPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 PPP PP PP P PP PP PF Sbjct: 9 PPPPPPPPPRLLVLPPLPPPPPPPPPQLPF 38 Score = 33.9 bits (74), Expect = 0.14 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 634 PPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAP 729 PPP PPP P PP PP + P P Sbjct: 9 PPPPPPPPPRLLVLPPLPPPPPPPPPQLPFGP 40 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXP 785 P P PP PP PPP PP P P P Sbjct: 10 PPPPPPPPRLLVLPPLPPPPPPPPPQLPFGPKLPFP 45 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 658 PXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSPXXG 765 P P PP P PL PPP PP G Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPPPPPQLPFG 39 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 622 PXTPPPPXXXP-PPXPXXXXPXPPXXPPXXXRAPLAPPP 735 P PPPP PP P P PP PP P P P Sbjct: 11 PPPPPPPRLLVLPPLP----PPPPPPPPQLPFGPKLPFP 45 >At3g42130.1 68416.m04326 glycine-rich protein Length = 65 Score = 35.1 bits (77), Expect = 0.061 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = -3 Query: 811 GXGGGXRXGGX---GGGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 G GG R GG GGGG G GGG GG G GG G Sbjct: 19 GGGGRYRKGGGNVYGGGGGYERHSRGYRSGGGCGGKRYGGGGREG 63 Score = 31.5 bits (68), Expect = 0.75 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGG 637 GGGG GGG GGG G G G GG GGG Sbjct: 19 GGGGRYRKGGGNVYGGGGGYERHSRGYRSGGGCGGKRYGGGGREGGG 65 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 35.1 bits (77), Expect = 0.061 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 906 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPAPKVDYKSPPPPYVYSSPP 965 Query: 807 XPF 815 P+ Sbjct: 966 PPY 968 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 89 PPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPIYSPSPKVDYKSPPPPYVYSSPP 148 Query: 807 XPF 815 P+ Sbjct: 149 PPY 151 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 214 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPP 273 Query: 807 XPF 815 P+ Sbjct: 274 PPY 276 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 264 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 323 Query: 807 XPF 815 P+ Sbjct: 324 PPY 326 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 289 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 348 Query: 807 XPF 815 P+ Sbjct: 349 PPY 351 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 314 PPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 373 Query: 807 XPF 815 P+ Sbjct: 374 PPY 376 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 339 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPP 398 Query: 807 XPF 815 P+ Sbjct: 399 PPY 401 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 414 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 473 Query: 807 XPF 815 P+ Sbjct: 474 PPY 476 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 464 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVLYKSPPPPYVYSSPP 523 Query: 807 XPF 815 P+ Sbjct: 524 PPY 526 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 856 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 915 Query: 807 XPF 815 P+ Sbjct: 916 PPY 918 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 881 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 940 Query: 807 XPF 815 P+ Sbjct: 941 PPY 943 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 189 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 248 Query: 807 XPF 815 P+ Sbjct: 249 PPY 251 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 239 PPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 298 Query: 807 XPF 815 P+ Sbjct: 299 PPY 301 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 364 PPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYTPSPKVVYKSPPPPYVYSSPP 423 Query: 807 XPF 815 P+ Sbjct: 424 PPY 426 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 389 PPPYVYSSPPPPYYTPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 448 Query: 807 XPF 815 P+ Sbjct: 449 PPY 451 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 439 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 498 Query: 807 XPF 815 P+ Sbjct: 499 PPY 501 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 489 PPPYVYSSPPPPYYSPSPKVLYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 548 Query: 807 XPF 815 P+ Sbjct: 549 PPY 551 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 514 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 573 Query: 807 XPF 815 P+ Sbjct: 574 PPY 576 Score = 34.3 bits (75), Expect = 0.11 Identities = 22/77 (28%), Positives = 23/77 (29%), Gaps = 3/77 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP PP Sbjct: 539 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 598 Query: 804 PXPFLAHXXXGXXXPPS 854 P + PPS Sbjct: 599 PPYYSPSPKVYYKSPPS 615 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 656 PPPYVYSSPPPPYHSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPP 715 Query: 807 XPF 815 P+ Sbjct: 716 PPY 718 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 681 PPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 740 Query: 807 XPF 815 P+ Sbjct: 741 PPY 743 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 706 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 765 Query: 807 XPF 815 P+ Sbjct: 766 PPY 768 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 731 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 790 Query: 807 XPF 815 P+ Sbjct: 791 PPY 793 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 756 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 815 Query: 807 XPF 815 P+ Sbjct: 816 PPY 818 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 781 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 840 Query: 807 XPF 815 P+ Sbjct: 841 PPY 843 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 806 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 865 Query: 807 XPF 815 P+ Sbjct: 866 PPY 868 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 831 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 890 Query: 807 XPF 815 P+ Sbjct: 891 PPY 893 Score = 32.7 bits (71), Expect = 0.32 Identities = 23/77 (29%), Positives = 25/77 (32%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P +P PP PP PP P PPP PPP Sbjct: 638 PPPPPCYSPSPKVVYKSSP--PPYVYSSPP--PPYHSPSPKVHYKSPPPPYVYSSPPPPY 693 Query: 813 FLAHXXXGXXXPPSXPP 863 + PP PP Sbjct: 694 YSPSPKVHYKSPP--PP 708 Score = 32.7 bits (71), Expect = 0.32 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P P PPP P P PP P PP P Sbjct: 956 PPPYVYSSPPP-------PYYSPSPKVDYKSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 1008 Score = 32.3 bits (70), Expect = 0.43 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXP-PXRXPP 803 PPP P P P P P PPP P P PP P PP Sbjct: 114 PPPYVYSSPPPPIYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPSPYVYNSPP 173 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 174 PSYYSPSPKVDYKSPP--PP 191 Score = 31.9 bits (69), Expect = 0.57 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP P +PPP SP Sbjct: 963 SPPPPYYSPSPKVDYKSPPPPYYSPSPKVDYKSPPPPYVYSSP 1005 Score = 31.5 bits (68), Expect = 0.75 Identities = 18/63 (28%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 P P P P P P P PPP P P PP P PP Sbjct: 164 PSPYVYNSPPPSYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 223 Query: 807 XPF 815 P+ Sbjct: 224 PPY 226 Score = 31.1 bits (67), Expect = 0.99 Identities = 21/71 (29%), Positives = 22/71 (30%), Gaps = 10/71 (14%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGP-------PPXXXPPLPXXXXPPPPX 782 PPP P P P PP P P P PP P P PP Sbjct: 31 PPPYSVPLPKVEYKSPPLPDVYSSPPPPLEYSPAPKVDYKSPPPPYYSPSPKVEYKSPPP 90 Query: 783 PPXRXPPPXPF 815 P PP P+ Sbjct: 91 PYVYNSPPPPY 101 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PPSP Sbjct: 121 SPPPPIYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPSP 166 Score = 30.3 bits (65), Expect = 1.7 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 11/71 (15%) Frame = +3 Query: 633 PPPXXXXXPXPXXXX--PXAPXXPPXP---XXGPP------GPPPXXXPPLPXXXXPPPP 779 PPP P P P P P P PP PPP P P PP Sbjct: 55 PPPPLEYSPAPKVDYKSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVDYKSPP 114 Query: 780 XPPXRXPPPXP 812 P PP P Sbjct: 115 PPYVYSSPPPP 125 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PPSP Sbjct: 571 SPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPSP 616 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/52 (34%), Positives = 21/52 (40%), Gaps = 9/52 (17%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX-----PPXXXRAPL----APPPXXXPPSP 756 +PPPP P P P PP PP +P +PPP PSP Sbjct: 938 SPPPPYYSPAPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYYSPSP 989 Score = 29.5 bits (63), Expect = 3.0 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 PP P P P PP PP PP P PPP PPP + Sbjct: 72 PPPPYYSPSPKVEYKSPP--PPYVYNSPP--PPYYSPSPKVDYKSPPPPYVYSSPPPPIY 127 Query: 816 LAHXXXGXXXPPSXPP 863 PP PP Sbjct: 128 SPSPKVDYKSPP--PP 141 Score = 29.5 bits (63), Expect = 3.0 Identities = 22/80 (27%), Positives = 23/80 (28%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PP P PPP PP Sbjct: 139 PPPYVYSSPPPPYYSPSPKVEYKSPPSPYVYNSPPPSYYSPSPKVDYKSPPPPYVYSSPP 198 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 199 PPYYSPSPKVVYKSPP--PP 216 Score = 29.5 bits (63), Expect = 3.0 Identities = 20/79 (25%), Positives = 22/79 (27%), Gaps = 2/79 (2%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P P Sbjct: 564 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPSPYHAPSPK 623 Query: 807 XPFLAHXXXGXXXPPSXPP 863 + + P PP Sbjct: 624 VLYKSPPHPHVCVCPPPPP 642 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 913 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPAPKVDYKSPPPP 958 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 71 SPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPP 116 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXP--PXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 212 SPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 256 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXP--PXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 262 SPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 306 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXP--PXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 312 SPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSP 356 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 321 SPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 366 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 387 SPPPPYVYSSPPPPYYTPSPKVVYKSPPPPYVYSSPPPPYYSPSP 431 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 396 SPPPPYYTPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 441 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXP--PXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 462 SPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 506 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 512 SPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSP 556 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 562 SPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSP 606 Score = 29.1 bits (62), Expect = 4.0 Identities = 20/71 (28%), Positives = 22/71 (30%), Gaps = 10/71 (14%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXX---GPPGP-------PPXXXPPLPXXXXPPPPX 782 PPP P P +P P P PP P PP P P P Sbjct: 598 PPPYYSPSPKVYYKSPPSPYHAPSPKVLYKSPPHPHVCVCPPPPPCYSPSPKVVYKSSPP 657 Query: 783 PPXRXPPPXPF 815 P PP P+ Sbjct: 658 PYVYSSPPPPY 668 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 704 SPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSP 748 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 754 SPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSP 798 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 804 SPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSP 848 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXP--PXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 854 SPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 898 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 863 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 908 Score = 29.1 bits (62), Expect = 4.0 Identities = 22/77 (28%), Positives = 24/77 (31%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P PP P PP P P P + PPP Sbjct: 931 PPPYVYSSPPPPYYSPA----PKVDYKSPPPPYVYSSPPPPYYS--PSPKVDYKSPPPPY 984 Query: 813 FLAHXXXGXXXPPSXPP 863 + PP PP Sbjct: 985 YSPSPKVDYKSPP--PP 999 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 521 SPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP 566 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 663 SPPPPYHSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPP 708 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 713 SPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP 758 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 763 SPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP 808 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 813 SPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP 858 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 471 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVLYKSPPPP 516 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 35.1 bits (77), Expect = 0.061 Identities = 25/79 (31%), Positives = 26/79 (32%), Gaps = 2/79 (2%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRG-GXXXGGGPG-GPXXGXGGXX 689 G +G A G GG G GGGG G G G G G G G G Sbjct: 128 GSGDGRVSSSGEYSASAGGGGSGEGSGGGGGGDGSSGSGSGSGSGSGSGTGTASGPDVYM 187 Query: 688 GAXGXXXXGXGXXXXXGGG 632 G G G GGG Sbjct: 188 HVEGGGGGGGGGGGGGGGG 206 Score = 34.7 bits (76), Expect = 0.080 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 4/62 (6%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXG----GXXGAXGXXXXGXGXXXXXG 638 GGG GG GGGG G G G G G G G G G G Sbjct: 95 GGGGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDGRVSSSGEYSASAGGGGSGEGSG 154 Query: 637 GG 632 GG Sbjct: 155 GG 156 Score = 34.7 bits (76), Expect = 0.080 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRG-GXXXGGGPG 719 G GGG GG GGGG G G G GGG G Sbjct: 192 GGGGGGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 33.9 bits (74), Expect = 0.14 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXG---GXXXGPGGXXXXXGGXXXGGGGGXXG 622 G G GGG G G G G G GP GG GGGGG G Sbjct: 150 GEGSGGGGGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGGGG 203 Score = 33.5 bits (73), Expect = 0.19 Identities = 25/77 (32%), Positives = 27/77 (35%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG E G + G G G G G G GG GGG GG GG G+ Sbjct: 60 GGTEKGIDDNANGYG-DGNGNGNAHGRADCPGGIVVGGGGGGGGGGGGG-----GGSGGS 113 Query: 682 XGXXXXGXGXXXXXGGG 632 G G G G G Sbjct: 114 NGSFFNGSGSGTGYGSG 130 Score = 33.1 bits (72), Expect = 0.25 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 6/58 (10%) Frame = -1 Query: 777 GGGGPXXXGG---GXXXXGGGQGGPXXXG---GXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG GG G G G G G PGG GG GGGGG G Sbjct: 52 GGGGASVEGGTEKGIDDNANGYGDGNGNGNAHGRADCPGGIVVGGGGGGGGGGGGGGG 109 Score = 32.7 bits (71), Expect = 0.32 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPG 719 G G P +G GGG GG GGGG G G G G Sbjct: 174 GSGTGTASGPDVYMHVEGGGGGGGGGGGGGGGGVDGSGSGSGSGSGGG 221 Score = 31.9 bits (69), Expect = 0.57 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 8/68 (11%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGP--------GGPXXGXGGXXGAXGXXXXGXG 656 G GGG G G G GP GG G GG G G G G Sbjct: 154 GGGGGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGGGGGGGVDGSGSG 213 Query: 655 XXXXXGGG 632 GGG Sbjct: 214 SGSGSGGG 221 Score = 31.9 bits (69), Expect = 0.57 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 787 GGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 GG GGGG G GG G G G G GG G Sbjct: 191 GGGGGGGGGGGGGGGGVDGSG-SGSGSGSGGGSG 223 Score = 31.5 bits (68), Expect = 0.75 Identities = 21/68 (30%), Positives = 23/68 (33%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAX 680 G GG + G G G G G GG GGG GG G GG G+ Sbjct: 154 GGGGGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGG--GGGGGVDGSG 211 Query: 679 GXXXXGXG 656 G G Sbjct: 212 SGSGSGSG 219 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 1/60 (1%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPG-GPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 G GGG GG GG G G G G G G + G G G GG Sbjct: 100 GGGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDGRVSSSGEYSASAGGGGSGEGSGGGGGG 159 Score = 28.7 bits (61), Expect = 5.3 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 6/58 (10%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXX------GGGGGXXG 622 GGGG GG GGG G G G G G GGGGG G Sbjct: 145 GGGGSGEGSGGG---GGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGG 199 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 753 GGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GG GGG GG GG G G G G G G Sbjct: 90 GGIVVGGGGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSG 130 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/64 (29%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXX--GRGGXXXGGGPGGPXXGXGGXX 689 GG GG + G G G G G G GG G G GG G G Sbjct: 107 GGGSGGSNGSFFNGSGSGTGYGSGDGRVSSSGEYSASAGGGGSGEGSGGGGGGDGSSGSG 166 Query: 688 GAXG 677 G Sbjct: 167 SGSG 170 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 732 GGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGG GG GG G GG G G GGG Sbjct: 191 GGGGGG---GGGGGGGGGGVDGSGSGSGSGSGGG 221 >At1g55540.1 68414.m06356 proline-rich family protein contains proline rich extensin domain, INTERPRO:IPR002965 Length = 915 Score = 35.1 bits (77), Expect = 0.061 Identities = 22/67 (32%), Positives = 23/67 (34%), Gaps = 1/67 (1%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXG-GGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 G G P +A G GG GGGG G G G G P GG GA Sbjct: 812 GFAGASSTPTGGFAALASGSGGFAGAAPGGGGGGFGGLGSGTGGFGGFAPQGSSGGFAGA 871 Query: 682 XGXXXXG 662 G G Sbjct: 872 AGGGGFG 878 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/49 (36%), Positives = 20/49 (40%) Frame = -3 Query: 823 WARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXG 677 +A +G GG GGG G GG G GG GG GA G Sbjct: 859 FAPQGSSGGFAGAAGGGG---FGGFGGQAQGQAGGGGFSAFGGNSGATG 904 Score = 29.1 bits (62), Expect = 4.0 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 802 GGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 GG G GG GG GGG GG G GG G G GGG Sbjct: 822 GGFAALASGSGGFAGAAPGGG--GGGFGGLGSGTGGFGGFAPQGSSGGFAGAAGGGG 876 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 29.1 bits (62), Expect(2) = 0.070 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 768 PPPPXPPXRXPPPXPFLA 821 PP P PP PPP P +A Sbjct: 297 PPSPPPPPPPPPPQPLIA 314 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 747 PLPXXXXPPPPXPPXRXPP 803 PL PPPP PP R PP Sbjct: 467 PLIQITPPPPPPPPFRVPP 485 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 720 PGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAH 824 P PP P P PPPP PP P P H Sbjct: 241 PSSPPQQPPATP----PPPPPPPPVEVPQKPRRTH 271 Score = 28.7 bits (61), Expect = 5.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 744 PPLPXXXXPPPPXPPXRXPPPXP 812 PP PPP PP PPP P Sbjct: 373 PPQYQSLIPPPSPPPPPPPPPPP 395 Score = 28.3 bits (60), Expect(2) = 0.34 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 726 PPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP PP P PPPP P PP Sbjct: 296 PPPSPPPPPP----PPPPQPLIAATPP 318 Score = 28.3 bits (60), Expect = 7.0 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXP 687 P +PPPP PPP P P Sbjct: 297 PPSPPPPPPPPPPQPLIAATPP 318 Score = 24.6 bits (51), Expect(2) = 0.070 Identities = 10/27 (37%), Positives = 10/27 (37%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPP 776 P P PP PP PP P P Sbjct: 241 PSSPPQQPPATPPPPPPPPPVEVPQKP 267 Score = 23.8 bits (49), Expect(2) = 7.7 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 Query: 696 PPXPXXGPPGPPP 734 PP P PP PPP Sbjct: 382 PPSPPPPPPPPPP 394 Score = 23.0 bits (47), Expect(2) = 0.34 Identities = 9/24 (37%), Positives = 10/24 (41%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPP 749 P +P P PP PPP P Sbjct: 241 PSSPPQQPPATPPPPPPPPPVEVP 264 Score = 22.6 bits (46), Expect(2) = 7.7 Identities = 10/31 (32%), Positives = 10/31 (32%) Frame = +3 Query: 720 PGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P PPP P PP PP P Sbjct: 421 PAPPPPPPPRYTQFDPQTPPRRVKSGRPPRP 451 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 34.7 bits (76), Expect = 0.080 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXG 698 GGG GG GGGG G GG GG G P G G Sbjct: 572 GGG---GGGGGGGSDYYGGGGYGGGGYGGAPSGGYG 604 Score = 31.9 bits (69), Expect = 0.57 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 823 WARKGXGGGXRXGGX--GGGGXXXXGRGGXXXGGGPGGPXXGXGG 695 WA GGG GG GG G G GGG GG GG Sbjct: 56 WAPPSSGGGGASGGGYRNDGGRTGYGYGAGGGGGGGGGWNNRSGG 100 Score = 31.9 bits (69), Expect = 0.57 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 3/52 (5%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGX---GGGGXXXXGRGGXXXGGGPGG 716 GG GG +G GGG GG GGGG G GG GG G Sbjct: 555 GGRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGGGGYGGAPSGGYGAG 606 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = -3 Query: 820 ARKGXGGGXRXGGXGGGGXXXX-----GRGGXXXGGGPGGPXXGXGGXXG 686 +R GGG + G GG RGG GGG G G GG G Sbjct: 543 SRASFGGGKKRSGGRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGG 592 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPG 679 GGGG GG GGG GG G G G Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGGYGGAPSGGYG 604 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGG 655 GGGG GGG GG G GG G GG GG Sbjct: 62 GGGGAS--GGGYRNDGGRTGYGYGAGGGGGGGGGWNNRSGG 100 Score = 27.9 bits (59), Expect = 9.2 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 7/47 (14%) Frame = -1 Query: 753 GGGXXXXGGGQG-------GPXXXGGXXXGPGGXXXXXGGXXXGGGG 634 GGG GG G G GG G GG GG GGGG Sbjct: 548 GGGKKRSGGRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGGGG 594 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 34.7 bits (76), Expect = 0.080 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXG 698 GGG GG GGGG G GG GG G P G G Sbjct: 572 GGG---GGGGGGGSDYYGGGGYGGGGYGGAPSGGYG 604 Score = 31.9 bits (69), Expect = 0.57 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 823 WARKGXGGGXRXGGX--GGGGXXXXGRGGXXXGGGPGGPXXGXGG 695 WA GGG GG GG G G GGG GG GG Sbjct: 56 WAPPSSGGGGASGGGYRNDGGRTGYGYGAGGGGGGGGGWNNRSGG 100 Score = 31.9 bits (69), Expect = 0.57 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 3/52 (5%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGX---GGGGXXXXGRGGXXXGGGPGG 716 GG GG +G GGG GG GGGG G GG GG G Sbjct: 555 GGRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGGGGYGGAPSGGYGAG 606 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = -3 Query: 820 ARKGXGGGXRXGGXGGGGXXXX-----GRGGXXXGGGPGGPXXGXGGXXG 686 +R GGG + G GG RGG GGG G G GG G Sbjct: 543 SRASFGGGKKRSGGRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGG 592 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPG 679 GGGG GG GGG GG G G G Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGGYGGAPSGGYG 604 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGG 655 GGGG GGG GG G GG G GG GG Sbjct: 62 GGGGAS--GGGYRNDGGRTGYGYGAGGGGGGGGGWNNRSGG 100 Score = 27.9 bits (59), Expect = 9.2 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 7/47 (14%) Frame = -1 Query: 753 GGGXXXXGGGQG-------GPXXXGGXXXGPGGXXXXXGGXXXGGGG 634 GGG GG G G GG G GG GG GGGG Sbjct: 548 GGGKKRSGGRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGGGG 594 >At3g54590.1 68416.m06040 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 743 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 72 PPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPP 131 Query: 807 XPF 815 P+ Sbjct: 132 PPY 134 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 122 PPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 181 Query: 807 XPF 815 P+ Sbjct: 182 PPY 184 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 147 PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 206 Query: 807 XPF 815 P+ Sbjct: 207 PPY 209 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 172 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 231 Query: 807 XPF 815 P+ Sbjct: 232 PPY 234 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 197 PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 256 Query: 807 XPF 815 P+ Sbjct: 257 PPY 259 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 222 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 281 Query: 807 XPF 815 P+ Sbjct: 282 PPY 284 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 247 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 306 Query: 807 XPF 815 P+ Sbjct: 307 PPY 309 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 272 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 331 Query: 807 XPF 815 P+ Sbjct: 332 PPY 334 Score = 34.7 bits (76), Expect = 0.080 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP PP Sbjct: 297 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 356 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 357 PPTYSPSPKVDYKSPP--PP 374 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 322 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPP 381 Query: 807 XPF 815 P+ Sbjct: 382 PPY 384 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 372 PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPP 431 Query: 807 XPF 815 P+ Sbjct: 432 PPY 434 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 97 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPP 156 Query: 807 XPF 815 P+ Sbjct: 157 PPY 159 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 397 PPPYVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 456 Query: 807 XPF 815 P+ Sbjct: 457 PPY 459 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 422 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 481 Query: 807 XPF 815 P+ Sbjct: 482 PPY 484 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 447 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 506 Query: 807 XPF 815 P+ Sbjct: 507 PPY 509 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 472 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 531 Query: 807 XPF 815 P+ Sbjct: 532 PPY 534 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 497 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPP 556 Query: 807 XPF 815 P+ Sbjct: 557 PPY 559 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 522 PPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPP 581 Query: 807 XPF 815 P+ Sbjct: 582 PPY 584 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 572 PPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 631 Query: 807 XPF 815 P+ Sbjct: 632 PPY 634 Score = 33.9 bits (74), Expect = 0.14 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP PP Sbjct: 347 PPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 406 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 407 PPTYSPSPKVYYKSPP--PP 424 Score = 33.9 bits (74), Expect = 0.14 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 547 PPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPP 606 Query: 807 XPF 815 P+ Sbjct: 607 PPY 609 Score = 31.9 bits (69), Expect = 0.57 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP-XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP P +PPP PSP Sbjct: 696 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 739 Score = 31.5 bits (68), Expect = 0.75 Identities = 18/62 (29%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXX-PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPX 809 P P P P P P P PPP P P PP P PP Sbjct: 48 PLPYVDSSPPPTYTPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPP 107 Query: 810 PF 815 P+ Sbjct: 108 PY 109 Score = 31.5 bits (68), Expect = 0.75 Identities = 21/71 (29%), Positives = 22/71 (30%), Gaps = 10/71 (14%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXX---GPPGP-------PPXXXPPLPXXXXPPPPX 782 PPP P P P P P PP P PP P P PP Sbjct: 631 PPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPP 690 Query: 783 PPXRXPPPXPF 815 P PP P+ Sbjct: 691 PYVYNSPPPPY 701 Score = 31.1 bits (67), Expect = 0.99 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P P PPP P P PP P PP P Sbjct: 622 PPPYVYSSPPP-------PYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPP 674 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP PP P P Sbjct: 597 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPP-PPYYSPSP 655 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/52 (34%), Positives = 21/52 (40%), Gaps = 9/52 (17%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX-----PPXXXRAPL----APPPXXXPPSP 756 +PPPP P P P PP PP +P +PPP PSP Sbjct: 604 SPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSP 655 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/46 (32%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP P ++P P PP P Sbjct: 629 SPPPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPP 674 Score = 29.5 bits (63), Expect = 3.0 Identities = 17/63 (26%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P P P P P P P + PPP Sbjct: 673 PPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPP 732 Query: 807 XPF 815 + Sbjct: 733 PSY 735 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXP--PXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 70 SPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 114 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PP P PPP P PPP PPP + PP PP Sbjct: 71 PPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPP--PP 124 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 79 SPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 124 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 129 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPP 174 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 179 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPP 224 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 229 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 274 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 279 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 324 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 329 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP 374 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 420 SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 464 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 470 SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 514 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 520 SPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSP 564 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX--PPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 595 SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 639 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 529 SPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPP 574 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 570 SPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 614 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P PP PP P P P PP P P P Sbjct: 671 PPPPPCYSPSPKVVYKSPP--PPYVYNSPP---PPYYSPSPKVYYKSPPPPSYYSPSP 723 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PP P PP P PPPP PPP Sbjct: 47 PPLPYVDSSPPPTYTPAPEVEYKSPPPPYVYSSPPPP 83 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 379 SPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYKSPPPP 424 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 429 SPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 474 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 479 SPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 524 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 579 SPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 624 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 726 PPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PPP PLP PP P PP + PP PP Sbjct: 31 PPPLYSSPLPEVEYKTPPLPYVDSSPPPTYTPAPEVEYKSPP--PP 74 >At3g54580.1 68416.m06039 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 951 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 147 PPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 206 Query: 807 XPF 815 P+ Sbjct: 207 PPY 209 Score = 34.7 bits (76), Expect = 0.080 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP PP Sbjct: 172 PPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 231 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 232 PPTYSPSPKVDYKSPP--PP 249 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 197 PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPP 256 Query: 807 XPF 815 P+ Sbjct: 257 PPY 259 Score = 34.7 bits (76), Expect = 0.080 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP PP Sbjct: 222 PPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 281 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 282 PPTYSPSPKVDYKSPP--PP 299 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 247 PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPP 306 Query: 807 XPF 815 P+ Sbjct: 307 PPY 309 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 372 PPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 431 Query: 807 XPF 815 P+ Sbjct: 432 PPY 434 Score = 34.7 bits (76), Expect = 0.080 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP PP Sbjct: 397 PPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 456 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 457 PPTYSPSPKVDYKSPP--PP 474 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 422 PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPP 481 Query: 807 XPF 815 P+ Sbjct: 482 PPY 484 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 447 PPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 506 Query: 807 XPF 815 P+ Sbjct: 507 PPY 509 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 588 PPPYVYSSPPPPYHSPSPKVQYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 647 Query: 807 XPF 815 P+ Sbjct: 648 PPY 650 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 805 PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 864 Query: 807 XPF 815 P+ Sbjct: 865 PPY 867 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 830 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 889 Query: 807 XPF 815 P+ Sbjct: 890 PPY 892 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 855 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPVVDYKSPPPPYVYSSPP 914 Query: 807 XPF 815 P+ Sbjct: 915 PPY 917 Score = 34.3 bits (75), Expect = 0.11 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP PP Sbjct: 72 PPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 131 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 132 PPTYSPSPKVEYKSPP--PP 149 Score = 34.3 bits (75), Expect = 0.11 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP PP Sbjct: 97 PPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 156 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 157 PPTYSPSPKVEYKSPP--PP 174 Score = 34.3 bits (75), Expect = 0.11 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP PP Sbjct: 122 PPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 181 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 182 PPTYSPSPKVEYKSPP--PP 199 Score = 34.3 bits (75), Expect = 0.11 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP PP Sbjct: 272 PPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 331 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 332 PPTYSPSPKVEYKSPP--PP 349 Score = 34.3 bits (75), Expect = 0.11 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP PP Sbjct: 297 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 356 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 357 PPTYSPSPKVEYKSPP--PP 374 Score = 34.3 bits (75), Expect = 0.11 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP PP Sbjct: 322 PPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 381 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 382 PPTYSPSPKVEYKSPP--PP 399 Score = 34.3 bits (75), Expect = 0.11 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP PP Sbjct: 347 PPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 406 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 407 PPTYSPSPKVEYKSPP--PP 424 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 472 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 531 Query: 807 XPF 815 P+ Sbjct: 532 PPY 534 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 563 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYHSPSPKVQYKSPPPPYVYSSPP 622 Query: 807 XPF 815 P+ Sbjct: 623 PPY 625 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 613 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 672 Query: 807 XPF 815 P+ Sbjct: 673 PPY 675 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P P PP P P Sbjct: 663 PPPYVYSSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYSSP 722 Query: 804 PXP 812 P P Sbjct: 723 PPP 725 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 780 PPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 839 Query: 807 XPF 815 P+ Sbjct: 840 PPY 842 Score = 33.9 bits (74), Expect = 0.14 Identities = 19/61 (31%), Positives = 20/61 (32%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P P PPP P P PP P PP P Sbjct: 739 PPPYVYSSPPP-------PYYSPSPKVHYKSPPPPYYAPTPKVHYKSPPPPYVYSSPPPP 791 Query: 813 F 815 + Sbjct: 792 Y 792 Score = 33.9 bits (74), Expect = 0.14 Identities = 19/64 (29%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP + PP Sbjct: 880 PPPYVYSSPPPPYYSPSPVVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYKSPP 939 Query: 804 PXPF 815 P + Sbjct: 940 PPSY 943 Score = 33.1 bits (72), Expect = 0.25 Identities = 21/70 (30%), Positives = 22/70 (31%), Gaps = 9/70 (12%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAP---XXPPXPXXGP------PGPPPXXXPPLPXXXXPPPPXP 785 PPP P P P PP P P PPP P P PP P Sbjct: 506 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPPP 565 Query: 786 PXRXPPPXPF 815 PP P+ Sbjct: 566 YVYSSPPPPY 575 Score = 33.1 bits (72), Expect = 0.25 Identities = 21/70 (30%), Positives = 22/70 (31%), Gaps = 9/70 (12%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXP---XXGPP------GPPPXXXPPLPXXXXPPPPXP 785 PPP P P P P P PP PPP P P PP P Sbjct: 531 PPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 590 Query: 786 PXRXPPPXPF 815 PP P+ Sbjct: 591 YVYSSPPPPY 600 Score = 33.1 bits (72), Expect = 0.25 Identities = 21/70 (30%), Positives = 22/70 (31%), Gaps = 9/70 (12%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXP---XXGPP------GPPPXXXPPLPXXXXPPPPXP 785 PPP P P P P P PP PPP P P PP P Sbjct: 748 PPPYYSPSPKVHYKSPPPPYYAPTPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPP 807 Query: 786 PXRXPPPXPF 815 PP P+ Sbjct: 808 YVYSSPPPPY 817 Score = 32.3 bits (70), Expect = 0.43 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 2/62 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 638 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPHPHVCVCPP 697 Query: 807 XP 812 P Sbjct: 698 PP 699 Score = 31.9 bits (69), Expect = 0.57 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP P +PPP SP Sbjct: 529 SPPPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPPPYVYSSP 571 Score = 31.9 bits (69), Expect = 0.57 Identities = 23/77 (29%), Positives = 24/77 (31%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P PP PP PP P PPP PPP Sbjct: 696 PPPPPCYSPSPKVVYKSPP--PPYVYSSPP--PPHYSPSPKVYYKSPPPPYVYSSPPPPY 751 Query: 813 FLAHXXXGXXXPPSXPP 863 + PP PP Sbjct: 752 YSPSPKVHYKSPP--PP 766 Score = 31.9 bits (69), Expect = 0.57 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP P +PPP SP Sbjct: 746 SPPPPYYSPSPKVHYKSPPPPYYAPTPKVHYKSPPPPYVYSSP 788 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P PP PPP PSP Sbjct: 661 SPPPPYVYSSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSP 706 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP PP P P Sbjct: 497 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPP-PPYYSPSP 555 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 1/61 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXX-PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPX 809 P P P P P P P PPP P P PP P PP Sbjct: 48 PLPYIDSSPPPTYSPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPP 107 Query: 810 P 812 P Sbjct: 108 P 108 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/52 (34%), Positives = 21/52 (40%), Gaps = 9/52 (17%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX-----PPXXXRAPL----APPPXXXPPSP 756 +PPPP P P P PP PP +P +PPP PSP Sbjct: 504 SPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSP 555 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 570 SPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYHSPSPKVQYKSPPPP 615 Score = 29.5 bits (63), Expect = 3.0 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PP P PPP P PPP PPP + PP PP Sbjct: 71 PPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPP--PP 124 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXP--PXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 70 SPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSP 114 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 79 SPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP 124 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 104 SPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP 149 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 129 SPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP 174 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 154 SPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP 199 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 204 SPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP 249 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 254 SPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP 299 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 304 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP 349 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 329 SPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP 374 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 354 SPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP 399 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 379 SPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP 424 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 429 SPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP 474 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX--PPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 495 SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 539 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 561 SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYHSPSP 605 Score = 29.1 bits (62), Expect = 4.0 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 3/61 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P P P P P PP PP P Sbjct: 672 PPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYSSPP-PPHYSPS 730 Query: 804 P 806 P Sbjct: 731 P 731 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 712 SPPPPYVYSSPPPPHYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 756 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/52 (32%), Positives = 21/52 (40%), Gaps = 9/52 (17%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX-----PPXXXRAPL----APPPXXXPPSP 756 +PPPP P P P PP PP +P +PPP P+P Sbjct: 721 SPPPPHYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYYAPTP 772 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXP--PXXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 803 SPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSP 847 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 812 SPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 857 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXX--PPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 903 SPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYKSPPPPSYSPSP 947 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 862 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPVVDYKSPPPP 907 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PP P PP P PPPP PPP Sbjct: 47 PPLPYIDSSPPPTYSPAPEVEYKSPPPPYVYSSPPPP 83 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 479 SPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 524 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 620 SPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 665 >At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) similar to RNA helicases GI:3775995, GI:3775987 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 610 Score = 34.7 bits (76), Expect = 0.080 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXG 656 GG G GGGG G GGG G G G G G G G Sbjct: 507 GGSFGGGRSGGGGYGSYGSSSGRSGGGSYGGYGGSSGRSGGGGGSYGGSG 556 Score = 33.5 bits (73), Expect = 0.19 Identities = 21/69 (30%), Positives = 23/69 (33%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG G + G GG GG GG G GG GG G GG + Sbjct: 511 GGGRSGGGGYGSYGSSSGRSGGGSYGGYGGSSGRSGG-GGGSYGGSGGSSSRYSGGSDRS 569 Query: 682 XGXXXXGXG 656 G G G Sbjct: 570 SGFGSFGSG 578 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQ-GGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGGG G GGG GG G G GG GG GG Sbjct: 516 GGGGYGSYGSSSGRSGGGSYGGYGGSSGRSGGGGGSYGGSGGSSSRYSGG 565 Score = 29.5 bits (63), Expect = 3.0 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GG GGG G GG G G G GG G Sbjct: 531 GGGSYGGYGGSSGRSGGGGGSYGGSGGSSSRYSGGSDRSSGFGSFGSGGSSG 582 >At3g21215.1 68416.m02681 RNA-binding protein, putative contains RNA recognition motif, Pfam:PF00076; contains AT-AC splice sites at intron 8 Length = 339 Score = 34.7 bits (76), Expect = 0.080 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 607 IYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP 747 +Y P PPPP PP PP P AP P P P Sbjct: 167 VYSPSPFHPPPPPVWGPPHGYMAPAPPPYDPYAGYHAPPVPMPTPPP 213 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 637 PPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 PP PPP PP PP P PPP Sbjct: 14 PPAGAPPPPAAVSSAAPPHPPPIHHHPP--PPP 44 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = +3 Query: 729 PPXXXPPLPXXXX---PPPPXPPXRXPPPXPFL 818 PP PP P PP P P PPP P L Sbjct: 14 PPAGAPPPPAAVSSAAPPHPPPIHHHPPPPPVL 46 >At2g24980.1 68415.m02987 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 559 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 74 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 133 Query: 807 XPF 815 P+ Sbjct: 134 PPY 136 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 99 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPP 158 Query: 807 XPF 815 P+ Sbjct: 159 PPY 161 Score = 34.7 bits (76), Expect = 0.080 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 149 PPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 208 Query: 807 XPF 815 P+ Sbjct: 209 PPY 211 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPX--APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 124 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPP 183 Query: 807 XPF 815 P+ Sbjct: 184 PPY 186 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 174 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 233 Query: 807 XPF 815 P+ Sbjct: 234 PPY 236 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 199 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 258 Query: 807 XPF 815 P+ Sbjct: 259 PPY 261 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 224 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 283 Query: 807 XPF 815 P+ Sbjct: 284 PPY 286 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 249 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 308 Query: 807 XPF 815 P+ Sbjct: 309 PPY 311 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 274 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 333 Query: 807 XPF 815 P+ Sbjct: 334 PPY 336 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 299 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 358 Query: 807 XPF 815 P+ Sbjct: 359 PPY 361 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 324 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 383 Query: 807 XPF 815 P+ Sbjct: 384 PPY 386 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 349 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYNSPP 408 Query: 807 XPF 815 P+ Sbjct: 409 PPY 411 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 399 PPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 458 Query: 807 XPF 815 P+ Sbjct: 459 PPY 461 Score = 33.9 bits (74), Expect = 0.14 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 374 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPP 433 Query: 807 XPF 815 P+ Sbjct: 434 PPY 436 Score = 32.7 bits (71), Expect = 0.32 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 3/61 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP PP Sbjct: 424 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPP 483 Query: 804 P 806 P Sbjct: 484 P 484 Score = 31.1 bits (67), Expect = 0.99 Identities = 18/63 (28%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 P P P P P P P PPP P P PP P PP Sbjct: 49 PKPYVKSSPPPQYYTPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 108 Query: 807 XPF 815 P+ Sbjct: 109 PPY 111 Score = 31.1 bits (67), Expect = 0.99 Identities = 18/63 (28%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP PP Sbjct: 449 PPPYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPP 508 Query: 807 XPF 815 P+ Sbjct: 509 PPY 511 Score = 31.1 bits (67), Expect = 0.99 Identities = 18/63 (28%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PP P P P P P PPP P P PP P PP Sbjct: 474 PPSYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 533 Query: 807 XPF 815 P+ Sbjct: 534 PPY 536 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 81 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 126 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 131 SPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPP 176 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 222 SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 266 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 272 SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 316 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 322 SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 366 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 422 SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 466 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 506 SPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVTYKSPPPP 551 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 372 SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYNSPPPPYYSPSP 416 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 181 SPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 226 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 231 SPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 276 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 281 SPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 326 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 331 SPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 376 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 381 SPPPPYYSPSPKVYYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPP 426 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 34.7 bits (76), Expect = 0.080 Identities = 22/73 (30%), Positives = 22/73 (30%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P PP PPP PP P P P P P Sbjct: 37 PPPTQPGGPPAWYSNQFHHPHSPSP---PPPPPPQWGPPSPHYPQGQPYSSPAYPPHQPP 93 Query: 813 FLAHXXXGXXXPP 851 F A PP Sbjct: 94 FNAGANGNSQFPP 106 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/59 (30%), Positives = 19/59 (32%), Gaps = 3/59 (5%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPP-PPXPPXRXPPPXPFL--AHXXXGXXXPPSXPP 863 P P P GPP P PP PP + PP P PP PP Sbjct: 35 PVPPPTQPGGPPAWYSNQFHHPHSPSPPPPPPPQWGPPSPHYPQGQPYSSPAYPPHQPP 93 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPP-PPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PP P GPPP P PP PP P P PS PP Sbjct: 7 PPQYLRPPSGPPPPTDPYHQYYQHQARPPVPPPTQPGGPPAWYSNQFHHPHSPSPPP 63 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 34.7 bits (76), Expect = 0.080 Identities = 22/73 (30%), Positives = 22/73 (30%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P PP PPP PP P P P P P Sbjct: 37 PPPTQPGGPPAWYSNQFHHPHSPSP---PPPPPPQWGPPSPHYPQGQPYSSPAYPPHQPP 93 Query: 813 FLAHXXXGXXXPP 851 F A PP Sbjct: 94 FNAGANGNSQFPP 106 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/59 (30%), Positives = 19/59 (32%), Gaps = 3/59 (5%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPP-PPXPPXRXPPPXPFL--AHXXXGXXXPPSXPP 863 P P P GPP P PP PP + PP P PP PP Sbjct: 35 PVPPPTQPGGPPAWYSNQFHHPHSPSPPPPPPPQWGPPSPHYPQGQPYSSPAYPPHQPP 93 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPP-PPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PP P GPPP P PP PP P P PS PP Sbjct: 7 PPQYLRPPSGPPPPTDPYHQYYQHQARPPVPPPTQPGGPPAWYSNQFHHPHSPSPPP 63 >At1g65440.1 68414.m07424 glycine-rich protein Length = 1647 Score = 34.7 bits (76), Expect = 0.080 Identities = 23/79 (29%), Positives = 24/79 (30%) Frame = -3 Query: 859 GXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAX 680 G GG +K GG G GG G G G G GG G G G Sbjct: 1524 GNSGGGGWGSESAGKKTGGGSTGGWGSESGGNKSDGAGSWGSGSG-GGGSGGWGNDSGGK 1582 Query: 679 GXXXXGXGXXXXXGGGXXW 623 G GGG W Sbjct: 1583 KSSEDGGFGSGSGGGGSDW 1601 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/64 (26%), Positives = 18/64 (28%) Frame = -3 Query: 823 WARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXX 644 W G G GGG G GGG G G + G G G Sbjct: 1511 WGNNDTGTADGGWGNSGGGGWGSESAGKKTGGGSTGGWGSESGGNKSDGAGSWGSGSGGG 1570 Query: 643 XGGG 632 GG Sbjct: 1571 GSGG 1574 Score = 29.1 bits (62), Expect = 4.0 Identities = 23/78 (29%), Positives = 23/78 (29%), Gaps = 1/78 (1%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGR-GGXXXGGGPGGPXXGXGGXXG 686 GG GG K G G G GGGG G G GG G GG Sbjct: 1542 GGSTGGWGSESG--GNKSDGAGSWGSGSGGGGSGGWGNDSGGKKSSEDGGFGSGSGGGGS 1599 Query: 685 AXGXXXXGXGXXXXXGGG 632 G G G G Sbjct: 1600 DWGNESGGKKSSADGGWG 1617 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -1 Query: 771 GGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG G G G G GG G G G GGGG G Sbjct: 1553 GGNKSDGAGSWGSGSGGGGSGGWGNDSGGKKSSEDGGFGSGSGGGGSDWG 1602 >At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly identical to RNA helicase [Arabidopsis thaliana] GI:1488521; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 671 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -3 Query: 817 RKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGG 716 +K GGG R GGGG G GG GG GG Sbjct: 633 QKRFGGGGRGNRFGGGGGNRFGGGGGRGRGGSGG 666 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +3 Query: 717 PPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 PP PPP PP P PPP P PPP PF Sbjct: 99 PPQPPP---PPQPLNLFSPPPPP----PPPDPF 124 Score = 31.1 bits (67), Expect = 0.99 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 717 PPGPPPXXXPPLPXXXXPPPPXPP 788 PP PP PL PPPP PP Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPPPP 121 Score = 30.3 bits (65), Expect = 1.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 634 PPPXXXPPPXPXXXXPXPPXXPP 702 PPP PPP P PP PP Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPPP 120 >At5g06630.1 68418.m00749 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 440 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 105 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPLYYSPSPKVYYKSPPPPYVYSSPP 164 Query: 807 XPF 815 P+ Sbjct: 165 PPY 167 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 130 PPPYVYSSPPPLYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 189 Query: 807 XPF 815 P+ Sbjct: 190 PPY 192 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 155 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 214 Query: 807 XPF 815 P+ Sbjct: 215 PPY 217 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 180 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 239 Query: 807 XPF 815 P+ Sbjct: 240 PPY 242 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 205 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 264 Query: 807 XPF 815 P+ Sbjct: 265 PPY 267 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 230 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 289 Query: 807 XPF 815 P+ Sbjct: 290 PPY 292 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 255 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 314 Query: 807 XPF 815 P+ Sbjct: 315 PPY 317 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 280 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 339 Query: 807 XPF 815 P+ Sbjct: 340 PPY 342 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 305 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPNVYYKSPPPPYVYSSPP 364 Query: 807 XPF 815 P+ Sbjct: 365 PPY 367 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 355 PPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPP 414 Query: 807 XPF 815 P+ Sbjct: 415 PPY 417 Score = 33.9 bits (74), Expect = 0.14 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P P P PPP P P PP P PP Sbjct: 330 PPPYVYSSPPPPYYSPSPNVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPP 389 Query: 807 XPF 815 P+ Sbjct: 390 PPY 392 Score = 33.1 bits (72), Expect = 0.25 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P PP P PPP P PPP PP Sbjct: 80 PPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 139 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P + PP PP Sbjct: 140 PLYYSPSPKVYYKSPP--PP 157 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/63 (28%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 P P P P P P P PPP P P PP P PP Sbjct: 55 PKPYVYSSPPPPYYTPSPKVNYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPP 114 Query: 807 XPF 815 P+ Sbjct: 115 PPY 117 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 103 SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPLYYSPSP 147 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 153 SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 197 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 203 SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 247 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 253 SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 297 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 303 SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 347 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP--XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P P P +PPP PSP Sbjct: 378 SPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSP 422 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 387 SPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVTYKSPPPP 432 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 337 SPPPPYYSPSPNVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPP 382 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 62 SPPPPYYTPSPKVNYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPP 107 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 112 SPPPPYYSPSPKVYYKSPPPPYVYSSPPPLYYSPSPKVYYKSPPPP 157 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 162 SPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 207 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 212 SPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 257 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPP---XXPPXXXRAPLAPPPXXXPPSP 756 +PPPP P P P PP PP +P PP P Sbjct: 262 SPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 307 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/59 (28%), Positives = 18/59 (30%), Gaps = 3/59 (5%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX---PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 PPP P P P PP P PPP P PPP + P Sbjct: 380 PPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVTYKSPPPPYVYKTP 438 >At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar to RNA helicases GI:3775995, GI:3775987 from [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 616 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGR--GGXXXGGGPGGPXXGXGG 695 G G R GG GGG G GG GGG GG G GG Sbjct: 489 GIGSRSGGSFGGGMRDRGSSFGGRSGGGGYGGSSGGYGG 527 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +3 Query: 717 PPGPPPXXXPPLPXXXXP-PPPXPPXRXPPP 806 PP PPP PP P PPP PP P P Sbjct: 195 PPPPPPTPRPPRLLSSQPAPPPTPPVSLPSP 225 Score = 31.9 bits (69), Expect = 0.57 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAP 720 P PPPP PP P PP PP +P Sbjct: 193 PPPPPPPPTPRPPRLLSSQPAPPPTPPVSLPSP 225 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 34.3 bits (75), Expect = 0.11 Identities = 28/87 (32%), Positives = 28/87 (32%), Gaps = 13/87 (14%) Frame = +3 Query: 639 PXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP------PXXXPPLPXXXXPPPPX----PP 788 P P P P P P PP PP P P P PP PP Sbjct: 232 PQVNGLPRPFANGSMQPVPIPAPRQPPPPPPQVYQTQPPSWPSQPQQHSMVPPPMQFRPP 291 Query: 789 XRXPPPXP--FLAH-XXXGXXXPPSXP 860 PPP P FL H G PP P Sbjct: 292 QGMPPPPPPQFLNHQQGFGGPRPPPPP 318 Score = 32.7 bits (71), Expect = 0.32 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPP 750 P P P PPP P PP P + + PPP P Sbjct: 248 PVPIPAPRQPPPPPPQVYQTQPPSWPSQPQQHSMVPPPMQFRP 290 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP 779 P P P P P P P PPP P PPPP Sbjct: 252 PAPRQPPPPPPQVYQTQPPSWPSQPQQHSMVPPPMQFRPPQGMPPPPPP 300 >At2g10940.2 68415.m01168 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 291 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP 779 P P P P P P PP P GP PP P PPPP Sbjct: 147 PLPPISGLPIPPVVGPNLPL-PPLPIVGPILPPGTTPPATGGKDCPPPP 194 Score = 29.9 bits (64), Expect = 2.3 Identities = 21/89 (23%), Positives = 27/89 (30%), Gaps = 1/89 (1%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 P+ + PP P P P P P P P P+P P Sbjct: 77 PVPPVTIPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKL 136 Query: 777 PXPPXRXPP-PXPFLAHXXXGXXXPPSXP 860 P PP P P P ++ P+ P Sbjct: 137 PVPPVTVPKLPLPPISGLPIPPVVGPNLP 165 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/73 (26%), Positives = 22/73 (30%), Gaps = 1/73 (1%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 P+ + PP P P P P P P P P+P P Sbjct: 57 PVPPVTVPKLPVPPVTVPKLPVPPVTIPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKL 116 Query: 777 PXPPXRXPP-PXP 812 P PP P P P Sbjct: 117 PVPPVTVPKLPVP 129 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/73 (26%), Positives = 22/73 (30%), Gaps = 1/73 (1%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 P+ + PP P P P P P P P P+P P Sbjct: 67 PVPPVTVPKLPVPPVTIPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKL 126 Query: 777 PXPPXRXPP-PXP 812 P PP P P P Sbjct: 127 PVPPVTVPKLPVP 139 Score = 29.1 bits (62), Expect = 4.0 Identities = 19/73 (26%), Positives = 22/73 (30%), Gaps = 1/73 (1%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 P+ + PP P P P P P P P P+P P Sbjct: 47 PVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTIPKLPVPPVTVPKLPVPPVTVPKL 106 Query: 777 PXPPXRXPP-PXP 812 P PP P P P Sbjct: 107 PVPPVTVPKLPVP 119 Score = 29.1 bits (62), Expect = 4.0 Identities = 24/78 (30%), Positives = 26/78 (33%), Gaps = 8/78 (10%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXP----PXPXX-GP--PGPP-PXXXPPL 752 P+ + PP P P P P P P P GP P PP P P L Sbjct: 117 PVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPLPPISGLPIPPVVGPNLPLPPLPIVGPIL 176 Query: 753 PXXXXPPPPXPPXRXPPP 806 P PP PPP Sbjct: 177 PPGTTPPATGGKDCPPPP 194 >At2g10940.1 68415.m01167 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 291 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPP 779 P P P P P P PP P GP PP P PPPP Sbjct: 147 PLPPISGLPIPPVVGPNLPL-PPLPIVGPILPPGTTPPATGGKDCPPPP 194 Score = 29.9 bits (64), Expect = 2.3 Identities = 21/89 (23%), Positives = 27/89 (30%), Gaps = 1/89 (1%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 P+ + PP P P P P P P P P+P P Sbjct: 77 PVPPVTIPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKL 136 Query: 777 PXPPXRXPP-PXPFLAHXXXGXXXPPSXP 860 P PP P P P ++ P+ P Sbjct: 137 PVPPVTVPKLPLPPISGLPIPPVVGPNLP 165 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/73 (26%), Positives = 22/73 (30%), Gaps = 1/73 (1%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 P+ + PP P P P P P P P P+P P Sbjct: 57 PVPPVTVPKLPVPPVTVPKLPVPPVTIPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKL 116 Query: 777 PXPPXRXPP-PXP 812 P PP P P P Sbjct: 117 PVPPVTVPKLPVP 129 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/73 (26%), Positives = 22/73 (30%), Gaps = 1/73 (1%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 P+ + PP P P P P P P P P+P P Sbjct: 67 PVPPVTVPKLPVPPVTIPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKL 126 Query: 777 PXPPXRXPP-PXP 812 P PP P P P Sbjct: 127 PVPPVTVPKLPVP 139 Score = 29.1 bits (62), Expect = 4.0 Identities = 19/73 (26%), Positives = 22/73 (30%), Gaps = 1/73 (1%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPP 776 P+ + PP P P P P P P P P+P P Sbjct: 47 PVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTIPKLPVPPVTVPKLPVPPVTVPKL 106 Query: 777 PXPPXRXPP-PXP 812 P PP P P P Sbjct: 107 PVPPVTVPKLPVP 119 Score = 29.1 bits (62), Expect = 4.0 Identities = 24/78 (30%), Positives = 26/78 (33%), Gaps = 8/78 (10%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXP----PXPXX-GP--PGPP-PXXXPPL 752 P+ + PP P P P P P P P GP P PP P P L Sbjct: 117 PVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPLPPISGLPIPPVVGPNLPLPPLPIVGPIL 176 Query: 753 PXXXXPPPPXPPXRXPPP 806 P PP PPP Sbjct: 177 PPGTTPPATGGKDCPPPP 194 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +3 Query: 717 PPGPPPXXXPPLPXXXXP-PPPXPPXRXPP 803 PP PPP PPL PPP PP PP Sbjct: 44 PPPPPPPPPPPLYFSYFSLPPPPPPPHLPP 73 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP 747 P PPPP PPP PP PP P PP P Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPPP-----PHLPPTSVTP 78 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 687 PXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 P PP P PP PPP PPPP PP P Sbjct: 42 PHPPPPP---PPPPPPLY---FSYFSLPPPPPPPHLPP 73 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 768 PPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 P PP PP PPP F PP PP Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPPPPHLPP 73 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPX-PXXGPPGP-PPXXXPPLPXXXXPPPPXPPXRXP 800 PPP P +P P P PP P PPL PPP PP P Sbjct: 69 PPPPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSP 126 Score = 30.7 bits (66), Expect = 1.3 Identities = 22/80 (27%), Positives = 23/80 (28%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP---P 803 PP P P +P PP PPP PL P PP P P Sbjct: 40 PPSSSPSSAPPSSLSPSSPPPLSLSPSSPP-PPPPSSSPLSSLSPSLSPSPPSSSPSSAP 98 Query: 804 PXPFLAHXXXGXXXPPSXPP 863 P PS PP Sbjct: 99 PSSLSPSSPPPLSLSPSSPP 118 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +3 Query: 663 PXXXXPXAPXXPPX--PXXGPPGP-PPXXXPPLPXXXXPPPPXPPXRXP 800 P P PP P PP P PPL PPP PP P Sbjct: 29 PSSSSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSP 77 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 5/65 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXP---PXPXXGPPGPPPXXXPPLPXXXXPPPP--XPPXRX 797 PPP P P + P PP P PP PPP P Sbjct: 58 PPPLSLSPSSPPPPPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSP 117 Query: 798 PPPXP 812 PPP P Sbjct: 118 PPPPP 122 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 2/40 (5%) Frame = +3 Query: 699 PXPXXGPPGPPPXXXPPLPXXXXPPPP--XPPXRXPPPXP 812 P PP P PP PPP P PPP P Sbjct: 34 PSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPP 73 >At1g21310.1 68414.m02662 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 431 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 2/62 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPP--XRXPPP 806 PPP P P P P PP P PP P PPPP + PPP Sbjct: 350 PPPVKHYSPPPVYHSP-PPPKKHYVYKSPPPPVKHYSPP-PVYHSPPPPKEKYVYKSPPP 407 Query: 807 XP 812 P Sbjct: 408 PP 409 Score = 33.5 bits (73), Expect = 0.19 Identities = 21/68 (30%), Positives = 23/68 (33%), Gaps = 4/68 (5%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLP----XXXXPPPPXPPXR 794 + PPP P P PP P PP PP P PPPP Sbjct: 356 YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPVYHSPPPPKEKYVYKSPPPPPVHHY 413 Query: 795 XPPPXPFL 818 PP P+L Sbjct: 414 SPPHHPYL 421 Score = 33.1 bits (72), Expect = 0.25 Identities = 26/93 (27%), Positives = 27/93 (29%), Gaps = 8/93 (8%) Frame = +3 Query: 597 PINHIXXXXXHXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLP----XXX 764 P+ H H PP P P PP P PP PP P Sbjct: 37 PVKHYTPPVKHYSPPPVYHSPPPPKKH-YEYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 95 Query: 765 XPPPPXPPXRXPP----PXPFLAHXXXGXXXPP 851 PPPP PP P P H PP Sbjct: 96 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 128 Score = 32.7 bits (71), Expect = 0.32 Identities = 22/79 (27%), Positives = 23/79 (29%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 H PP P P P P PP P PP P PPPP P Sbjct: 40 HYTPPVKHYSPPPVYHSPPPPKKH-YEYKSPPPPVKHYSPP-PVYHSPPPPKKHYVYKSP 97 Query: 807 XPFLAHXXXGXXXPPSXPP 863 P + H PP Sbjct: 98 PPPVKHYSPPPVYHSPPPP 116 Score = 32.7 bits (71), Expect = 0.32 Identities = 22/77 (28%), Positives = 23/77 (29%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P PP P PP P PPPP P P Sbjct: 70 PPPVKHYSPPPVYHSPPPPKKH-YVYKSPPPPVKHYSPP-PVYHSPPPPKKHYVYKSPPP 127 Query: 813 FLAHXXXGXXXPPSXPP 863 + H PP Sbjct: 128 PVKHYSPPPVYHSPPPP 144 Score = 32.7 bits (71), Expect = 0.32 Identities = 22/77 (28%), Positives = 23/77 (29%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P PP P PP P PPPP P P Sbjct: 98 PPPVKHYSPPPVYHSPPPPKKH-YVYKSPPPPVKHYSPP-PVYHSPPPPKKHYVYKSPPP 155 Query: 813 FLAHXXXGXXXPPSXPP 863 + H PP Sbjct: 156 PVKHYSPPPVYHSPPPP 172 Score = 32.7 bits (71), Expect = 0.32 Identities = 22/77 (28%), Positives = 23/77 (29%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P PP P PP P PPPP P P Sbjct: 126 PPPVKHYSPPPVYHSPPPPKKH-YVYKSPPPPVKHYSPP-PVYHSPPPPKKHYVYKSPPP 183 Query: 813 FLAHXXXGXXXPPSXPP 863 + H PP Sbjct: 184 PVKHYSPPPVYHSPPPP 200 Score = 32.7 bits (71), Expect = 0.32 Identities = 22/77 (28%), Positives = 23/77 (29%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P PP P PP P PPPP P P Sbjct: 154 PPPVKHYSPPPVYHSPPPPKKH-YVYKSPPPPVKHYSPP-PVYHSPPPPKKHYVYKSPPP 211 Query: 813 FLAHXXXGXXXPPSXPP 863 + H PP Sbjct: 212 PVKHYSPPPVYHSPPPP 228 Score = 32.7 bits (71), Expect = 0.32 Identities = 22/77 (28%), Positives = 23/77 (29%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P PP P PP P PPPP P P Sbjct: 182 PPPVKHYSPPPVYHSPPPPKKH-YVYKSPPPPVKHYSPP-PVYHSPPPPKKHYVYKSPPP 239 Query: 813 FLAHXXXGXXXPPSXPP 863 + H PP Sbjct: 240 PVKHYSPPPVYHSPPPP 256 Score = 32.7 bits (71), Expect = 0.32 Identities = 22/77 (28%), Positives = 23/77 (29%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P PP P PP P PPPP P P Sbjct: 210 PPPVKHYSPPPVYHSPPPPKKH-YVYKSPPPPVKHYSPP-PVYHSPPPPKKHYVYKSPPP 267 Query: 813 FLAHXXXGXXXPPSXPP 863 + H PP Sbjct: 268 PVKHYSPPPVYHSPPPP 284 Score = 32.7 bits (71), Expect = 0.32 Identities = 22/77 (28%), Positives = 23/77 (29%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P PP P PP P PPPP P P Sbjct: 238 PPPVKHYSPPPVYHSPPPPKKH-YVYKSPPPPVKHYSPP-PVYHSPPPPKKHYVYKSPPP 295 Query: 813 FLAHXXXGXXXPPSXPP 863 + H PP Sbjct: 296 PVKHYSPPPVYHSPPPP 312 Score = 32.7 bits (71), Expect = 0.32 Identities = 22/77 (28%), Positives = 23/77 (29%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P PP P PP P PPPP P P Sbjct: 266 PPPVKHYSPPPVYHSPPPPKKH-YVYKSPPPPVKHYSPP-PVYHSPPPPKKHYVYKSPPP 323 Query: 813 FLAHXXXGXXXPPSXPP 863 + H PP Sbjct: 324 PVKHYSPPPVYHSPPPP 340 Score = 32.7 bits (71), Expect = 0.32 Identities = 22/77 (28%), Positives = 23/77 (29%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P PP P PP P PPPP P P Sbjct: 294 PPPVKHYSPPPVYHSPPPPKKH-YVYKSPPPPVKHYSPP-PVYHSPPPPKKHYVYKSPPP 351 Query: 813 FLAHXXXGXXXPPSXPP 863 + H PP Sbjct: 352 PVKHYSPPPVYHSPPPP 368 Score = 32.7 bits (71), Expect = 0.32 Identities = 22/77 (28%), Positives = 23/77 (29%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P P P PP P PP P PPPP P P Sbjct: 322 PPPVKHYSPPPVYHSPPPPKKH-YVYKSPPPPVKHYSPP-PVYHSPPPPKKHYVYKSPPP 379 Query: 813 FLAHXXXGXXXPPSXPP 863 + H PP Sbjct: 380 PVKHYSPPPVYHSPPPP 396 Score = 31.9 bits (69), Expect = 0.57 Identities = 24/84 (28%), Positives = 26/84 (30%), Gaps = 9/84 (10%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLP----XXXXPPPP----- 779 + PPP P P PP P PP PP P PPPP Sbjct: 328 YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPVYHSPPPPKKHYVYKSPPPPVKHYS 385 Query: 780 XPPXRXPPPXPFLAHXXXGXXXPP 851 PP PP P + PP Sbjct: 386 PPPVYHSPPPPKEKYVYKSPPPPP 409 Score = 31.9 bits (69), Expect = 0.57 Identities = 21/78 (26%), Positives = 23/78 (29%), Gaps = 5/78 (6%) Frame = +3 Query: 597 PINHIXXXXX-HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXX----PPLPXX 761 P+ H H PPP P PP PP P PP P Sbjct: 352 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKEKYVYKSPPPPPVH 411 Query: 762 XXPPPPXPPXRXPPPXPF 815 PP P PP P+ Sbjct: 412 HYSPPHHPYLYKSPPPPY 429 Score = 31.1 bits (67), Expect = 0.99 Identities = 24/83 (28%), Positives = 25/83 (30%), Gaps = 8/83 (9%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLP----XXXXPPPPXPPXR 794 + PPP P P PP P PP PP P PPPP Sbjct: 76 YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPVYHSPPPPKKHYVYKSPPPPVKHYS 133 Query: 795 XPP----PXPFLAHXXXGXXXPP 851 PP P P H PP Sbjct: 134 PPPVYHSPPPPKKHYVYKSPPPP 156 Score = 31.1 bits (67), Expect = 0.99 Identities = 24/83 (28%), Positives = 25/83 (30%), Gaps = 8/83 (9%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLP----XXXXPPPPXPPXR 794 + PPP P P PP P PP PP P PPPP Sbjct: 104 YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPVYHSPPPPKKHYVYKSPPPPVKHYS 161 Query: 795 XPP----PXPFLAHXXXGXXXPP 851 PP P P H PP Sbjct: 162 PPPVYHSPPPPKKHYVYKSPPPP 184 Score = 31.1 bits (67), Expect = 0.99 Identities = 24/83 (28%), Positives = 25/83 (30%), Gaps = 8/83 (9%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLP----XXXXPPPPXPPXR 794 + PPP P P PP P PP PP P PPPP Sbjct: 132 YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPVYHSPPPPKKHYVYKSPPPPVKHYS 189 Query: 795 XPP----PXPFLAHXXXGXXXPP 851 PP P P H PP Sbjct: 190 PPPVYHSPPPPKKHYVYKSPPPP 212 Score = 31.1 bits (67), Expect = 0.99 Identities = 24/83 (28%), Positives = 25/83 (30%), Gaps = 8/83 (9%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLP----XXXXPPPPXPPXR 794 + PPP P P PP P PP PP P PPPP Sbjct: 160 YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPVYHSPPPPKKHYVYKSPPPPVKHYS 217 Query: 795 XPP----PXPFLAHXXXGXXXPP 851 PP P P H PP Sbjct: 218 PPPVYHSPPPPKKHYVYKSPPPP 240 Score = 31.1 bits (67), Expect = 0.99 Identities = 24/83 (28%), Positives = 25/83 (30%), Gaps = 8/83 (9%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLP----XXXXPPPPXPPXR 794 + PPP P P PP P PP PP P PPPP Sbjct: 188 YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPVYHSPPPPKKHYVYKSPPPPVKHYS 245 Query: 795 XPP----PXPFLAHXXXGXXXPP 851 PP P P H PP Sbjct: 246 PPPVYHSPPPPKKHYVYKSPPPP 268 Score = 31.1 bits (67), Expect = 0.99 Identities = 24/83 (28%), Positives = 25/83 (30%), Gaps = 8/83 (9%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLP----XXXXPPPPXPPXR 794 + PPP P P PP P PP PP P PPPP Sbjct: 216 YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPVYHSPPPPKKHYVYKSPPPPVKHYS 273 Query: 795 XPP----PXPFLAHXXXGXXXPP 851 PP P P H PP Sbjct: 274 PPPVYHSPPPPKKHYVYKSPPPP 296 Score = 31.1 bits (67), Expect = 0.99 Identities = 24/83 (28%), Positives = 25/83 (30%), Gaps = 8/83 (9%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLP----XXXXPPPPXPPXR 794 + PPP P P PP P PP PP P PPPP Sbjct: 244 YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPVYHSPPPPKKHYVYKSPPPPVKHYS 301 Query: 795 XPP----PXPFLAHXXXGXXXPP 851 PP P P H PP Sbjct: 302 PPPVYHSPPPPKKHYVYKSPPPP 324 Score = 31.1 bits (67), Expect = 0.99 Identities = 24/83 (28%), Positives = 25/83 (30%), Gaps = 8/83 (9%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLP----XXXXPPPPXPPXR 794 + PPP P P PP P PP PP P PPPP Sbjct: 272 YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPVYHSPPPPKKHYVYKSPPPPVKHYS 329 Query: 795 XPP----PXPFLAHXXXGXXXPP 851 PP P P H PP Sbjct: 330 PPPVYHSPPPPKKHYVYKSPPPP 352 Score = 31.1 bits (67), Expect = 0.99 Identities = 24/83 (28%), Positives = 25/83 (30%), Gaps = 8/83 (9%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLP----XXXXPPPPXPPXR 794 + PPP P P PP P PP PP P PPPP Sbjct: 300 YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPVYHSPPPPKKHYVYKSPPPPVKHYS 357 Query: 795 XPP----PXPFLAHXXXGXXXPP 851 PP P P H PP Sbjct: 358 PPPVYHSPPPPKKHYVYKSPPPP 380 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/74 (24%), Positives = 24/74 (32%), Gaps = 5/74 (6%) Frame = +2 Query: 572 VVVXYTSXTNKSYXFXXPXXPPPPPXXXPPXXXXXPP-----GPXXXXXXXXXXXXXXXX 736 + + + S + +Y + P PPP PP PP P Sbjct: 17 ISLTFVSQSTANYFYSSP--PPPVKHYTPPVKHYSPPPVYHSPPPPKKHYEYKSPPPPVK 74 Query: 737 XXXPPPXXXGPPPP 778 PPP PPPP Sbjct: 75 HYSPPPVYHSPPPP 88 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 33.9 bits (74), Expect = 0.14 Identities = 23/62 (37%), Positives = 24/62 (38%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG P G GG GG GGG G G GG GG G G G+ Sbjct: 53 GGVGGGVSGPGGNLGYGGFGGA--GGGLGGG--LGGGAGSGLGGGLGGGSGIGAGTSGGS 108 Query: 682 XG 677 G Sbjct: 109 TG 110 Score = 32.7 bits (71), Expect = 0.32 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 5/65 (7%) Frame = -3 Query: 811 GXGGGXRXGG-----XGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXX 647 G GGG G GG G G GG GG GG G GG G G G Sbjct: 37 GYGGGYSGVGDNGLPFGGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGG 96 Query: 646 XXGGG 632 G G Sbjct: 97 GSGIG 101 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G G GG GGG GG GG G GG G G GG G Sbjct: 61 GPGGNLGYGGFGGAGGGLGG-GLGGGAGSGLGGGLGGGSGIGAGTSGGSTG 110 Score = 30.3 bits (65), Expect = 1.7 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = -3 Query: 799 GXRXGGXGGGGXXXXGR---GGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 G GG GGG G GG GG G G G G G G G GG Sbjct: 49 GLPFGGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGGGSGIGAGTSGG 107 Score = 29.1 bits (62), Expect = 4.0 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -1 Query: 771 GGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGG-GGXXG 622 G P GG GG G GG G GG G GGG GG G Sbjct: 49 GLPFGGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGGGSG 99 >At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibrillarin 2 GI:9965655 from [Arabidopsis thaliana] Length = 320 Score = 33.9 bits (74), Expect = 0.14 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 G GGG GG G GG GRG GG GG G GG G G G GG Sbjct: 7 GSGGGFS-GGRGRGGYSG-GRGDGGFSGGRGGG--GRGGGRGFSDRGGRGRGRGPPRGG 61 Score = 32.7 bits (71), Expect = 0.32 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXG 662 G G G GG GGGG GRG GG G GG G G G Sbjct: 24 GRGDGGFSGGRGGGGR-GGGRGFSDRGGRGRGRGPPRGGARGGRGPAGRG 72 Score = 29.1 bits (62), Expect = 4.0 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 2/62 (3%) Frame = -3 Query: 814 KGXGG--GXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXX 641 +G GG G R G GG GRGG GG G G G G Sbjct: 16 RGRGGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGPPRGGARGGRGPAGRGGMK 75 Query: 640 GG 635 GG Sbjct: 76 GG 77 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXG--GGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG G GG G GG+GG GG G G GG G G Sbjct: 14 GGRGRGGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGPPRGGARGGRG 67 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 33.9 bits (74), Expect = 0.14 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGG 716 G GGG GG GGG G GG GGG GG Sbjct: 122 GGGGGYSYGGGGGG---YGGGGGGYGGGGDGG 150 Score = 32.3 bits (70), Expect = 0.43 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 778 GGGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 GGGG G GG GGG GG G G G Sbjct: 122 GGGGGYSYGGGGGGYGGGGGGYGGGGDGGGG 152 Score = 32.3 bits (70), Expect = 0.43 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGG 676 GGGG GGG GGG GG GG G GG Sbjct: 122 GGGGGYSYGGGGGGYGGGGGG---YGGGGDGGGG 152 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 689 GGXGXXXXGXGGGXXXGGGGVXG 621 GG G G GGG GGGG G Sbjct: 123 GGGGYSYGGGGGGYGGGGGGYGG 145 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -3 Query: 793 RXGGXGGGGXXXXGRGGXXXGGGP-GGPXXGXGG 695 R G GGG G GG GGG GG G GG Sbjct: 119 RAYGGGGGYSYGGGGGGYGGGGGGYGGGGDGGGG 152 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 689 GGXGXXXXGXGGGXXXGGGGVXG 621 GG G G GGG GGGG G Sbjct: 122 GGGGGYSYGGGGGGYGGGGGGYG 144 Score = 24.6 bits (51), Expect(2) = 3.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -2 Query: 689 GGXGXXXXGXGGGXXXGGG 633 GG G G GGG GGG Sbjct: 134 GGYGGGGGGYGGGGDGGGG 152 Score = 23.4 bits (48), Expect(2) = 3.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -2 Query: 803 WGXAGGWXXGGGXPXXGEGG 744 +G GG+ GGG G GG Sbjct: 121 YGGGGGYSYGGGGGGYGGGG 140 >At3g07100.1 68416.m00845 protein transport protein Sec24, putative similar to protein transport protein Sec24A (SEC24-related protein) [Homo sapiens] SWISS-PROT:O95486 Length = 1038 Score = 33.9 bits (74), Expect = 0.14 Identities = 22/75 (29%), Positives = 23/75 (30%), Gaps = 3/75 (4%) Frame = +3 Query: 636 PPXXXXXPX-PXXXXPXAPXXPPXPXXGPPGPPPXXXPP--LPXXXXPPPPXPPXRXPPP 806 PP P P P P P P P PP P P PP P + PP Sbjct: 67 PPVGTMRPGQPSPFVSQIPGSRPPPPSSNSFPSPAYGPPGGAPFQRFPSPPFPTTQNPPQ 126 Query: 807 XPFLAHXXXGXXXPP 851 P G PP Sbjct: 127 GPPPPQTLAGHLSPP 141 Score = 33.9 bits (74), Expect = 0.14 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P P P + P P GPPG P P P P PP PPP Sbjct: 77 PSPFVSQIPGSRPPPPSSNSFPS-PAYGPPGGAPFQRFPSPPF--PTTQNPPQGPPPPQT 133 Query: 813 FLAHXXXGXXXPPSXP 860 H P P Sbjct: 134 LAGHLSPPMSLRPQQP 149 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/48 (33%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +3 Query: 720 PGPPPXXXPPLPXXXXPPPPXPPX---RXPPPXPFLAHXXXGXXXPPS 854 P P P P PPP PP R P PF++ PPS Sbjct: 46 PFTPSASQPTRPFTASGPPPAPPVGTMRPGQPSPFVSQIPGSRPPPPS 93 >At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) Length = 130 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/48 (33%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +1 Query: 622 PXTPPPPXXXPPPX---PXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PPP P P P P P PP +P + P PP+P Sbjct: 36 PVATPPPAATPAPTTTPPPAVSPAPTSSPPSSAPSPSSDAPTASPPAP 83 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 634 PPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP 747 PPP PPP P PP AP + PP P Sbjct: 34 PPPVATPPPAATPAPTTTP--PPAVSPAPTSSPPSSAP 69 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 33.5 bits (73), Expect = 0.19 Identities = 24/74 (32%), Positives = 24/74 (32%), Gaps = 16/74 (21%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPP---------------LPXXXXPP-PPXPPXRXPPPX 809 P AP PP P G PP PP P PP P P PPP Sbjct: 562 PIAPPGPPAPQPPTQGYPPSNQPPGAYPSQQYATGGYSTAPVPWGPPVPSYSPYALPPPP 621 Query: 810 PFLAHXXXGXXXPP 851 P H G PP Sbjct: 622 PGSYHPVHGQHMPP 635 Score = 32.7 bits (71), Expect = 0.32 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 8/67 (11%) Frame = +3 Query: 687 PXXPPXPXXGP---PGPPPXXXPPLPXXXXPP-----PPXPPXRXPPPXPFLAHXXXGXX 842 P PP P P P PPP P+ PP PP PP P P Sbjct: 604 PWGPPVPSYSPYALPPPPPGSYHPVHGQHMPPYGMQYPPPPPHVTQAPPPGTTQNPSSSE 663 Query: 843 XPPSXPP 863 S PP Sbjct: 664 PQQSFPP 670 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 33.5 bits (73), Expect = 0.19 Identities = 24/74 (32%), Positives = 24/74 (32%), Gaps = 16/74 (21%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPP---------------LPXXXXPP-PPXPPXRXPPPX 809 P AP PP P G PP PP P PP P P PPP Sbjct: 562 PIAPPGPPAPQPPTQGYPPSNQPPGAYPSQQYATGGYSTAPVPWGPPVPSYSPYALPPPP 621 Query: 810 PFLAHXXXGXXXPP 851 P H G PP Sbjct: 622 PGSYHPVHGQHMPP 635 Score = 32.7 bits (71), Expect = 0.32 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 8/67 (11%) Frame = +3 Query: 687 PXXPPXPXXGP---PGPPPXXXPPLPXXXXPP-----PPXPPXRXPPPXPFLAHXXXGXX 842 P PP P P P PPP P+ PP PP PP P P Sbjct: 604 PWGPPVPSYSPYALPPPPPGSYHPVHGQHMPPYGMQYPPPPPHVTQAPPPGTTQNPSSSE 663 Query: 843 XPPSXPP 863 S PP Sbjct: 664 PQQSFPP 670 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 33.5 bits (73), Expect = 0.19 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 687 PXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPP 788 P P PP PPP P P PPPP PP Sbjct: 42 PCSPVQSSPPPPSPPP---PSTPTTACPPPPSPP 72 Score = 31.5 bits (68), Expect = 0.75 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 +PPPP PP P P PP P + PP Sbjct: 49 SPPPPSPPPPSTPTTACPPPPSPPSSGGGSSYYYPP 84 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 655 PPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSPXXG 765 P P P PP PP PPP PPS G Sbjct: 42 PCSPVQSSPPPPSPPPPSTPTTACPPP-PSPPSSGGG 77 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 33.5 bits (73), Expect = 0.19 Identities = 18/45 (40%), Positives = 20/45 (44%) Frame = +3 Query: 720 PGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPS 854 P PPP PP+ PPPP PP PP A+ PPS Sbjct: 37 PPPPPVYSPPI----SPPPPPPP--PPPQSHAAAYKRYSPPPPPS 75 Score = 33.5 bits (73), Expect = 0.19 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P P +P PP PP PP PPPP R PP P Sbjct: 39 PPPVYSPPISPPPPP-----PPPPPQSHAAAYKRYSPPPPPSKYGRVYPPPP 85 Score = 31.9 bits (69), Expect = 0.57 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 PPPP PP P P PP +PPP PPS Sbjct: 38 PPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPP---PPS 75 Score = 31.5 bits (68), Expect = 0.75 Identities = 20/73 (27%), Positives = 23/73 (31%), Gaps = 3/73 (4%) Frame = +2 Query: 569 IVVVXYTSXTNKSYXFXXPXXPPPPPXXXPPXXXXXPPGPXXXXXXXXXXXXXXXXXXXP 748 I++ N+ PPPPP PP PP P P Sbjct: 16 ILITVANGNDNRKLLTSYKYSPPPPPVYSPP---ISPPPPPPPPPPQSHAAAYKRYSPPP 72 Query: 749 PPXXXG---PPPP 778 PP G PPPP Sbjct: 73 PPSKYGRVYPPPP 85 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 732 GGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GG GG GG G GG GG GGGG G Sbjct: 779 GGHHGGGGCGGGHHGGGGGGCGGCGGGGCGGGGDGGG 815 Score = 32.3 bits (70), Expect = 0.43 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGG 716 GGG G GGGG G GG GGG G Sbjct: 784 GGGCGGGHHGGGGGGCGGCGGGGCGGGGDG 813 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -3 Query: 817 RKGXGGGXRXGGXGGGGXXXXGRGGXXXG-GGPGGPXXGXGGXXG 686 R G G GGGG GG G GG GG G GG G Sbjct: 770 RHHHAGYHHGGHHGGGGCGGGHHGGGGGGCGGCGGGGCGGGGDGG 814 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRG-GXXXGGGPGGPXXGXG 698 GG GG GGG G G G GGG GG G G Sbjct: 779 GGHHGGGGCGGGHHGGGGGGCGGCGGGGCGGGGDGGG 815 >At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi domain-containing protein contains Pfam profiles PF02170: PAZ domain, PF02171: Piwi domain Length = 1194 Score = 33.5 bits (73), Expect = 0.19 Identities = 23/62 (37%), Positives = 24/62 (38%), Gaps = 1/62 (1%) Frame = -3 Query: 814 KGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPG-GPXXGXGGXXGAXGXXXXGXGXXXXXG 638 +G GGG G G GRGG G G G G GG G G G G G Sbjct: 14 RGRGGGGDRGRGYSGRGDGRGRGGDGDRGYSGRGDGHGRGG-GGDRGRGYSGRGDGRGRG 72 Query: 637 GG 632 GG Sbjct: 73 GG 74 Score = 31.1 bits (67), Expect = 0.99 Identities = 18/58 (31%), Positives = 20/58 (34%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXGXXXIYD 604 GGGG G G G+GG G G G GG G G G + D Sbjct: 53 GGGGDRGRGYSGRGDGRGRGGGGDRGRGYSGRGDGHGRGGGGDRGRGYSGRGRGFVQD 110 Score = 29.1 bits (62), Expect = 4.0 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXG 656 GGG R G G G GRGG GG G G G G G G G Sbjct: 54 GGGDRGRGYSGRGDG-RGRGG---GGDRGRGYSGRGDGHGRGGGGDRGRG 99 Score = 28.3 bits (60), Expect = 7.0 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = -3 Query: 787 GGXGGGGXXXXGR-GGXXXGGGPGGPXXGXG-GXXGAXGXXXXGXGXXXXXGG 635 GG GG GR GG G G G G G G G G G G GG Sbjct: 4 GGYRGGRGDGRGRGGGGDRGRGYSGRGDGRGRGGDGDRGYSGRGDGHGRGGGG 56 >At5g25550.1 68418.m03040 leucine-rich repeat family protein / extensin family protein similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana]; contains Pfam PF00560: Leucine Rich Repeat domains Length = 433 Score = 33.1 bits (72), Expect = 0.25 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = +3 Query: 696 PPXPXXGPPGPP--PXXXPPLPXXXXPPP--PXPPXRXPPPXPFLA 821 PP P P P P P PPP P PP PPP P L+ Sbjct: 382 PPPSQISPSSQPLAPAPSPTSPPLSTPPPARPCPPVYSPPPPPPLS 427 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXX-GPPGPPPXXXPPLPXXXXPPPPXP 785 P P P + P P PP P P P PPPP P Sbjct: 382 PPPSQISPSSQPLAPAPSPTSPPLSTPPPARPCPPVYSPPPPPP 425 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/42 (33%), Positives = 14/42 (33%), Gaps = 1/42 (2%) Frame = +1 Query: 634 PPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAP-PPXXXPPSP 756 PPP P P PP P P PP PP P Sbjct: 382 PPPSQISPSSQPLAPAPSPTSPPLSTPPPARPCPPVYSPPPP 423 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 33.1 bits (72), Expect = 0.25 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 14/56 (25%) Frame = +3 Query: 687 PXXPPXPXXGPPGPPPXXX--------------PPLPXXXXPPPPXPPXRXPPPXP 812 P PP P PP PP PP P PPPP PP PPP P Sbjct: 33 PYTPPPPQLPPPLPPSSYGLSPTEPRVFTFFNIPPHPMMFSPPPPQPP--PPPPRP 86 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P TPPPP PPP P P P + P P P P Sbjct: 33 PYTPPPP-QLPPPLPPSSYGLSPTEPRVFTFFNIPPHPMMFSPPP 76 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/58 (27%), Positives = 16/58 (27%) Frame = +2 Query: 605 SYXFXXPXXPPPPPXXXPPXXXXXPPGPXXXXXXXXXXXXXXXXXXXPPPXXXGPPPP 778 S F P PPPP P P PPP PPPP Sbjct: 27 SSGFHFPYTPPPPQLPPPLPPSSYGLSPTEPRVFTFFNIPPHPMMFSPPPPQPPPPPP 84 >At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar to RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF00397: WW domain Length = 1088 Score = 33.1 bits (72), Expect = 0.25 Identities = 22/65 (33%), Positives = 23/65 (35%) Frame = -3 Query: 850 GGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXX 671 GG P R+G R GGG G G GGG G G GG G G Sbjct: 817 GGGGGPGYSQDRRGMVN--RFDSGGGGTRWDSGGGFGGRGGGFSGREGGFGGREGGFGGR 874 Query: 670 XXGXG 656 G G Sbjct: 875 EGGFG 879 Score = 31.5 bits (68), Expect = 0.75 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GGG GGG G GG GG GG GG GG G Sbjct: 839 GGGTRWDSGGGFGGRGGGFSG--REGGFGGREGGFGGREGG--FGGRGGRFG 886 >At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ boundaries domain protein 18 (LBD18) identical to LOB DOMAIN 18 [Arabidopsis thaliana] GI:17227164; supported by full-length cDNA gi:17227163 Length = 262 Score = 33.1 bits (72), Expect = 0.25 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GGG GGGG G G GG GG G GG GA Sbjct: 3 GGGNTITAVGGGGGGCGGGGSSGGGGSSGG---GGGGPCGA 40 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXG 731 G GGG GG GGG G GG G Sbjct: 13 GGGGGCGGGGSSGGGGSSGGGGGGPCG 39 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 732 GGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG GG GG GG GGGGG G Sbjct: 3 GGGNTITAVGGGGGGCGGGGSSGGGGSSGGGGGGPCG 39 >At2g11005.1 68415.m01177 glycine-rich protein Length = 170 Score = 33.1 bits (72), Expect = 0.25 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = -3 Query: 823 WARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGG---PGGPXXGXGGXXGAXG 677 W G GGG GG G G GG GGG G GG G G Sbjct: 9 WFGSGDGGGSGGGGGSGDGSGSGDGGGSGDGGGSRDSDGSGDSSGGGSGDSG 60 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGG 634 GGG GG G G GG GG G GG GG Sbjct: 15 GGGSGGGGGSGDGSGSGDGGGSGDGGGSRDSDGSGDSSGGGSGDSGG 61 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = -3 Query: 787 GGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 G GGG G G G G GG GG + G G GG Sbjct: 11 GSGDGGGSGGGGGSGDGSGSGDGGGSGDGGGSRDSDGSGDSSGGGSGDSGG 61 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGG G G G GG GG G GG GG G Sbjct: 15 GGGSGGGGGSGDGSGSGDGGGSGDGGGSRDSDGSGDSSGGGSGDSGGFG 63 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/50 (34%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -3 Query: 823 WARKGXGGGXRXGGXGGGGXXXXGRG-GXXXGGGPGGPXXGXGGXXGAXG 677 + +K G GG GGGG G G G G G GG G + G Sbjct: 4 YVKKWWFGSGDGGGSGGGGGSGDGSGSGDGGGSGDGGGSRDSDGSGDSSG 53 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 G G GG G G G GG G G G GGG G G Sbjct: 11 GSGDGGGSGGGGGSGDGSGS-GDGGGSGDGGGSRDSDGSGDSSGGGSGDSG 60 Score = 28.3 bits (60), Expect = 7.0 Identities = 21/77 (27%), Positives = 23/77 (29%) Frame = -3 Query: 862 GGXEGGXXXPXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGA 683 GG GG + G GGG G GGG G G GG G + Sbjct: 15 GGGSGGGGGSGDG-SGSGDGGG---SGDGGGSRDSDGSGDSSGGGSGDSGGFGDNSDNNS 70 Query: 682 XGXXXXGXGXXXXXGGG 632 G G G G Sbjct: 71 VSSDSSGGGSRDGGGSG 87 >At1g63550.1 68414.m07184 hypothetical protein low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 299 Score = 33.1 bits (72), Expect = 0.25 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +3 Query: 696 PPXPXXGPP-GPPPXXXPPLPXXXXPPPP---XPPXRXPPP 806 PP P PP PPP PP P PP PP P P Sbjct: 227 PPSPSAPPPRSPPPKSSPPSSLPQTPSPPLVFTPPQNVPNP 267 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +1 Query: 628 TPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 +PPP PPP PP P PL P P+P Sbjct: 225 SPPPSPSAPPPRSPPPKSSPPSSLPQTPSPPLVFTPPQNVPNP 267 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +3 Query: 705 PXXGPPGPPPXXXPP--LPXXXXPPPPXPPXRXPPP 806 P P PPP PP P P P PP PP Sbjct: 226 PPPSPSAPPPRSPPPKSSPPSSLPQTPSPPLVFTPP 261 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 33.1 bits (72), Expect = 0.25 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = -1 Query: 783 EXGGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 + GGG G G GGG+G G G GG GG G GG G Sbjct: 484 DSSGGGGFGRGNGRFGSGGGRG--RDGGRGRFGSGGGRGRDGGRGRFGSGGGRG 535 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXG 677 G G G G GGG GRG GGG G G G G+ G Sbjct: 490 GFGRGNGRFGSGGGRGRDGGRGRFGSGGGRG--RDGGRGRFGSGG 532 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 814 KGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPG 719 +G GG G GGG GRG GGG G Sbjct: 504 RGRDGGRGRFGSGGGRGRDGGRGRFGSGGGRG 535 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 32.7 bits (71), Expect = 0.32 Identities = 24/77 (31%), Positives = 25/77 (32%), Gaps = 1/77 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP-PX 809 PPP P P P PPG PP P PPP P PP Sbjct: 174 PPPYGMRPPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPP-PHGMQGPPPSRPGMPPPGGA 232 Query: 810 PFLAHXXXGXXXPPSXP 860 P A G PP+ P Sbjct: 233 PMFAPPHPG--MPPAPP 247 Score = 31.5 bits (68), Expect = 0.75 Identities = 23/74 (31%), Positives = 23/74 (31%) Frame = +3 Query: 639 PXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFL 818 P P P P P PGPPP PPP R PPP Sbjct: 157 PPGQMPPQPPFAGQGGPPPPYGMRPPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPP---- 212 Query: 819 AHXXXGXXXPPSXP 860 H G PPS P Sbjct: 213 PHGMQG--PPPSRP 224 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +3 Query: 699 PXPXXGPPGPPPXXXPPLPXXXXPPPP---XPPXRXPPPXPFLAHXXXGXXXPP 851 P PPG P PP PPPP PP PPP + PP Sbjct: 151 PPQIIRPPGQMP-PQPPFAGQGGPPPPYGMRPPYPGPPPPQYGGQQRPMMIPPP 203 Score = 30.3 bits (65), Expect = 1.7 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 7/55 (12%) Frame = +3 Query: 663 PXXXXPXAPXXPPXPXXGPPGPPP--XXXPPLPXXXXPPPP-----XPPXRXPPP 806 P P P P G GPPP PP P PPPP P PPP Sbjct: 152 PQIIRPPGQMPPQPPFAGQGGPPPPYGMRPPYP---GPPPPQYGGQQRPMMIPPP 203 >At5g07150.1 68418.m00815 leucine-rich repeat family protein contains weak similarity to LRR receptor-like protein kinase [Nicotiana tabacum] gi|7672732|gb|AAF66615; contains Pfam PF00560 domain Leucine Rich Repeat Length = 553 Score = 32.7 bits (71), Expect = 0.32 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 3/61 (4%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXA-PXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PPP P P P P PP G P P P PPP PP P Sbjct: 150 PPPSQPSPPSPMEEVPIDFPFFFAPPPQNIGASPPTETQVIPNPSPVPPPPAQPPPAQTP 209 Query: 804 P 806 P Sbjct: 210 P 210 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 32.7 bits (71), Expect = 0.32 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +3 Query: 687 PXXPPX-PXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P PP P PP PP P P PP PP + P P P Sbjct: 32 PSHPPIQPSSQPPTQPPSQPPTQP--PTQPPSHPPTQPPTPPP 72 Score = 32.3 bits (70), Expect = 0.43 Identities = 20/63 (31%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPX-PXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PP P P PP P PP PP P P PPP P + P P Sbjct: 27 PPSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQP--PTPPPSQSPSQPSPLPP 84 Query: 813 FLA 821 +A Sbjct: 85 NIA 87 Score = 31.1 bits (67), Expect = 0.99 Identities = 18/62 (29%), Positives = 19/62 (30%), Gaps = 2/62 (3%) Frame = +3 Query: 684 APXXPPXPXXGPPGPPPXXXPPLPXXXXPP--PPXPPXRXPPPXPFLAHXXXGXXXPPSX 857 +P PP P P PP PP PP P PP P P Sbjct: 23 SPTRPPSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSPSQPSPL 82 Query: 858 PP 863 PP Sbjct: 83 PP 84 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/54 (29%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXP--PPPXPP 788 PP P P P PP PP P P P P P PP Sbjct: 31 PPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSPSQPSPLPP 84 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 817 RKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXG 704 RKG + GG GGG G G GG GGP G Sbjct: 49 RKGSKPNKKWGGGMGGGGGGGGGSGGGGGGRGGGPPRG 86 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 835 PXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGG 725 P W G GGG GG GG G GRGG GG Sbjct: 54 PNKKWGG-GMGGGG--GGGGGSGGGGGGRGGGPPRGG 87 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGG 697 G GG GGG GGG+GG GG Sbjct: 61 GMGGGGGGGGGSGGGGGGRGGGPPRGG 87 >At3g07540.1 68416.m00900 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 841 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 705 PXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLA 821 P P P P PPPP PP PPP P A Sbjct: 39 PVTDPSTFSPPFFPLYSSTSPPPPPSPPQPLPPPAPTFA 77 >At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 177 Score = 32.7 bits (71), Expect = 0.32 Identities = 19/47 (40%), Positives = 21/47 (44%), Gaps = 4/47 (8%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPP--XXXRAPLAP--PPXXXPP 750 P PPP PPP P P PP PP + P+A PP PP Sbjct: 120 PTICPPP---PPPYPRQVHPQPPAPPPYKFHQKEPVAKSFPPTPAPP 163 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P PP P P PP P + PL PPP PP P Sbjct: 35 PLEETPPVDPSPSSVHRPYPPPPPLPDFAPQ-PLLPPPSPPPPPP 78 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +3 Query: 687 PXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 P P P PPP PPLP P PP PPP + Sbjct: 41 PVDPSPSSVHRPYPPP---PPLPDFAPQPLLPPPSPPPPPPAY 80 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 32.7 bits (71), Expect = 0.32 Identities = 23/64 (35%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Frame = -3 Query: 820 ARKGXGGGXRXGGXGGGGXXXX-GRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXX 644 AR G GG G GG +GG GGG GG G GG G G G Sbjct: 119 ARGSGTRGGMVGGYGSGGYRGRRDQGGYNRGGG-GGYGGGYGGDRREGGYGDGGYGGQGR 177 Query: 643 XGGG 632 GG Sbjct: 178 SEGG 181 >At2g05530.1 68415.m00585 glycine-rich protein Length = 115 Score = 32.7 bits (71), Expect = 0.32 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXG 662 GG GG GGG G GG GG GG GG G G G Sbjct: 43 GGHGGNGGYNGGGGYNGG-GGHNGGGYNGGGGYNGGGHGGRHGYCRYG 89 Score = 31.5 bits (68), Expect = 0.75 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 765 PXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 P GG GG GG GG GG GG GG GG G Sbjct: 38 PDQYNGGHGGNGGYNGGGGYNGGGGHN-GGGYNGGGGYNGGGHGGRHG 84 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXG 686 G GG GG GG G GG GGG G G GG G Sbjct: 46 GGNGGYNGGGGYNGGGGHNG-GGYNGGGGYNG--GGHGGRHG 84 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXG 658 GG GGG GGG G GG GG G Sbjct: 46 GGNGGYNGGGGYNGGGGHNGGGYNGGGGYNGGGHGGRHG 84 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPG 719 G G G GG GGG G GG GGG G Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGGGGG 89 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGG 716 G GG GG GGGG GG GGG GG Sbjct: 60 GGDGGGDGGGDGGGGGCG---GGGGCGGGGGG 88 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 787 GGXGGGGXXXXGRGGXXXGGGPGGPXXGXG 698 GG GGG G GG GGG G G G Sbjct: 60 GGDGGGDGGGDGGGGGCGGGGGCGGGGGGG 89 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 787 GGXGGGGXXXXGRGGXXXGGGPGGPXXGXGG 695 GG GGG GG GGG G G GG Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGGGGG 89 Score = 28.7 bits (61), Expect = 5.3 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 753 GGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GGG GGG GG GG G GG GG GGGGG Sbjct: 59 GGGD---GGGDGGGDGGGGGCGGGGG----CGG---GGGGG 89 >At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identical to gi_3883128_gb_AAC77827 Length = 133 Score = 32.7 bits (71), Expect = 0.32 Identities = 17/61 (27%), Positives = 19/61 (31%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSX 857 P A P P PP P PP+ PP PP P + G P Sbjct: 43 PRATAPAPSPSANPPPSAPTTAPPVSQPPTESPPAPPTSTSPSGAPGTNVPSGEAGPAQS 102 Query: 858 P 860 P Sbjct: 103 P 103 Score = 31.5 bits (68), Expect = 0.75 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 684 APXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 AP P P P P P P PPP P PP Sbjct: 27 APTISPLPATPTPSQSPRATAPAPSPSANPPPSAPTTAPP 66 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 P P P P P P PP PP P PP P Sbjct: 34 PATPTPSQSPRATAPAPSPSANPPPSAPTTAPPVSQPPTESPPAP 78 >At5g59950.3 68418.m07518 RNA and export factor-binding protein, putative Length = 242 Score = 32.3 bits (70), Expect = 0.43 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = -3 Query: 814 KGXGGGXRXGGXGGGGXXXXGRGGXXXGGGP 722 +G GG R GG GGGG GR G G GP Sbjct: 189 QGRGGQQRGGGRGGGGRGGGGR-GRRPGKGP 218 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPG-GP 713 GG R G GGG GRGG G PG GP Sbjct: 187 GGQGRGGQQRGGGRGGGGRGGGGRGRRPGKGP 218 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXG 698 G R G GG GRGG GGG G G G Sbjct: 182 GAPWRGGQGRGGQQRGGGRGGGGRGGGGRGRRPGKG 217 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 754 GRGGXXXGGGPGGPXXGXGG 695 GRGG GGG GG G GG Sbjct: 190 GRGGQQRGGGRGGGGRGGGG 209 >At5g59950.2 68418.m07519 RNA and export factor-binding protein, putative Length = 178 Score = 32.3 bits (70), Expect = 0.43 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = -3 Query: 814 KGXGGGXRXGGXGGGGXXXXGRGGXXXGGGP 722 +G GG R GG GGGG GR G G GP Sbjct: 125 QGRGGQQRGGGRGGGGRGGGGR-GRRPGKGP 154 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPG-GP 713 GG R G GGG GRGG G PG GP Sbjct: 123 GGQGRGGQQRGGGRGGGGRGGGGRGRRPGKGP 154 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXG 698 G R G GG GRGG GGG G G G Sbjct: 118 GAPWRGGQGRGGQQRGGGRGGGGRGGGGRGRRPGKG 153 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 754 GRGGXXXGGGPGGPXXGXGG 695 GRGG GGG GG G GG Sbjct: 126 GRGGQQRGGGRGGGGRGGGG 145 >At5g59950.1 68418.m07517 RNA and export factor-binding protein, putative Length = 244 Score = 32.3 bits (70), Expect = 0.43 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = -3 Query: 814 KGXGGGXRXGGXGGGGXXXXGRGGXXXGGGP 722 +G GG R GG GGGG GR G G GP Sbjct: 191 QGRGGQQRGGGRGGGGRGGGGR-GRRPGKGP 220 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPG-GP 713 GG R G GGG GRGG G PG GP Sbjct: 189 GGQGRGGQQRGGGRGGGGRGGGGRGRRPGKGP 220 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXG 698 G R G GG GRGG GGG G G G Sbjct: 184 GAPWRGGQGRGGQQRGGGRGGGGRGGGGRGRRPGKG 219 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 754 GRGGXXXGGGPGGPXXGXGG 695 GRGG GGG GG G GG Sbjct: 192 GRGGQQRGGGRGGGGRGGGG 211 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 32.3 bits (70), Expect = 0.43 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = +3 Query: 627 HXPPPXXXXXPX--PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 H PP P P P PP P G PP PP P PP P Sbjct: 14 HGYPPAGYPPPGAYPPAGYPQQGYPPPPGAYPPAGYPPGAYPPAPGGY---PPAPGYGGY 70 Query: 801 PPXP 812 PP P Sbjct: 71 PPAP 74 Score = 31.5 bits (68), Expect = 0.75 Identities = 22/63 (34%), Positives = 23/63 (36%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPF 815 PP P P P A PP P PP P PP P PP P PP + Sbjct: 38 PPPPGAYP-PAGYPPGA--YPPAPGGYPPAPGYGGYPPAPGYGG-YPPAPGHGGYPPAGY 93 Query: 816 LAH 824 AH Sbjct: 94 PAH 96 Score = 28.7 bits (61), Expect = 5.3 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 3/65 (4%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPG---PPPXXXPPLPXXXXPPPPXPPXRX 797 + PP P P P P P PPG P P PP P PP P Sbjct: 21 YPPPGAYPPAGYPQQGYPPPPGAYP-PAGYPPGAYPPAPGGYPPAPGYGG-YPPAPGYGG 78 Query: 798 PPPXP 812 PP P Sbjct: 79 YPPAP 83 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 32.3 bits (70), Expect = 0.43 Identities = 24/68 (35%), Positives = 26/68 (38%), Gaps = 4/68 (5%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPP----XRXP 800 PPP P P P G P PPP P + PPPP PP R Sbjct: 618 PPPRLVCGPYPL---------PRLVRVGSPSPPP---PSMSGGAPPPPPPPPMLVASRTA 665 Query: 801 PPXPFLAH 824 PP P L+H Sbjct: 666 PP-PHLSH 672 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/46 (39%), Positives = 20/46 (43%) Frame = +3 Query: 726 PPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPSXPP 863 PP PLP PPPP P R P P ++ G PP PP Sbjct: 15 PPMRGRVPLP----PPPPPPMRRSAPSPPPMS----GRVPPPPPPP 52 Score = 30.3 bits (65), Expect = 1.7 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 652 PPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 PPP P PP PP + APPP Sbjct: 641 PPPSMSGGAPPPPPPPPMLVASRTAPPP 668 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 P P PP P PPP PPPP PP P Sbjct: 22 PLPPPPPPPMRRSAPSPPPMSG------RVPPPPPPPPMFDP 57 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 652 PPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 PPP P P PP R P PPP Sbjct: 24 PPPPPPPMRRSAPSPPPMSGRVPPPPPP 51 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PP P PPP PP+ PPP PPP P Sbjct: 15 PPMRGRVPLPPPPP--PPMRRSAPSPPPMSGRVPPPPPP 51 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 747 PLPXXXXPPPPXPPXRXPPPXP 812 PLP PPPP P R PPP P Sbjct: 148 PLP----PPPPPMPRRSPPPPP 165 Score = 28.7 bits (61), Expect = 5.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPP 734 P P PP P PP PPP Sbjct: 148 PLPPPPPPMPRRSPPPPPP 166 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 679 PXPPXXPPXXXRAPLAPPP 735 P PP PP R+P PPP Sbjct: 148 PLPPPPPPMPRRSPPPPPP 166 >At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; glycine-rich protein 18 (GRP18) PMID:11431566; Length = 228 Score = 32.3 bits (70), Expect = 0.43 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = -3 Query: 823 WARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXG 662 W G GG GG GGGG G GG GG A G Sbjct: 138 WLGPGAAGGGAPGGLGGGGNPFGNISKWFGPGAAGGDASAAGGAPAAEAAPAAG 191 >At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1 (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta) {Arabidopsis thaliana}; contains Pfam profiles: PF00614 phospholipase D.active site motif, PF00168 C2 domain Length = 1083 Score = 32.3 bits (70), Expect = 0.43 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPX--PPXRXP 800 H P P AP PP PP PP P PPPP PP Sbjct: 4 HGPRYPYPYGQYPYPYPYPAPYRPPSSEPYPP--PPTNQYSAPYYPYPPPPYATPPPYAS 61 Query: 801 PPXP 812 PP P Sbjct: 62 PPPP 65 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 32.3 bits (70), Expect = 0.43 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +1 Query: 610 YXXXPXTPPPPXXXPPP--XPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSPXXG 765 Y PPP PPP P P PP P A PPP PP+ G Sbjct: 24 YPPGAYPPPPQGAYPPPGGYPPQGYPPPPHGYPP---AAYPPPPGAYPPAGYPG 74 Score = 31.9 bits (69), Expect = 0.57 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGP-PPXXXPPLPXXXXPPP-PXPPXRXPP 803 P A PP PPG PP PP P P P PP PP Sbjct: 26 PGAYPPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPP 69 Score = 31.5 bits (68), Expect = 0.75 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Frame = +3 Query: 723 GPPPXXXPPLPXXXXPPP-PXPPXRXPPP---XPFLAHXXXGXXXPPSXPP 863 G PP PP P PPP PP PPP P A+ PP+ P Sbjct: 23 GYPPGAYPPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYP 73 Score = 31.1 bits (67), Expect = 0.99 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPP-GPPPXXXPPLPXXXXPPPPXPPXRXPP 803 H PP P P P PP PP G PP PP P PP P P Sbjct: 22 HGYPPGAYPPP-PQGAYPPPGGYPPQGYPPPPHGYPPAAYPP-PPGAYPPAGYPGPSGPR 79 Query: 804 P 806 P Sbjct: 80 P 80 >At1g11850.1 68414.m01363 expressed protein Length = 93 Score = 32.3 bits (70), Expect = 0.43 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRG-GXXXGGGPGGPXXGXGG 695 G GGG GG G G G G G GG GG G GG Sbjct: 52 GLGGGAGLGGLGIGAGIGAGAGLGLGGGGFGGGAGGGLGG 91 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGGG G G G GG G G G GG G GGG G Sbjct: 41 GGGGSGDGLGLGLGGGAGLGGLGIGAGIGAG-AGLGLGGGGFGGGAGGGLGG 91 Score = 28.7 bits (61), Expect = 5.3 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 3/51 (5%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPG---GPXXGXGGXXGAXGXXXXG 662 GGG G G G G GG G G G G G GG G G G Sbjct: 41 GGGGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGFGGGAGGGLGG 91 >At5g24316.1 68418.m02864 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 125 Score = 31.9 bits (69), Expect = 0.57 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 732 PXXXPPLPXXXXPPPPXPPXRXPP 803 P P P PPPP PP R PP Sbjct: 97 PRPIPKRPMPYVPPPPPPPTRRPP 120 >At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; glycine-rich protein 14 (GRP14) PMID:11431566; PIR:JQ1063 Length = 193 Score = 31.9 bits (69), Expect = 0.57 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -3 Query: 817 RKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXGG 695 R G G GG GGG G GG GG PGG G GG Sbjct: 105 RFGGRFGKPGGGGLGGGGLPGGLGGLGGGGLPGG-LGGLGG 144 Score = 30.3 bits (65), Expect = 1.7 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = -3 Query: 802 GGXRXGGXG--GGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGG 635 G R GG GGG GR G GGG GG G G G G G GG Sbjct: 90 GRRRFGGLRRFGGGRRFGGRFGKPGGGGLGG--GGLPGGLGGLGGGGLPGGLGGLGGG 145 Score = 29.9 bits (64), Expect = 2.3 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -1 Query: 774 GGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGGXXG 622 GGG G GGG GG GG PGG GG GG GG G Sbjct: 101 GGGRRFGGRFGKPGGGGLGG----GGL---PGGLGGLGGGGLPGGLGGLGG 144 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -3 Query: 811 GXGGGXRXGGXG--GGGXXXXGRGGXXXGGGP 722 G GGG GG G GGG G GG G P Sbjct: 117 GLGGGGLPGGLGGLGGGGLPGGLGGLGGGENP 148 >At5g07190.1 68418.m00819 embryo-specific protein 3, putative similar to embryo-specific protein 3 GI:3335171 from [Arabidopsis thaliana] Length = 213 Score = 31.9 bits (69), Expect = 0.57 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXP 785 P P PP PP P P PPPP P Sbjct: 154 PSSPDLPPPHFPPEFPPETPTTPPPPPPRP 183 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 31.9 bits (69), Expect = 0.57 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 787 GGXGGGGXXXXGRGGXXXGGGPGGPXXG 704 GG GGGG G GG GG GG G Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGGGGHG 39 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPG 719 G GGG GG GGG GG GGG G Sbjct: 13 GAGGGGGHGGGAGGGFG----GGAGGGGGHG 39 >At3g49840.1 68416.m05449 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 606 Score = 31.9 bits (69), Expect = 0.57 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 1/59 (1%) Frame = +3 Query: 633 PPPXXXXXPX-PXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P P A PP G G P PP P PP P + PPP Sbjct: 512 PPPAGYPPPQYPQAGYPPAGYPPPQQGYGQ-GYPAQGYPP-PQYPQGHPPQYPYQGPPP 568 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = +1 Query: 622 PXTPPPPXXXPPP--XPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSPXXG 765 P + PPP PP P P P PP PP PP G Sbjct: 491 PVSAPPPQGYPPKEGYPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYG 540 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/65 (29%), Positives = 21/65 (32%), Gaps = 3/65 (4%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPG-PPPXXXPP--LPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXP 848 P PP P G PPP PP P PP PP + + A P Sbjct: 495 PPPQGYPPKEGYPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGYPPPQYP 554 Query: 849 PSXPP 863 PP Sbjct: 555 QGHPP 559 >At2g18470.1 68415.m02151 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 633 Score = 31.9 bits (69), Expect = 0.57 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSP 756 P P PP PP P P P +AP P PSP Sbjct: 30 PPAPSPPSPTPPQGDSSSSPPPDSTSPPAPQAPNPPNSSNNSPSP 74 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/57 (28%), Positives = 16/57 (28%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPP 803 PP P P PP P P PP P PP P PP Sbjct: 9 PPTNSTSSPSPPSNTNSTTSSPPAPSPPSPTPPQGDSSSSPPPDSTSPPAPQAPNPP 65 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/60 (28%), Positives = 18/60 (30%), Gaps = 1/60 (1%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGP-PPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXPPS 854 P P PP P PP PP PPP P P + PPS Sbjct: 17 PSPPSNTNSTTSSPPAPSPPSPTPPQGDSSSSPPPDSTSPPAPQAPNPPNSSNNSPSPPS 76 >At1g79480.1 68414.m09263 hypothetical protein low similarity to beta-1,3-glucanase-like protein GI:9758115 from [Arabidopsis thaliana] Length = 356 Score = 31.9 bits (69), Expect = 0.57 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPP 788 PP P P P + P P P P PP+ PPP PP Sbjct: 209 PPESGYTPGPVLGPPYSEPGPSTPTGSIPSPSSGFLPPI---VYPPPMAPP 256 Score = 29.9 bits (64), Expect = 2.3 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 5/63 (7%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXX--PPXPXXGPPGPPPXXXPPLPXXXXPPPP---XPPXRX 797 P P P P P P P P GPP P P P P P PP Sbjct: 192 PYPPESSSPNPPEIVPSPPESGYTPGPVLGPPYSEP--GPSTPTGSIPSPSSGFLPPIVY 249 Query: 798 PPP 806 PPP Sbjct: 250 PPP 252 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSPXXG 765 P PP P P P P PP P + P P PP G Sbjct: 185 PNPPITIPYP-PESSSPNPPEIVPSPPESGYTPGPVLGPPYSEPG 228 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +1 Query: 604 IIYXXXPXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPS 753 I Y +P PP P P P P PP P P PS Sbjct: 191 IPYPPESSSPNPPEIVPSPPESGYTPGPVLGPPYSEPGPSTPTGSIPSPS 240 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/57 (28%), Positives = 16/57 (28%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PP P P P P P PP P P P PP PP Sbjct: 124 PPVTVPNPPESSSNPNPPDSSSNPNSNP-NPPESSSNPNPPVTVPNPPESSSNPNPP 179 >At1g70250.1 68414.m08082 receptor serine/threonine kinase, putative similar to to receptor serine/threonine kinase PR5K gi|1235680|gb|AAC49208 Length = 799 Score = 31.9 bits (69), Expect = 0.57 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 714 GPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 G P PPP PP PPPP P P Sbjct: 99 GAPPPPPDLFPPPSAQMLPPPPASSPAPPSP 129 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PP P PP P PP P PP P P P P Sbjct: 102 PPPPDLFPP-PSAQMLPPPPASSPAPPSPPSSSRPRPLP 139 Score = 29.5 bits (63), Expect = 3.0 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXP-PSP 756 PPPP PP P PP P AP +PP P P P Sbjct: 101 PPPPPDLFPPPSAQMLPPPPASSP----APPSPPSSSRPRPLP 139 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 717 PPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PP PP PP PPP P PP Sbjct: 101 PPPPPDLFPPPSAQMLPPPPASSPAPPSPP 130 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 6/40 (15%) Frame = +1 Query: 631 PPPPXXXPPPX------PXXXXPXPPXXPPXXXRAPLAPP 732 PPPP PPP P P PP P PL P Sbjct: 102 PPPPDLFPPPSAQMLPPPPASSPAPPSPPSSSRPRPLPRP 141 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 31.9 bits (69), Expect = 0.57 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +3 Query: 627 HXPPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPP 788 H PPP P P PP P P PP+ P PP PP Sbjct: 225 HQPPPQVKQSE------PTPPPPPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPP 272 Score = 31.5 bits (68), Expect = 0.75 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +1 Query: 637 PPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPPXXXPPSPXXG 765 P PPP P PP PP L+ PP+P G Sbjct: 252 PTPSPPPPIKKGSSPSPPPPPPVKKVGALSSSASKPPPAPVRG 294 >At5g60980.2 68418.m07650 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein G3BP ras-GTPase-activating protein SH3-domain binding protein, Mus musculus, EMBL:MMU65313 Length = 460 Score = 31.5 bits (68), Expect = 0.75 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 787 GGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 GG GGGG GRGG G P GG G G GG Sbjct: 399 GGRGGGGRGGYGRGGGEFSGRPKSSNPRNGGEGYQRVPQNGGGGRGGRGEGG 450 >At5g60980.1 68418.m07649 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein G3BP ras-GTPase-activating protein SH3-domain binding protein, Mus musculus, EMBL:MMU65313 Length = 459 Score = 31.5 bits (68), Expect = 0.75 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 787 GGXGGGGXXXXGRGGXXXGGGPGGPXXGXGGXXGAXGXXXXGXGXXXXXGGG 632 GG GGGG GRGG G P GG G G GG Sbjct: 398 GGRGGGGRGGYGRGGGEFSGRPKSSNPRNGGEGYQRVPQNGGGGRGGRGEGG 449 >At5g53350.1 68418.m06630 ATP-dependent Clp protease ATP-binding subunit ClpX1 (CLPX) identical to CLP protease regulatory subunit CLPX GI:2674203 from [Arabidopsis thaliana] Length = 579 Score = 31.5 bits (68), Expect = 0.75 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 835 PXXXWARKGXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXGXG 698 P W G G R G GRGG G PGGP G G Sbjct: 100 PPDLWQPPGDGVSVRVNGSS----VNLGRGGGGGGSSPGGPGNGTG 141 >At4g34440.1 68417.m04894 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 670 Score = 31.5 bits (68), Expect = 0.75 Identities = 20/62 (32%), Positives = 22/62 (35%), Gaps = 2/62 (3%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPP--PXXXPPLPXXXXPPPPXPPXRXPPP 806 PPP P P +P PP P PP P PP+ P P P PP Sbjct: 39 PPPSSISAPPPDISASFSP--PPAPPTQETSPPTSPSSSPPV---VANPSPQTPENPSPP 93 Query: 807 XP 812 P Sbjct: 94 AP 95 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 2/61 (3%) Frame = +3 Query: 636 PPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXR--XPPPX 809 P P P PP P PP PP PPP PP + PP Sbjct: 12 PETSNGTPPSNGTSPSNESSPPTPPSSPPPSSISAPPPDISASFSPPPAPPTQETSPPTS 71 Query: 810 P 812 P Sbjct: 72 P 72 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/49 (32%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPP----XXXRAPLAPPPXXXPPSP 756 P +PPP PP PP PP +P + PP PSP Sbjct: 36 PSSPPPSSISAPPPDISASFSPPPAPPTQETSPPTSPSSSPPVVANPSP 84 Score = 29.1 bits (62), Expect = 4.0 Identities = 20/69 (28%), Positives = 21/69 (30%) Frame = +3 Query: 657 PXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXG 836 P P + P PP PP PP PPP PPP P Sbjct: 12 PETSNGTPPSNGTSPSNESSPPTPPSS--PPPSSISAPPPDISASFSPPPAP-PTQETSP 68 Query: 837 XXXPPSXPP 863 P S PP Sbjct: 69 PTSPSSSPP 77 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/60 (26%), Positives = 16/60 (26%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPPXP 812 PPP P P PP P P P PP P PP P Sbjct: 47 PPPDISASFSPPPAPPTQETSPPTSPSSSPPVVANPSPQTPENPSPPAPEGSTPVTPPAP 106 Score = 27.9 bits (59), Expect = 9.2 Identities = 17/57 (29%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +3 Query: 633 PPPXXXXXPXPXXXXPXAPXXPPXPXXGP-PGPPPXXXPPLPXXXXPPPPXPPXRXP 800 PPP P P +P P P P P PP P P P P + P Sbjct: 57 PPPAP---PTQETSPPTSPSSSPPVVANPSPQTPENPSPPAPEGSTPVTPPAPPQTP 110 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 31.5 bits (68), Expect = 0.75 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGG 743 GGG R G GGGG GRGG Sbjct: 76 GGGGRGGDRGGGGGGRGGRGG 96 >At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPP-PXPPXRXPPPXP 812 PP P P P LP PPP P P PPP P Sbjct: 81 PPHPQMFGQQQPQAFLPHLPPHHLPPPFPGPYDSAPPPPP 120 Score = 28.7 bits (61), Expect = 5.3 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 3/64 (4%) Frame = +3 Query: 678 PXAPXXPPXPXXGPP---GPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXP 848 P P PP P P PP P PP R PP PF H P Sbjct: 181 PGGPFDPPFPSSSMPMIHHPPNPMMSPSMNNVPGALAVPPIRQPPFPPFHDHHQLQQHLP 240 Query: 849 PSXP 860 P Sbjct: 241 QPHP 244 >At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPP-PXPPXRXPPPXP 812 PP P P P LP PPP P P PPP P Sbjct: 81 PPHPQMFGQQQPQAFLPHLPPHHLPPPFPGPYDSAPPPPP 120 Score = 28.7 bits (61), Expect = 5.3 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 3/64 (4%) Frame = +3 Query: 678 PXAPXXPPXPXXGPP---GPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXP 848 P P PP P P PP P PP R PP PF H P Sbjct: 181 PGGPFDPPFPSSSMPMIHHPPNPMMSPSMNNVPGALAVPPIRQPPFPPFHDHHQLQQHLP 240 Query: 849 PSXP 860 P Sbjct: 241 QPHP 244 >At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPP-PXPPXRXPPPXP 812 PP P P P LP PPP P P PPP P Sbjct: 81 PPHPQMFGQQQPQAFLPHLPPHHLPPPFPGPYDSAPPPPP 120 Score = 28.7 bits (61), Expect = 5.3 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 3/64 (4%) Frame = +3 Query: 678 PXAPXXPPXPXXGPP---GPPPXXXPPLPXXXXPPPPXPPXRXPPPXPFLAHXXXGXXXP 848 P P PP P P PP P PP R PP PF H P Sbjct: 181 PGGPFDPPFPSSSMPMIHHPPNPMMSPSMNNVPGALAVPPIRQPPFPPFHDHHQLQQHLP 240 Query: 849 PSXP 860 P Sbjct: 241 QPHP 244 >At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family protein Length = 421 Score = 31.5 bits (68), Expect = 0.75 Identities = 21/70 (30%), Positives = 23/70 (32%), Gaps = 4/70 (5%) Frame = +3 Query: 627 HXPPPXXXXXPX---PXXXXPXAPXXPPXPXXGPPGPPPXXXP-PLPXXXXPPPPXPPXR 794 H PP P P P P P PP P P P P P PP Sbjct: 213 HPLPPRFYDNPTNDYPADVPPPPPSSYPSNDHLPPPTGPSDSPYPHPYSHQPYHQDPPKH 272 Query: 795 XPPPXPFLAH 824 PPP + +H Sbjct: 273 MPPPQNYSSH 282 >At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / heat shock transcription factor 7 (HSTF7) identical to heat shock factor protein 7 (HSF7) SP:Q9T0D3 from [Arabidopsis thaliana] Length = 377 Score = 31.5 bits (68), Expect = 0.75 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 811 GXGGGXRXGGXGGGGXXXXGRGGXXXGGGPGG 716 G G G G GG G GG GGG GG Sbjct: 17 GGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGG 48 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -3 Query: 805 GGGXRXGGXGGGGXXXXGRGGXXXGGGPGGPXXG 704 GGG GG G GG G G GG G Sbjct: 17 GGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGGGG 50 >At3g29390.1 68416.m03693 hydroxyproline-rich glycoprotein family protein sequencing discrepancy between cDNA and genomic sequence prevents representation of entire coding sequence Length = 578 Score = 31.5 bits (68), Expect = 0.75 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 696 PPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXPPP 806 PP P P PPP P P PP PPP Sbjct: 472 PPSPRSVMPPPPPKTIAPPPSKTMSPPSSKSMLPPPP 508 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +1 Query: 631 PPPPXXXPPPXPXXXXPXP-PXXPPXXXRAPLAPPPXXXPPSP 756 P P PPP P P P P ++ L PPP SP Sbjct: 473 PSPRSVMPPPPPKTIAPPPSKTMSPPSSKSMLPPPPRSKTMSP 515 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +3 Query: 678 PXAPXXPPXPXXGPPGPPPXXXPPLPXXXXPPPPXPPXRXP 800 P + PP P P P PP PPPP P Sbjct: 475 PRSVMPPPPPKTIAPPPSKTMSPPSSKSMLPPPPRSKTMSP 515 >At3g07195.1 68416.m00858 proline-rich family protein Length = 225 Score = 31.5 bits (68), Expect = 0.75 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 622 PXTPPPPXXXPPPXPXXXXPXPPXXPPXXXRAPLAPPP 735 P T P PPP P P P P APPP Sbjct: 42 PETKPQELAPPPPQPARRIQKPEAPKPVKQDTPRAPPP 79 >At2g17870.1 68415.m02070 cold-shock DNA-binding family protein contains Pfam domains, PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 301 Score = 31.5 bits (68), Expect = 0.75 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = -1 Query: 777 GGGGPXXXGGGXXXXGGGQGGPXXXGGXXXGPGGXXXXXGGXXXGGGGG 631 GG G GGG GG+G G GG GGGGG Sbjct: 111 GGSGGKSFGGGGGRRSGGEGECYMCGDVGHFARDCRQSGGGNSGGGGGG 159 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,981,854 Number of Sequences: 28952 Number of extensions: 386237 Number of successful extensions: 27125 Number of sequences better than 10.0: 386 Number of HSP's better than 10.0 without gapping: 1380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9661 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2019160800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -