BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_C21 (886 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 46 5e-06 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 46 7e-06 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 45 1e-05 SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 44 2e-05 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 42 9e-05 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 42 9e-05 SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex p... 42 2e-04 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 42 2e-04 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 40 6e-04 SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pomb... 35 0.018 SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||M... 34 0.023 SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccha... 34 0.031 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 33 0.071 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 33 0.071 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 32 0.094 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 31 0.29 SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1... 28 0.33 SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1... 30 0.38 SPCC645.07 |rgf1||RhoGEF for Rho1, Rgf1|Schizosaccharomyces pomb... 29 1.2 SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|S... 27 3.6 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 27 3.6 SPBP8B7.16c |dbp2||ATP-dependent RNA helicase Dbp2|Schizosacchar... 27 3.6 SPAC13G7.02c |ssa1||heat shock protein Ssa1|Schizosaccharomyces ... 27 4.7 SPBC119.05c |||Wiskott-Aldrich syndrome homolog binding protein ... 27 4.7 SPBC557.04 |ppk29||Ark1/Prk1 family protein kinase Ppk29|Schizos... 27 4.7 SPBC660.05 |||conserved fungal protein|Schizosaccharomyces pombe... 27 4.7 SPBC13E7.03c |||RNA hairpin binding protein |Schizosaccharomyces... 23 6.0 SPCC794.04c |||membrane transporter|Schizosaccharomyces pombe|ch... 26 8.2 SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2... 26 8.2 SPCC584.15c |||arrestin/PY protein 2|Schizosaccharomyces pombe|c... 26 8.2 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 46.4 bits (105), Expect = 5e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPP 722 PP PPP PPPPP PP P PPPPP Sbjct: 5 PPGNPPP--PPPPPGFEPPSQPPPPPPP 30 Score = 35.5 bits (78), Expect = 0.010 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 679 PXXXPPXXPXPPXXXPPXPPPXPPXP 756 P PP P PP PP PP PP P Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 32.7 bits (71), Expect = 0.071 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 690 PPXXPXPPPPPXPXPPXPXPXAPP 761 PP P PPPPP P P PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPP 28 Score = 32.3 bits (70), Expect = 0.094 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 676 PPXXXPPXXPXPPXXXPPXPPPXPP 750 PP PP P P P PPP PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPP 29 Score = 31.9 bits (69), Expect = 0.12 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 691 PPXXPXPPXXXPPXPPPXPPXPPXXP 768 PP P PP P PP P PP P Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 31.9 bits (69), Expect = 0.12 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXPPP 741 P P PPP PP PP PP PPP Sbjct: 6 PGNPPPPP---PPPGFEPPSQPPPPPPP 30 Score = 31.5 bits (68), Expect = 0.17 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 690 PPXXPXPPPPPXPXPPXPXPXAPP 761 P P PPPPP PP P PP Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPP 29 Score = 29.5 bits (63), Expect = 0.67 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 709 PPXXXPPXPPPXPPXPPXXPP 771 PP PP PPP PP PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPP 25 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 46.0 bits (104), Expect = 7e-06 Identities = 22/55 (40%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXP---PXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P PP P P P P P PP PP P PPL G+ AP P Sbjct: 416 PVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLP 470 Score = 39.5 bits (88), Expect = 6e-04 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXP-PXPXPXAPPXS 767 +PP P PP P P P PP P P P P P P AP S Sbjct: 446 APPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPAPAAPVAS 490 Score = 37.9 bits (84), Expect = 0.002 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 3/60 (5%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPP-XPPPXPP-XPPXXPP-LXGGVXGAPXTP 807 P P P P PP PP PP PP PP PP PP L G AP P Sbjct: 391 PPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLP 450 Score = 36.3 bits (80), Expect = 0.006 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPP---PPXPXPPXPXPXAPP 761 +PP PP PP P PP P P P P P P APP Sbjct: 414 TPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPP 458 Score = 34.7 bits (76), Expect = 0.018 Identities = 21/69 (30%), Positives = 22/69 (31%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXSXXXXXXXXXXXXXXXX 815 S P PP P PP P P PPP P P +PP S Sbjct: 228 SAPPIPPSIPSSRPPERVPSLSA-PAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINS 286 Query: 816 XSXXFXPPP 842 S PPP Sbjct: 287 TSKPPLPPP 295 Score = 33.1 bits (72), Expect = 0.054 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = +3 Query: 627 QXDSPPXXPPPXPPP-----PPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 Q S P PPP P PPP PP PP P P PP Sbjct: 356 QGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPP 405 Score = 32.7 bits (71), Expect = 0.071 Identities = 18/65 (27%), Positives = 20/65 (30%), Gaps = 2/65 (3%) Frame = +1 Query: 610 IPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXP--PXPPPXPPXPPXXPPLXGG 783 +P +P P P PP P P P PP PP P PP Sbjct: 423 LPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAP 482 Query: 784 VXGAP 798 AP Sbjct: 483 APAAP 487 Score = 32.3 bits (70), Expect = 0.094 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 P PPPPP P PP PP P AP Sbjct: 337 PPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAP 370 Score = 31.9 bits (69), Expect = 0.12 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXP-PXXPXPPPPPXPXPPXPXPXAPP 761 +PP PP P P P PP P PP P APP Sbjct: 387 NPPAPPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPSAPP 429 Score = 31.5 bits (68), Expect = 0.17 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PPPPPP PP PP P P + P Sbjct: 338 PPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAP 370 Score = 31.1 bits (67), Expect = 0.22 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PPP PP PPPP P PP Sbjct: 337 PPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPP 377 Score = 31.1 bits (67), Expect = 0.22 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 9/56 (16%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXXPXPP-------XXXPPXPPPXPP--XPPXXPPL 774 IP P P PPP P PP PP PPP P P PPL Sbjct: 351 IPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPPL 406 Score = 31.1 bits (67), Expect = 0.22 Identities = 16/53 (30%), Positives = 18/53 (33%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P + + P P P P PP PP P P P PP PP Sbjct: 378 PLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTSTPPVPTP-PSLPPSAPP 429 Score = 31.1 bits (67), Expect = 0.22 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 5/60 (8%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXX--PPXP---PPXPPXPPXXPPLXGGVXGAPXTP 807 P P P P P P P PP PP P P PP PP P AP P Sbjct: 429 PSLP-PSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPAPAAP 487 Score = 29.5 bits (63), Expect = 0.67 Identities = 20/82 (24%), Positives = 22/82 (26%) Frame = +1 Query: 562 YSXHAVYVPYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPP 741 Y + P + IP P P P PPP P PP PP Sbjct: 216 YLNESAGTPTSTSAPPIPPSIPSSRPPERVPSLSAPAPPPIPPPSNG---TVSSPPNSPP 272 Query: 742 XPPXPPXXPPLXGGVXGAPXTP 807 P P P P P Sbjct: 273 RPIAPVSMNPAINSTSKPPLPP 294 Score = 29.1 bits (62), Expect = 0.88 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +3 Query: 636 SPPXXPPPXP-PPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 S P P PPPPP P PPP P APP Sbjct: 350 SIPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPP 392 Score = 28.7 bits (61), Expect = 1.2 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 7/33 (21%) Frame = +3 Query: 651 PPPXPPP-------PPPXXXPPXXPXPPPPPXP 728 PPP PPP PP PPPPP P Sbjct: 311 PPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPP 343 Score = 26.6 bits (56), Expect = 4.7 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 8/44 (18%) Frame = +3 Query: 651 PPPXPPPPPPXXXPP--------XXPXPPPPPXPXPPXPXPXAP 758 PPP PP PP P PPPPP P P Sbjct: 312 PPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPP 355 Score = 26.6 bits (56), Expect = 4.7 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +3 Query: 654 PPXPPPP-PPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 PP PPP P P P PP P P + P S Sbjct: 388 PPAPPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPS 426 Score = 26.2 bits (55), Expect = 6.2 Identities = 14/41 (34%), Positives = 14/41 (34%), Gaps = 3/41 (7%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXX---PPXPPPXPPXPPXXPP 771 P P PP P PP PP PP P PP Sbjct: 337 PPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPP 377 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 45.2 bits (102), Expect = 1e-05 Identities = 29/75 (38%), Positives = 29/75 (38%), Gaps = 1/75 (1%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGG-XXX 681 GG GGG G G G GG GG GGG GG G G GG Sbjct: 188 GGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGF 247 Query: 680 GGGXGXXGXGXXGXG 636 GGG G G G G G Sbjct: 248 GGGLGGFGGGPGGFG 262 Score = 40.7 bits (91), Expect = 3e-04 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGG-XXXGGGGGGXGGGXXG 641 GG G GG G GGG G GG GGG GG GGG G Sbjct: 227 GGGPGGFEGGPGGFGGGPGGFGGGLGGFGGGPGGFGGGPGG 267 Score = 38.7 bits (86), Expect = 0.001 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGG-XXXGGGGGGXGGGXXG 641 G G GG G GGG G GG GGG GG GGG G Sbjct: 214 GGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGFGGGLGG 253 Score = 37.9 bits (84), Expect = 0.002 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG 641 G G G GG G GG G GG GGG GG GGG G Sbjct: 224 GGFGGGPGGFEGGPGGFGGGPGGF--GGGLGGFGGGPGG 260 Score = 37.5 bits (83), Expect = 0.003 Identities = 26/68 (38%), Positives = 26/68 (38%), Gaps = 1/68 (1%) Frame = -1 Query: 853 GXXWGGGXXXXEGXXXXXXXXXXXXXXXGEXG-GAXGXGXGGXGXGGGGGXGXXGGXXXG 677 G G G EG E G G G G GG G G GG G GG G Sbjct: 205 GGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGGGPGGF--G 262 Query: 676 GGGGGXGG 653 GG GG GG Sbjct: 263 GGPGGHGG 270 Score = 36.7 bits (81), Expect = 0.004 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG 641 GG G G GG G G GGG G GG G GGG G G G Sbjct: 235 GGPGGFG-GGPG-GFGGGLGGFGGGPGGFGGGPGGHGGPG 272 Score = 33.1 bits (72), Expect = 0.054 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = -3 Query: 770 GGXXGGXGGXGGG--XGGXXXGGXGXXGG-XXXGGGXGXXGXGXXG 642 GG GG GG GG G GG G GG GG G G G G Sbjct: 187 GGGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGG 232 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 44.4 bits (100), Expect = 2e-05 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -3 Query: 773 RGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 RGG GG GG GGG GG GG G G G G G G G Sbjct: 18 RGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGG 63 Score = 43.2 bits (97), Expect = 5e-05 Identities = 23/54 (42%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Frame = -3 Query: 791 PXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG--GGXGXXGXGXXGXG 636 P + RGG GG GG GG GG G G GG G GG G G G G Sbjct: 5 PGSRGGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRG 58 Score = 37.5 bits (83), Expect = 0.003 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXG-GGGGGXGGGXXGG 638 GG G GG G GG G GG G GG G GG GG Sbjct: 29 GGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 Score = 35.9 bits (79), Expect = 0.008 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG G GG R G RGG GG GG GG GG G G GG G Sbjct: 12 GGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGG-RGGSSGGRGGAKGG 70 Score = 35.9 bits (79), Expect = 0.008 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXX-GGXXXGGGGGGXGGGXXGGES 632 G G GG G G GG G GG G GG G G GG S Sbjct: 19 GGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSS 61 Score = 35.9 bits (79), Expect = 0.008 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 GG G GG GG GG G G GG GG G G G G Sbjct: 23 GGRGGFGGGRGGARGGGRGGARGGRGG--RGGARGGRGGSSGGRG 65 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 42.3 bits (95), Expect = 9e-05 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = +3 Query: 627 QXDSPPXXPPPXPPPPPPXXXPPXXPXP---PPPPXPXPPXPXPXAP 758 Q +PP P PPPPP PP P PP P PP P AP Sbjct: 1695 QSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAP 1741 Score = 40.7 bits (91), Expect = 3e-04 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXP--PPXPPXPPXXPPLXGGVXGAPXTP 807 P P PP P P PP PP P PP P PP PP AP P Sbjct: 1686 PVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVP 1744 Score = 40.7 bits (91), Expect = 3e-04 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +3 Query: 627 QXDSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 Q +P PPP PPPP P P PP P P P P Sbjct: 1701 QMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVP 1744 Score = 40.3 bits (90), Expect = 4e-04 Identities = 20/55 (36%), Positives = 21/55 (38%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P P PP P PP PP P PP PP+ G AP P Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPT---PPPPPMSVPPPPSAPPMPAGPPSAPPPP 1734 Score = 39.9 bits (89), Expect = 5e-04 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P PP P PP P PPP P P P APP Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPP 1722 Score = 39.1 bits (87), Expect = 8e-04 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 PP PP P PP PP P PP P P P P Sbjct: 1710 PPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 38.7 bits (86), Expect = 0.001 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP--XPXAPP 761 +PP P PP PP P PPP PP P P APP Sbjct: 1689 TPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPP 1732 Score = 38.7 bits (86), Expect = 0.001 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 +PP P PPPP P P PPPP P P P Sbjct: 1706 TPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 36.3 bits (80), Expect = 0.006 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +3 Query: 639 PPXXPPPX---PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 P PP P PPPP P P PP P P P P P S Sbjct: 1694 PQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASS 1739 Score = 33.1 bits (72), Expect = 0.054 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P PPP PP PP PP P P P P Sbjct: 1705 PTPPPPPMSVPPPPSAPPMPAGPPS-APPPPLPASSAPSVPNP 1746 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 42.3 bits (95), Expect = 9e-05 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = +3 Query: 639 PPXXPPPXP--PPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 PP PP P PPP P PP PP P PP P AP S Sbjct: 139 PPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKS 183 Score = 37.9 bits (84), Expect = 0.002 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = +3 Query: 636 SPPXXPPPXPPPP---PPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 +PP P P P PP PP PPP P PP P APP Sbjct: 123 APPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIP-SKAPP 166 Score = 36.7 bits (81), Expect = 0.004 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +3 Query: 642 PXXPPPXPP--PPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P PPP P PP P PP PPP P P P + P Sbjct: 147 PSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAP 188 Score = 36.3 bits (80), Expect = 0.006 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPL 774 P K P P P P PP P P PP PP PP P P+ Sbjct: 158 PPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPPLSQAPV 211 Score = 34.3 bits (75), Expect = 0.023 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P P PP P PPP P P P Sbjct: 140 PTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSP 184 Score = 33.5 bits (73), Expect = 0.041 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXP-PXXXPPXPPPXPPXPPXXPPL 774 P P P PP P P PP P PP P PP+ Sbjct: 128 PAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPI 167 Score = 31.9 bits (69), Expect = 0.12 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 642 PXXPPPXPPPPP--PXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 P P PP P P PP P PPPP P + P S Sbjct: 177 PAAPVKSPPSAPSLPSAVPPMPPKVPPPPLSQAPVANTSSRPSS 220 Score = 31.5 bits (68), Expect = 0.17 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPL 774 P P PP P PP PP P PP P PP+ Sbjct: 125 PSAPAPPT---PQSELRPPTSAPPRPSIPPPSPASAPPI 160 Score = 30.3 bits (65), Expect = 0.38 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = +3 Query: 636 SPPXXPPPX--PPPPPPXXXPPXXPXPP---PPPXPXPPXPXPXAPP 761 SP PP PP P PP P P PP P P P PP Sbjct: 153 SPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPP 199 Score = 30.3 bits (65), Expect = 0.38 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAP 798 P P P P P PP P P PP P P PP+ V P Sbjct: 154 PASAPPIPSKAPPIPSSLPP--PAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPP 205 Score = 28.7 bits (61), Expect = 1.2 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P PP P PP P PP P PP Sbjct: 125 PSAPAPPTPQSELRPPTSAPPRPSIPPP----SPASAPPIPSKAPPIPSSLPP 173 Score = 28.3 bits (60), Expect = 1.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPP 716 P PPPPPP P PP Sbjct: 3 PAPPPPPPAPAPAAAAPAPP 22 Score = 27.1 bits (57), Expect = 3.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 702 PXPPPPPXPXPPXPXPXAPP 761 P PPPPP P APP Sbjct: 3 PAPPPPPPAPAPAAAAPAPP 22 Score = 27.1 bits (57), Expect = 3.6 Identities = 11/31 (35%), Positives = 11/31 (35%) Frame = +1 Query: 676 PPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 PP P P P PP P PP P Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRPSIPPPSP 154 Score = 27.1 bits (57), Expect = 3.6 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P PP P P P PP P PP P+ AP P Sbjct: 139 PPTSAPPRPSIPP-PSPASAPPIPSKAPPIPSSLPPPAQPAAPVK-SPPSAPSLP 191 Score = 26.2 bits (55), Expect = 6.2 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 1/40 (2%) Frame = +3 Query: 639 PPXXPP-PXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXA 755 PP P P PP P P PP P P P A Sbjct: 173 PPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPPLSQAPVA 212 Score = 25.8 bits (54), Expect = 8.2 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXP 704 PPP PP P P P P Sbjct: 5 PPPPPPAPAPAAAAPAPP 22 >SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex protein Gar1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 194 Score = 41.5 bits (93), Expect = 2e-04 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = -3 Query: 806 GVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXG 642 G P RGG GG GG GG GG GG G GG G G G G G Sbjct: 129 GARNGPAGRGGRGGFRGGRGGSRGGFGGNSRGGFG--GGSRGGFGGGSRGGSRGG 181 Score = 40.7 bits (91), Expect = 3e-04 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G A G GG G GG G GG GG GGG GG GG Sbjct: 133 GPAGRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGG 173 Score = 39.5 bits (88), Expect = 6e-04 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G G GG G GG GG GGG GG GG Sbjct: 141 GGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGG 181 Score = 38.7 bits (86), Expect = 0.001 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G G GGG G GG GG GG GG GG Sbjct: 149 GSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGGSRGG 189 Score = 37.5 bits (83), Expect = 0.003 Identities = 23/66 (34%), Positives = 24/66 (36%), Gaps = 1/66 (1%) Frame = -3 Query: 836 GGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGG-GXGGXXXGGXGXXGGXXXGGGXGXX 660 G K + G G RGG G GG GG GG G G GG GG G Sbjct: 123 GPKKPKGARNGPAGRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGF 182 Query: 659 GXGXXG 642 G G Sbjct: 183 RGGSRG 188 Score = 37.1 bits (82), Expect = 0.003 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G GG G GG G G GG GG GGG GG Sbjct: 138 GGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGG 177 Score = 31.5 bits (68), Expect = 0.17 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G GG GG G GG GG GG GG Sbjct: 129 GARNGPAGRGGRGGFRGGRGGSRGGFGGNSRGGFGGG 165 Score = 29.9 bits (64), Expect = 0.50 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGG 653 G G G G GGG G G GG GG G Sbjct: 161 GFGGGSRGGFGGGSRGGSRGGFRGGSRGGFRG 192 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 41.5 bits (93), Expect = 2e-04 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 +P P P PPP P PP P PP PP P P P S Sbjct: 743 TPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPAVS 786 Score = 40.3 bits (90), Expect = 4e-04 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 6/51 (11%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXP------PXPPXXPP 771 P P P P P P P P P PP PPP P P PP PP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 38.7 bits (86), Expect = 0.001 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PPP P P P PPP P P P PP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPP 767 Score = 38.3 bits (85), Expect = 0.001 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +1 Query: 634 IPXPXX-PXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAP 798 +P P P P P P PP P PP PPP PP PP G AP Sbjct: 741 VPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPP-PPPPPPAVSAGGSRYYAP 795 Score = 36.3 bits (80), Expect = 0.006 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P PP P P P PP P P PP PP G P P Sbjct: 734 PPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPP 780 Score = 34.7 bits (76), Expect = 0.018 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPX---PXPPXPXP 749 PPP P P P P PPP P P PP P P Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPP 768 Score = 29.9 bits (64), Expect = 0.50 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +1 Query: 610 IPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXP-PXXXPPXPP 738 +P IP P P P PPP PP P PP PP Sbjct: 741 VPTPAPAPIPVPP-PAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 29.5 bits (63), Expect = 0.67 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +1 Query: 691 PPXXPXPPXXXPPXPPPXP-PXPPXXPPLXGGVXGAPXTP 807 PP P PP P P P P P PP P+ GG P P Sbjct: 732 PP--PPPPAVIVPTPAPAPIPVPPPA-PIMGGPPPPPPPP 768 Score = 27.1 bits (57), Expect = 3.6 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPPXPXP 734 PP PPPPPP P P P Sbjct: 775 PPPPPPPPPAVSAGGSRYYAPAPQAEP 801 Score = 26.6 bits (56), Expect = 4.7 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXP 734 PPP PPPP P P P P Sbjct: 776 PPPPPPPPAVSAGGSRYYAPAPQAEPEP 803 Score = 25.8 bits (54), Expect = 8.2 Identities = 15/48 (31%), Positives = 15/48 (31%), Gaps = 4/48 (8%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXX----PPXXPXPPXXXPPXPPPXPPXPPXXP 768 P P P P PPP PP P PP P P P Sbjct: 754 PAPIMGGPPPPPPPPGVAGAGPPPPPPPPPAVSAGGSRYYAPAPQAEP 801 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 39.5 bits (88), Expect = 6e-04 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 5/70 (7%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPP--XPPXP---PXXPPLX 777 P +P P P P PPP PP P P PP PPP PP P PP+ Sbjct: 1174 PSSGIPPVPKPAAGVP--PVPPPSEAPPV-PKPSVGVPPVPPPSTAPPVPTPSAGLPPVP 1230 Query: 778 GGVXGAPXTP 807 AP P Sbjct: 1231 VPTAKAPPVP 1240 Score = 39.1 bits (87), Expect = 8e-04 Identities = 25/80 (31%), Positives = 27/80 (33%), Gaps = 5/80 (6%) Frame = +1 Query: 583 VPYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPP---XPPX 753 VP +P P P P P P P P P P PP P P PP Sbjct: 1133 VPVPSGAPPVPKPSVAAPPVPA-PSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPV 1191 Query: 754 PP--XXPPLXGGVXGAPXTP 807 PP PP+ G P P Sbjct: 1192 PPPSEAPPVPKPSVGVPPVP 1211 Score = 37.9 bits (84), Expect = 0.002 Identities = 25/80 (31%), Positives = 27/80 (33%), Gaps = 5/80 (6%) Frame = +1 Query: 583 VPYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPP---XPPX 753 VP +P P P P P P P P PP PP P P PP Sbjct: 1152 VPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVP-PPSEAPPVPKPSVGVPPV 1210 Query: 754 PP--XXPPLXGGVXGAPXTP 807 PP PP+ G P P Sbjct: 1211 PPPSTAPPVPTPSAGLPPVP 1230 Score = 37.9 bits (84), Expect = 0.002 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P PPP PP P P PPP P P P PP Sbjct: 1189 PPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPP 1228 Score = 36.7 bits (81), Expect = 0.004 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P +P P P P PPP PP P P PP P P PP P Sbjct: 1193 PPSEAPPVPKPSVGVP--PVPPPSTAPPV-PTPSAGLPPVPVPTAKAPPVPAP 1242 Score = 35.9 bits (79), Expect = 0.008 Identities = 24/80 (30%), Positives = 27/80 (33%), Gaps = 5/80 (6%) Frame = +1 Query: 583 VPYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXP-----PPXP 747 VP + +P P P P P P PP P P PP P PP P Sbjct: 1085 VPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPV-PKPSVAAPPVPVPSGAPPVP 1143 Query: 748 PXPPXXPPLXGGVXGAPXTP 807 PP+ GAP P Sbjct: 1144 KPSVAAPPVP-APSGAPPVP 1162 Score = 35.1 bits (77), Expect = 0.013 Identities = 18/60 (30%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = +1 Query: 634 IPXPXXPXPXXPXPP--PXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 +P P P P P P P PP P PP P PP+ G P P Sbjct: 1123 VPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVP 1182 Score = 34.7 bits (76), Expect = 0.018 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 IP P P P P PP P P PP P P PP P GAP P Sbjct: 1073 IPSIPAPSGAPPVPAPSGIPP-VPKPSVAAPPVPKPSVAVPPVPAP-----SGAPPVP 1124 Score = 33.5 bits (73), Expect = 0.041 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = +3 Query: 642 PXXPPPXPPPPP--PXXXPPXXPXPPPPPXPXPPXPXP--XAPP 761 P PPP P P P P P P P PP P P APP Sbjct: 1060 PSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPP 1103 Score = 32.7 bits (71), Expect = 0.071 Identities = 22/79 (27%), Positives = 25/79 (31%) Frame = +1 Query: 571 HAVYVPYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPP 750 H P + V P +P P P P P PP P PP P Sbjct: 990 HPPSAPLSKPVSTSPAAPLARVP----PVPKLSSKAPPVPLPSADAPPIPVPSTAPPVP- 1044 Query: 751 XPPXXPPLXGGVXGAPXTP 807 P PP+ GAP P Sbjct: 1045 IPTSTPPVPKSSSGAPSAP 1063 Score = 32.7 bits (71), Expect = 0.071 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P PP P P P P P P P APP Sbjct: 1092 PPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPP 1132 Score = 32.3 bits (70), Expect = 0.094 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P P PP P P P P P P P APP Sbjct: 1112 PPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPP 1151 Score = 32.3 bits (70), Expect = 0.094 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P P PP P P P P P P P APP Sbjct: 1131 PPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPP 1170 Score = 32.3 bits (70), Expect = 0.094 Identities = 18/63 (28%), Positives = 20/63 (31%) Frame = +1 Query: 583 VPYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPX 762 VP +P K +P P P P P P P P PP P P P Sbjct: 1191 VPPPSEAPPVP-KPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAPSV 1249 Query: 763 XPP 771 P Sbjct: 1250 STP 1252 Score = 31.5 bits (68), Expect = 0.17 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +3 Query: 633 DSPPXXPPPXPPPPP-PXXXPPXXPXPPPPPXPXPPXPXP 749 D+PP P PP P P PP P PP P P Sbjct: 1030 DAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAP 1069 Score = 31.1 bits (67), Expect = 0.22 Identities = 23/77 (29%), Positives = 24/77 (31%), Gaps = 8/77 (10%) Frame = +1 Query: 601 VXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXP--------PXPPPXPPXP 756 V +P K P P P P P PP P P P P PP P P Sbjct: 1011 VPPVPKLSSKAPPVPLPSADAPPIPVPSTAPP-VPIPTSTPPVPKSSSGAPSAPPPVPAP 1069 Query: 757 PXXPPLXGGVXGAPXTP 807 P GAP P Sbjct: 1070 SSEIPSIPAPSGAPPVP 1086 Score = 31.1 bits (67), Expect = 0.22 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 5/62 (8%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXP-----PPXPPXPPXXPPLXGGVXGAPX 801 P P P P P P P P PP P PP P PP+ GAP Sbjct: 1083 PPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVP-VPSGAPP 1141 Query: 802 TP 807 P Sbjct: 1142 VP 1143 Score = 30.7 bits (66), Expect = 0.29 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +3 Query: 621 IXQXDSPPXXPP-PXPPPPPPXXXPPXXPXP-PPPPXPXPPXPXP-XAPP 761 I +P PP P P PP P P P P PP P P APP Sbjct: 1073 IPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPP 1122 Score = 30.7 bits (66), Expect = 0.29 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 642 PXXPPPX--PPPPPPXXXPPXX-PXPPPPPXPXPPXPXPXAPPXS 767 P P P PP P P PP P PP P P P P S Sbjct: 1074 PSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPS 1118 Score = 30.7 bits (66), Expect = 0.29 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = +3 Query: 639 PPXXPPPXPPP-PPPXXXPPXXPXP----PPPPXPXPPXPXPXAPPXS 767 PP PP PP P P P P P PP P P P P S Sbjct: 1208 PPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAPSVSTPRSS 1255 Score = 29.9 bits (64), Expect = 0.50 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 636 SPPXXPPPX--PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 +PP P PP P P PP PP P P APP Sbjct: 1021 APPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPP 1064 Score = 29.5 bits (63), Expect = 0.67 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 7/48 (14%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXP-----XPPXPXP--XAPP 761 PP PP P P P P PP P PP P P APP Sbjct: 986 PPKDHPPSAPLSKPVSTSPAAPLARVPPVPKLSSKAPPVPLPSADAPP 1033 Score = 29.5 bits (63), Expect = 0.67 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 P P P PP P PPP P P P AP Sbjct: 1041 PPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAP 1079 Score = 29.1 bits (62), Expect = 0.88 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 4/62 (6%) Frame = +1 Query: 634 IPXPXXPXPXX----PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPX 801 IP P P P PP P P P PP P P PP+ AP Sbjct: 1045 IPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPA-PSGIPPVPKPSVAAPP 1103 Query: 802 TP 807 P Sbjct: 1104 VP 1105 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 636 SPPXXPPPXPP---PPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 +P PP P PP P P P P PP P P + P Sbjct: 1006 APLARVPPVPKLSSKAPPVPLPSADAPPIPVPSTAPPVPIPTSTP 1050 Score = 27.1 bits (57), Expect = 3.6 Identities = 19/75 (25%), Positives = 22/75 (29%) Frame = +1 Query: 583 VPYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPX 762 VP + +P K P P P P P PP P PP P Sbjct: 1043 VPIPTSTPPVP-KSSSGAPSAPPPVPAPSSEIPSIPAPSGA-PPVPAPSGIPPVPKPSVA 1100 Query: 763 XPPLXGGVXGAPXTP 807 PP+ P P Sbjct: 1101 APPVPKPSVAVPPVP 1115 Score = 26.2 bits (55), Expect = 6.2 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 2/44 (4%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP--XPXAPP 761 S P PP PP P P P PP P APP Sbjct: 980 SSPTSEPPKDHPPSAPLSKPVSTSPAAPLARVPPVPKLSSKAPP 1023 >SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 331 Score = 34.7 bits (76), Expect = 0.018 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +3 Query: 642 PXXPPPXPPPPP--PXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P P PP P P P PP P P P P P PP Sbjct: 99 PEEPLPREPPLPNEPVPEEPLPGEPPLPDEPVPEEPLPGEPP 140 Score = 29.9 bits (64), Expect = 0.50 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXP-PXXPXPPPPPXPXPPXPXPXAP 758 PP P P P P P P P P P PP P P Sbjct: 107 PPLPNEPVPEEPLPGEPPLPDEPVPEEPLPGEPPLPNEPVP 147 Score = 29.5 bits (63), Expect = 0.67 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 + P PP P P P P P P P P P P Sbjct: 100 EEPLPREPPLPNEPVPEEPLPGEPPLPDEPVPEEPLP 136 Score = 25.8 bits (54), Expect = 8.2 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXP-PXXXPPXPPPXPPXPPXXPPL 774 P P P P P P P P P P P P P P PPL Sbjct: 99 PEEPLPREP-PLPNEPVPEEPLPGEPPLPDEPVPEEPL-PGEPPL 141 >SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||Manual Length = 500 Score = 34.3 bits (75), Expect = 0.023 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG+ G G G GG GG G GG G GG G G Sbjct: 447 GGSRGGRGGFGGRGGFGGRGGFGGGRGRGRGGARSGNPNRG 487 Score = 27.9 bits (59), Expect = 2.0 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 718 GGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GGG G GG GG GG GG GG Sbjct: 446 GGGSRGGRGGFGGRGGFGGR-GGFGGG 471 >SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccharomyces pombe|chr 2|||Manual Length = 884 Score = 33.9 bits (74), Expect = 0.031 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP-XPXAP 758 +SP P P PP P P PPPPP P P AP Sbjct: 719 NSPAIKPQVTPAPPTPAPTPAVKHHPPPPPVRSSISPSMPPAP 761 Score = 26.6 bits (56), Expect = 4.7 Identities = 14/43 (32%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +1 Query: 679 PXXXPPXXPXPPXXXP-PXPPPXPPXPPXXPPLXGGVXGAPXT 804 P P P PP P P PP PP + + AP T Sbjct: 721 PAIKPQVTPAPPTPAPTPAVKHHPPPPPVRSSISPSMPPAPLT 763 Score = 25.8 bits (54), Expect = 8.2 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P PP P PPP P P PP Sbjct: 725 PQVTPAPPTPAPTPAVKHHPPPPPVRSSISPSMPP 759 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 32.7 bits (71), Expect = 0.071 Identities = 21/79 (26%), Positives = 21/79 (26%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXSXXXXXXXXXXXXXXXXX 818 P P PPPP P PPPP P P PP Sbjct: 198 PAHHEPGEHMPPPPMHHKPGEHMPPPPMHHEPGEHMP--PPPMHHEPGEHMPPPPMHHEP 255 Query: 819 SXXFXPPPQXXPPXHHHFP 875 PPP P H P Sbjct: 256 GEHMPPPPMHHEPGEHMPP 274 Score = 32.3 bits (70), Expect = 0.094 Identities = 21/79 (26%), Positives = 21/79 (26%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXSXXXXXXXXXXXXXXXXX 818 P P PPPP P PPPP P P PP Sbjct: 237 PMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMP--PPPMHHEPGEHMPPPPMHHEP 294 Query: 819 SXXFXPPPQXXPPXHHHFP 875 PPP P H P Sbjct: 295 GEHMPPPPMHHEPGEHMPP 313 Score = 29.5 bits (63), Expect = 0.67 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 P P PPPP P PPPP P P P Sbjct: 276 PMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 315 Score = 29.5 bits (63), Expect = 0.67 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 P P PPPP P PPPP P P P Sbjct: 289 PMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 328 Score = 29.5 bits (63), Expect = 0.67 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 P P PPPP P PPPP P P P Sbjct: 302 PMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 341 Score = 26.6 bits (56), Expect = 4.7 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P PPP PPPP P PP Sbjct: 275 PPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 315 Score = 26.6 bits (56), Expect = 4.7 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P PPP PPPP P PP Sbjct: 288 PPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 328 Score = 26.6 bits (56), Expect = 4.7 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P PPP PPPP P PP Sbjct: 301 PPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 341 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 32.7 bits (71), Expect = 0.071 Identities = 20/72 (27%), Positives = 22/72 (30%), Gaps = 6/72 (8%) Frame = +1 Query: 610 IPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXX------PPXPPPXPPXPPXXPP 771 +P + IP P P PP P P P PP PP PP P Sbjct: 478 VPSQNAPFIPGTSAPLPPTTFAPPGVPLPPIPGAPGMPNLNMSQPPMVPPGMALPPGMPA 537 Query: 772 LXGGVXGAPXTP 807 G P P Sbjct: 538 PFPGYPAVPAMP 549 Score = 32.3 bits (70), Expect = 0.094 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P P PP PP P PP P P P PP Sbjct: 484 PFIPGTSAPLPPTTFAPPGVPLPPIPGAPGMPNLNMSQPP 523 Score = 27.1 bits (57), Expect = 3.6 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = +1 Query: 643 PXXPXPXXPXPP--PXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P P P PP P P P P P P P G+ GA P Sbjct: 504 PLPPIPGAPGMPNLNMSQPPMVPPGMALPPGMPAPFPGYPAV--PAMPGIPGATAPP 558 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 32.3 bits (70), Expect = 0.094 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +1 Query: 673 PPPXXXPPXXPXPPXXXPP--XPPPXPPXPP 759 PPP PP P P PPP PP PP Sbjct: 167 PPPSFQPPSAAAPATSLPSDYNPPPPPPPPP 197 Score = 30.7 bits (66), Expect = 0.29 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXP 728 PP PP P P PPPPP P Sbjct: 168 PPSFQPPSAAAPATSLPSDYNPPPPPPPPP 197 Score = 30.7 bits (66), Expect = 0.29 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPPXPXPP 737 P PP P P PPPPP PP Sbjct: 221 PEIPPTYTPKQADPLPAPPPPPPPTLPP 248 Score = 30.7 bits (66), Expect = 0.29 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXP 728 P P PPPPPP PP P P Sbjct: 234 PLPAPPPPPPPTLPPQSTNTSQLPMP 259 Score = 30.3 bits (65), Expect = 0.38 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXPPPXPP 750 P PP P P PP PPP PP Sbjct: 167 PPPSFQPPSAAAPATSLPSDYNPPPPPPPPP 197 Score = 28.3 bits (60), Expect = 1.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 712 PXXXPPXPPPXPPXPPXXPP 771 P P P P PP PP PP Sbjct: 229 PKQADPLPAPPPPPPPTLPP 248 Score = 27.9 bits (59), Expect = 2.0 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 9/44 (20%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXP---------PPPPXPXPP 737 ++P P PPP PP P PPPP P PP Sbjct: 154 NAPTVSAPNSMVSPPPSFQPPSAAAPATSLPSDYNPPPPPPPPP 197 Score = 27.9 bits (59), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 PPP PP P PP P PP P Sbjct: 167 PPPSFQPPSAAAPATSLPSDYNPPPPPPPPP 197 Score = 27.9 bits (59), Expect = 2.0 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXP 743 P PP P P PPP P P P Sbjct: 221 PEIPPTYTPKQADPLPAPPPPPPPTLP 247 Score = 26.6 bits (56), Expect = 4.7 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = +3 Query: 666 PPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXSXXXXXXXXXXXXXXXXXSXXFXPPPQ 845 P PP P P PP P P P PP S S PPP Sbjct: 221 PEIPPTYTPKQADPLPAPP----PPPPPTLPPQSTNTSQLPMPSRNVNNLGSQVNIPPPP 276 Query: 846 XXP 854 P Sbjct: 277 ATP 279 Score = 26.6 bits (56), Expect = 4.7 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPP 750 P PP P P PP PP PP Sbjct: 221 PEIPPTYTPKQADPLPAPPPPPPPTLPP 248 Score = 26.2 bits (55), Expect = 6.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 627 QXDSPPXXPPPXPPPPPP 680 Q D P PPP PP PP Sbjct: 231 QADPLPAPPPPPPPTLPP 248 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 30.7 bits (66), Expect = 0.29 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 PPPPPP P P P PP P Sbjct: 1882 PPPPPPMALPKAGPPSAAPTSALPPAGPP 1910 Score = 26.2 bits (55), Expect = 6.2 Identities = 13/40 (32%), Positives = 14/40 (35%), Gaps = 1/40 (2%) Frame = +1 Query: 691 PPXXPXPPXXXPPXPPPXPPXPPXXPPLXG-GVXGAPXTP 807 PP P PP P PP PP + G P P Sbjct: 1884 PPPPMALPKAGPPSAAPTSALPPAGPPAGATAISGNPGMP 1923 Score = 25.8 bits (54), Expect = 8.2 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPP 737 PPP PP P PP P PP Sbjct: 1882 PPPPPPMALPKAGPPSAAPTSALPPAGPP 1910 >SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1841 Score = 28.3 bits (60), Expect = 1.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 642 PXXPPPXPPPPP 677 P PPP PPPPP Sbjct: 942 PAFPPPPPPPPP 953 Score = 25.8 bits (54), Expect(2) = 0.33 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +1 Query: 736 PPXPPXPPXXPPLXGGVXGAPXTP 807 P PP PP PPL G +P Sbjct: 942 PAFPPPPPPPPPLVSAAGGKFVSP 965 Score = 25.0 bits (52), Expect(2) = 1.2 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 693 PXXPXPPPPPXP 728 P P PPPPP P Sbjct: 942 PAFPPPPPPPPP 953 Score = 23.8 bits (49), Expect(2) = 0.71 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 639 PPXXPPPXPPPPPP 680 P P PPPPPP Sbjct: 899 PTIITHPTPPPPPP 912 Score = 23.8 bits (49), Expect(2) = 0.71 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 702 PXPPPPPXPXPP 737 P PPPP P PP Sbjct: 942 PAFPPPPPPPPP 953 Score = 23.0 bits (47), Expect(2) = 0.33 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 709 PPXXXPPXPPPXPPXP 756 P P PPP PP P Sbjct: 899 PTIITHPTPPPPPPLP 914 Score = 21.8 bits (44), Expect(2) = 1.2 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 651 PPPXPPPPPP 680 P P PPPP P Sbjct: 905 PTPPPPPPLP 914 >SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 857 Score = 30.3 bits (65), Expect = 0.38 Identities = 18/67 (26%), Positives = 20/67 (29%) Frame = +1 Query: 583 VPYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPX 762 VP V +P+ P P P P P P P PP PP Sbjct: 649 VPQRPAVPVVPEAPSVPQPPAAPVVPEVPSVPQPPAVPVVPEAGQLNEPVVPPLPPHDET 708 Query: 763 XPPLXGG 783 P GG Sbjct: 709 QEPQVGG 715 Score = 28.3 bits (60), Expect = 1.5 Identities = 18/76 (23%), Positives = 21/76 (27%), Gaps = 1/76 (1%) Frame = +1 Query: 583 VPYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPX 762 VP +P + P P P P P PP P P PP Sbjct: 625 VPVVPEAPSVPQPPAAPVVPEVPSVPQRPAVPVVPEAPSVPQPPAAPVVPEVPSVPQPPA 684 Query: 763 XPPL-XGGVXGAPXTP 807 P + G P P Sbjct: 685 VPVVPEAGQLNEPVVP 700 Score = 27.5 bits (58), Expect = 2.7 Identities = 18/76 (23%), Positives = 21/76 (27%), Gaps = 2/76 (2%) Frame = +1 Query: 586 PYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXX 765 P +P + + P P P P P PP P P PP Sbjct: 551 PVVPEAPSVPQRPAVPVVPEALSVPQPPVAPVAPEVPSVPQPPVAPVVPEAPSVPQPPVA 610 Query: 766 P--PLXGGVXGAPXTP 807 P P V P P Sbjct: 611 PVAPEVPSVPQRPAVP 626 >SPCC645.07 |rgf1||RhoGEF for Rho1, Rgf1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1334 Score = 28.7 bits (61), Expect = 1.2 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P PPP P P P PP P APP Sbjct: 44 PVSKKPLPPPTRRLPRKPLPFRSTSLQPPSSQPPAPP 80 >SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|Schizosaccharomyces pombe|chr 3|||Manual Length = 551 Score = 27.1 bits (57), Expect = 3.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPP 680 DS PP PPPPPP Sbjct: 299 DSANGGLPPPPPPPPP 314 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 27.1 bits (57), Expect = 3.6 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 S P P PP PP PP P P P P Sbjct: 919 SAPAIASPPPPKVGETYHPPTASGTRVPPVQQPSHPNPYTP 959 Score = 26.6 bits (56), Expect = 4.7 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P PP PP P P PPP P PP Sbjct: 1052 PQLPPVSSRLPPVSATRPQIPQPPPVSTALPSSSAVSRPP 1091 >SPBP8B7.16c |dbp2||ATP-dependent RNA helicase Dbp2|Schizosaccharomyces pombe|chr 2|||Manual Length = 550 Score = 27.1 bits (57), Expect = 3.6 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 737 GGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXG 642 GG GG G GG GGG G G G Sbjct: 508 GGRGGNYRRGGYGRGGFRRGGGYGNRNRGFTG 539 >SPAC13G7.02c |ssa1||heat shock protein Ssa1|Schizosaccharomyces pombe|chr 1|||Manual Length = 644 Score = 26.6 bits (56), Expect = 4.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -1 Query: 718 GGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG G GG G GG GG G E Sbjct: 612 GGAPGGAPGGMPGGAPGGAPGGADNGPE 639 >SPBC119.05c |||Wiskott-Aldrich syndrome homolog binding protein Lsb1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 296 Score = 26.6 bits (56), Expect = 4.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 702 PXPPPPPXPXPPXPXPXAPP 761 P PPPP PP APP Sbjct: 206 PPPPPPQQNYPPAASSSAPP 225 Score = 26.2 bits (55), Expect = 6.2 Identities = 13/36 (36%), Positives = 13/36 (36%), Gaps = 4/36 (11%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPP----PXPXPPXPXPXAP 758 PPPPP PP PP PP P P Sbjct: 207 PPPPPQQNYPPAASSSAPPMQYQQTAYPPQQAPYPP 242 >SPBC557.04 |ppk29||Ark1/Prk1 family protein kinase Ppk29|Schizosaccharomyces pombe|chr 2|||Manual Length = 872 Score = 26.6 bits (56), Expect = 4.7 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPP 713 PPP PP P P P P P Sbjct: 356 PPPPPPMPAPIYNVPNVPTVP 376 >SPBC660.05 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 143 Score = 26.6 bits (56), Expect = 4.7 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 718 GGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GGG G G GG GG GGG GG Sbjct: 112 GGGHHGPLHGPH--GGFGGRGGGRMGG 136 >SPBC13E7.03c |||RNA hairpin binding protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 713 Score = 23.4 bits (48), Expect(2) = 6.0 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 651 PPPXPPPP 674 PPP PPPP Sbjct: 370 PPPPPPPP 377 Score = 21.0 bits (42), Expect(2) = 6.0 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +3 Query: 708 PPPPPXPXPPXPXPXAPP 761 PPPPP P P + P Sbjct: 371 PPPPPPPELLNHSPKSRP 388 >SPCC794.04c |||membrane transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 547 Score = 25.8 bits (54), Expect = 8.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -1 Query: 505 WLSWSSFQSFHWNSKFPVGSF 443 WL W+ + S HW + G F Sbjct: 434 WLGWTCYPSVHWAAPMVSGIF 454 >SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2|||Manual Length = 1217 Score = 25.8 bits (54), Expect = 8.2 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 636 SPPXXPPPXPPPPP 677 S P PP PPPPP Sbjct: 1089 SKPSAVPPPPPPPP 1102 >SPCC584.15c |||arrestin/PY protein 2|Schizosaccharomyces pombe|chr 3|||Manual Length = 594 Score = 25.8 bits (54), Expect = 8.2 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +3 Query: 666 PPPPPXXXPPXXPXPPPPPXPXPP 737 P P P P P P PP P P Sbjct: 553 PSPVPTIIAPALPSTPAPPLPSHP 576 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,130,329 Number of Sequences: 5004 Number of extensions: 67707 Number of successful extensions: 1455 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 444486180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -