BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_C21 (886 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 71 9e-13 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 62 8e-10 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 61 1e-09 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 59 4e-09 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 58 7e-09 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 56 4e-08 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 56 4e-08 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 56 5e-08 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 54 2e-07 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 8e-07 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 51 1e-06 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 51 1e-06 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 50 2e-06 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 50 3e-06 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 49 4e-06 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 49 6e-06 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 48 8e-06 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 48 8e-06 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 47 2e-05 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 47 2e-05 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 47 2e-05 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 47 2e-05 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 46 4e-05 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 46 5e-05 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 45 7e-05 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 45 7e-05 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 45 9e-05 SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 44 1e-04 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 44 1e-04 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 44 2e-04 SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) 44 2e-04 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 43 3e-04 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 43 3e-04 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 42 5e-04 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 42 7e-04 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 42 9e-04 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 9e-04 SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) 42 9e-04 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 42 9e-04 SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 9e-04 SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 9e-04 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 41 0.002 SB_19562| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 41 0.002 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 41 0.002 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 41 0.002 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 41 0.002 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 40 0.002 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 40 0.002 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 40 0.002 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 40 0.002 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 40 0.002 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 40 0.002 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 40 0.002 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 40 0.003 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 40 0.003 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 40 0.003 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 40 0.003 SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_53480| Best HMM Match : Sigma70_r1_1 (HMM E-Value=5.7) 40 0.004 SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 40 0.004 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 40 0.004 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 40 0.004 SB_51557| Best HMM Match : Collagen (HMM E-Value=0.56) 39 0.005 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 39 0.005 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 39 0.005 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 39 0.006 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 39 0.006 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) 38 0.008 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 38 0.008 SB_14698| Best HMM Match : E1_DerP2_DerF2 (HMM E-Value=4.1e-31) 38 0.008 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 38 0.011 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 38 0.011 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 38 0.011 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 38 0.011 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 38 0.011 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.014 SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.014 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 37 0.019 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 37 0.019 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 37 0.019 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 37 0.019 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 37 0.019 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 36 0.033 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.033 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 36 0.033 SB_504| Best HMM Match : GRP (HMM E-Value=2.8) 36 0.033 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 36 0.033 SB_29605| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.033 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.033 SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.033 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.033 SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) 36 0.044 SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) 36 0.044 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 36 0.044 SB_44810| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) 36 0.044 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 36 0.044 SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.058 SB_35308| Best HMM Match : VWA (HMM E-Value=1.1e-20) 36 0.058 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 36 0.058 SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) 36 0.058 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 36 0.058 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.058 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.076 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 35 0.076 SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) 35 0.076 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.076 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.076 SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.10 SB_27284| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.10 SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.10 SB_13751| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.10 SB_55443| Best HMM Match : Homeobox (HMM E-Value=2.3e-26) 35 0.10 SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) 35 0.10 SB_14695| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.10 SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.10 SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) 35 0.10 SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) 35 0.10 SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) 34 0.13 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_27771| Best HMM Match : SH2 (HMM E-Value=8.6e-16) 34 0.13 SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 34 0.13 SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) 34 0.13 SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_55729| Best HMM Match : YajC (HMM E-Value=0.56) 34 0.18 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 34 0.18 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 34 0.18 SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) 34 0.18 SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) 34 0.18 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_52712| Best HMM Match : Dynein_light (HMM E-Value=3) 34 0.18 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 34 0.18 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 34 0.18 SB_8478| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) 33 0.23 SB_34601| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 33 0.23 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_40892| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 33 0.23 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_19205| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_51094| Best HMM Match : VWA (HMM E-Value=0) 33 0.31 SB_28064| Best HMM Match : DUF1174 (HMM E-Value=4.5) 33 0.31 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_31182| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 0.31 SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) 33 0.41 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.41 SB_48544| Best HMM Match : TSP_1 (HMM E-Value=3.1e-32) 33 0.41 SB_10487| Best HMM Match : FGF (HMM E-Value=1.4e-06) 33 0.41 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.41 SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) 33 0.41 SB_51163| Best HMM Match : Adeno_PIX (HMM E-Value=0.96) 32 0.54 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 32 0.54 SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) 32 0.54 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 32 0.54 SB_53084| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) 32 0.54 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 32 0.54 SB_23882| Best HMM Match : Cyt-b5 (HMM E-Value=9.2e-19) 32 0.54 SB_23371| Best HMM Match : SRCR (HMM E-Value=0) 32 0.54 SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) 32 0.71 SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.71 SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) 32 0.71 SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) 32 0.71 SB_37033| Best HMM Match : Annexin (HMM E-Value=0) 32 0.71 SB_25716| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.71 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.71 SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.71 SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.71 SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) 32 0.71 SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) 32 0.71 SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) 32 0.71 SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) 32 0.71 SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.85 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.94 SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.94 SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) 31 0.94 SB_35820| Best HMM Match : TRAP_240kDa (HMM E-Value=0.006) 31 0.94 SB_35620| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.94 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 31 0.94 SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.94 SB_20156| Best HMM Match : GED (HMM E-Value=6.8e-16) 31 0.94 SB_51035| Best HMM Match : Extensin_2 (HMM E-Value=0.33) 31 0.94 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 31 0.94 SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) 31 0.94 SB_31904| Best HMM Match : Extensin_2 (HMM E-Value=0.5) 26 0.96 SB_56109| Best HMM Match : Collagen (HMM E-Value=0.79) 31 1.2 SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) 31 1.2 SB_45113| Best HMM Match : CemA (HMM E-Value=6) 31 1.2 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 31 1.2 SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 31 1.2 SB_15415| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_8600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 31 1.2 SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) 31 1.2 SB_54760| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_52043| Best HMM Match : Collagen (HMM E-Value=0.77) 31 1.6 SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 31 1.6 SB_41259| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_37296| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_33199| Best HMM Match : Collagen (HMM E-Value=0.77) 31 1.6 SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) 31 1.6 SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) 31 1.6 SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) 31 1.6 SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_50149| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_43644| Best HMM Match : SH3_1 (HMM E-Value=0) 31 1.6 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 31 1.6 SB_24909| Best HMM Match : Mab-21 (HMM E-Value=3.4e-06) 31 1.6 SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) 31 1.6 SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) 31 1.6 SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_222| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_19890| Best HMM Match : Drf_FH1 (HMM E-Value=2.4) 30 2.2 SB_2886| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_57323| Best HMM Match : ShTK (HMM E-Value=0) 30 2.2 SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) 30 2.2 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 30 2.2 SB_40594| Best HMM Match : Extensin_2 (HMM E-Value=0.083) 30 2.2 SB_33702| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 30 2.2 SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_54430| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) 30 2.9 SB_43997| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_42662| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_42247| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) 30 2.9 SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_41312| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_36777| Best HMM Match : VWA (HMM E-Value=0) 30 2.9 SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) 30 2.9 SB_16709| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) 30 2.9 SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) 30 2.9 SB_21275| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 3.6 SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_51716| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_51034| Best HMM Match : Extensin_2 (HMM E-Value=0.038) 29 3.8 SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) 29 3.8 SB_48645| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=0.17) 29 3.8 SB_42335| Best HMM Match : Hint (HMM E-Value=1.4013e-45) 29 3.8 SB_32416| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0021) 29 3.8 SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) 29 3.8 SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) 29 3.8 SB_4001| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0056) 29 3.8 SB_1002| Best HMM Match : OTCace_N (HMM E-Value=0) 29 3.8 SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 29 3.8 SB_42044| Best HMM Match : ubiquitin (HMM E-Value=1.2e-06) 29 3.8 SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_15136| Best HMM Match : Peptidase_S13 (HMM E-Value=0.27) 29 3.8 SB_10452| Best HMM Match : TP2 (HMM E-Value=9.5) 29 3.8 SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_738| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_59007| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) 29 5.0 SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_46131| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_41234| Best HMM Match : CASP_C (HMM E-Value=0.79) 29 5.0 SB_36040| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_20016| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) 29 5.0 SB_3455| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_984| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_59765| Best HMM Match : Metallothio_2 (HMM E-Value=4.3) 29 5.0 SB_44878| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_32762| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 29 5.0 SB_25393| Best HMM Match : Collagen (HMM E-Value=0.00015) 29 5.0 SB_18739| Best HMM Match : YhhN (HMM E-Value=7.3) 29 5.0 SB_16879| Best HMM Match : Stig1 (HMM E-Value=1) 29 5.0 SB_10217| Best HMM Match : ubiquitin (HMM E-Value=1.6e-06) 29 5.0 SB_38095| Best HMM Match : No HMM Matches (HMM E-Value=.) 24 5.9 SB_43730| Best HMM Match : Drf_FH1 (HMM E-Value=0.74) 29 6.6 SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_11987| Best HMM Match : OTU (HMM E-Value=1.1e-24) 29 6.6 SB_11360| Best HMM Match : PDZ (HMM E-Value=0) 29 6.6 SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) 29 6.6 SB_6877| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_3165| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_57911| Best HMM Match : Drf_FH1 (HMM E-Value=2.3) 29 6.6 SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_45794| Best HMM Match : zf-CCCH (HMM E-Value=3.1e-27) 29 6.6 SB_45508| Best HMM Match : PT (HMM E-Value=7) 29 6.6 SB_43407| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) 29 6.6 SB_5763| Best HMM Match : Cadherin (HMM E-Value=0) 29 6.6 SB_3180| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_2691| Best HMM Match : Luteo_Vpg (HMM E-Value=2.1) 29 6.6 SB_5778| Best HMM Match : Gag_MA (HMM E-Value=1.2) 25 8.0 SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_31707| Best HMM Match : Extensin_2 (HMM E-Value=0.19) 28 8.7 SB_31698| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_28631| Best HMM Match : Drf_FH1 (HMM E-Value=0.35) 28 8.7 SB_28577| Best HMM Match : Chitin_bind_3 (HMM E-Value=0.00012) 28 8.7 SB_12656| Best HMM Match : CS (HMM E-Value=0.0018) 28 8.7 SB_49263| Best HMM Match : Surp (HMM E-Value=1e-28) 28 8.7 SB_26965| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0) 28 8.7 SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 71.3 bits (167), Expect = 9e-13 Identities = 26/41 (63%), Positives = 26/41 (63%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PPP PPPPPP PP P PPPPP P PP P P PP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 71.3 bits (167), Expect = 9e-13 Identities = 26/41 (63%), Positives = 26/41 (63%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PPP PPPPPP PP P PPPPP P PP P P PP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 70.1 bits (164), Expect = 2e-12 Identities = 26/41 (63%), Positives = 26/41 (63%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PPP PPPPP PP P PPPPP P PP P P APP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 69.7 bits (163), Expect = 3e-12 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 SPP PPP PP PPP PP P PPPPP P PP P P PP Sbjct: 377 SPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 69.7 bits (163), Expect = 3e-12 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 SPP P P PPPPPP PP P PPPPP P PP P P PP Sbjct: 388 SPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 68.5 bits (160), Expect = 7e-12 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +3 Query: 636 SPPXXPPPXPPPP-PPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 SPP PPP PPPP PP PP P PPPPP P PP P P PP Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 68.1 bits (159), Expect = 9e-12 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P P PPPPPP PP P PPPPP P PP P P PP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 68.1 bits (159), Expect = 9e-12 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PPP PPPPP PP P PPPPP P PP P P PP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 68.1 bits (159), Expect = 9e-12 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PPP PPPPP PP P PPPPP P PP P P PP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 68.1 bits (159), Expect = 9e-12 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PPP PPPPPP PP P PPPP P PP P P PP Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 64.9 bits (151), Expect = 8e-11 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PPP P PPPP PP P PPP P P PP P P PP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 64.9 bits (151), Expect = 8e-11 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PPP PPPPP PP P PP PP P PP P P PP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 64.9 bits (151), Expect = 8e-11 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PP PPPPPP PP PPPPP P PP P P PP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 64.5 bits (150), Expect = 1e-10 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXA 755 PP PPP PPPPPP PP P P PPP P PP P P A Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPA 433 Score = 63.3 bits (147), Expect = 3e-10 Identities = 24/45 (53%), Positives = 24/45 (53%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P PPP PP P PP PP PPP PP PP PP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 61.7 bits (143), Expect = 8e-10 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +3 Query: 627 QXDSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 Q PP PPP PPPPPP PP PPPPP P PP P Sbjct: 394 QPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 60.1 bits (139), Expect = 2e-09 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PPP PPPPPP P P PPPPP P P APP Sbjct: 401 PPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 56.8 bits (131), Expect = 2e-08 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P PP PP P PP P PPP PP PP PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 45.6 bits (103), Expect = 5e-05 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P PPP PP PP PP PPP PP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 63.7 bits (148), Expect = 2e-10 Identities = 29/62 (46%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +3 Query: 582 CTLXKKCXTHS**IXQXDSPPXXPPPXPP--PPPPXXXPPXXPXPPPPPXPXPPXPXPXA 755 C + KC H +PP PPP PP PPPP PP P PPPP P PP P P Sbjct: 74 CLVSAKCGGHPP-TNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPY 132 Query: 756 PP 761 PP Sbjct: 133 PP 134 Score = 60.1 bits (139), Expect = 2e-09 Identities = 24/41 (58%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +3 Query: 642 PXXPPPXPPPP-PPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P PPP PPPP PP PP P PPPP P PP P P PP Sbjct: 173 PYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPP 213 Score = 57.2 bits (132), Expect = 2e-08 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P PPP PP PPP PP P PP P P PP P P PP Sbjct: 147 PYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPP 186 Score = 56.4 bits (130), Expect = 3e-08 Identities = 25/45 (55%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Frame = +3 Query: 639 PPXXPPPXPP--PPPPXXXPPXXPXPPPP--PXPXPPXPXPXAPP 761 PP PP PP PPPP PP P PPPP P P PP P P PP Sbjct: 150 PPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPP 194 Score = 56.4 bits (130), Expect = 3e-08 Identities = 25/75 (33%), Positives = 29/75 (38%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXSXXXXXXXXXXXXXXXXX 818 P PPP PPPP PP P PP PP P PP P PP + Sbjct: 159 PLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAP 218 Query: 819 SXXFXPPPQXXPPXH 863 + + PPP P + Sbjct: 219 NPPYPPPPNAPNPPY 233 Score = 56.0 bits (129), Expect = 4e-08 Identities = 29/80 (36%), Positives = 31/80 (38%), Gaps = 1/80 (1%) Frame = +3 Query: 639 PPXXPPPXPPPP-PPXXXPPXXPXPPPPPXPXPPXPXPXAPPXSXXXXXXXXXXXXXXXX 815 P PPP PPPP PP PP P PPPP P PP P PP Sbjct: 101 PYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPP-----SPNAPYPPPPNPP 155 Query: 816 XSXXFXPPPQXXPPXHHHFP 875 PPP PP + +P Sbjct: 156 YPPPLYPPPPNPPPPNAPYP 175 Score = 56.0 bits (129), Expect = 4e-08 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PPP PPPP PP P PPPP P PP P P PP Sbjct: 158 PPLYPPPPNPPPPNAPYPP-PPYPPPPNPPYPPPPNPPYPP 197 Score = 54.0 bits (124), Expect = 2e-07 Identities = 24/57 (42%), Positives = 25/57 (43%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P P P PPP PP P PP P PP PP PP PP +P P Sbjct: 93 PYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPP--PPNPPYPPPPNAPYPPSPNAP 147 Score = 54.0 bits (124), Expect = 2e-07 Identities = 24/46 (52%), Positives = 25/46 (54%), Gaps = 4/46 (8%) Frame = +3 Query: 636 SPPXXPPPXPP--PPP--PXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 +PP PPP PP PPP P PP P PPPP P PP P P P Sbjct: 184 NPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAP 229 Score = 53.6 bits (123), Expect = 2e-07 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P PPPP P PP P PP PP P P P P PP Sbjct: 141 PPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPP 181 Score = 53.2 bits (122), Expect = 3e-07 Identities = 28/74 (37%), Positives = 30/74 (40%), Gaps = 6/74 (8%) Frame = +3 Query: 639 PPXXPPPXPP-PPPPXXXPPXXPXPPPP--PXPXP---PXPXPXAPPXSXXXXXXXXXXX 800 PP PPP P PPPP PP P PPPP P P P P P P PP Sbjct: 164 PPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYP 223 Query: 801 XXXXXXSXXFXPPP 842 + + PPP Sbjct: 224 PPPNAPNPPYPPPP 237 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPP-XXXPPXPPPXPPXPPXXPP 771 P P P P PPP PP P PP PP P P PP PP PP Sbjct: 147 PYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPP 190 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = +1 Query: 637 PXPXXPXPXXPXPP--PXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P P P PP P P P PP PP PPP P PP PP P P Sbjct: 123 PYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPP 181 Score = 50.4 bits (115), Expect = 2e-06 Identities = 21/39 (53%), Positives = 21/39 (53%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 P PPP PP PPP P P PPPP P PP P P P Sbjct: 202 PNPPPPNPPYPPPPNAP-NPPYPPPPNAPNPPYPPPPNP 239 Score = 50.0 bits (114), Expect = 3e-06 Identities = 25/57 (43%), Positives = 25/57 (43%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P P P PPP PP P PP PP PP PP PP P AP P Sbjct: 152 PNPPYPPPLYP-PPPNPPPPNAPYPPPPYPP--PPNPPYPPPPNPPYPPPPNAPNPP 205 Score = 50.0 bits (114), Expect = 3e-06 Identities = 23/46 (50%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +3 Query: 636 SPPXXPPPX----PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 +PP PPP PPP PP PP P PP PP P P P P PP Sbjct: 192 NPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNP-PYPPP 236 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/50 (48%), Positives = 24/50 (48%), Gaps = 5/50 (10%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXP-PXXPXPPXXXPPX----PPPXPPXPPXXPP 771 P P P P P PPP P P P PP PP PPP PP PP PP Sbjct: 168 PPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPP--PP 215 Score = 47.2 bits (107), Expect = 2e-05 Identities = 29/79 (36%), Positives = 29/79 (36%), Gaps = 3/79 (3%) Frame = +1 Query: 580 YVPYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPX-PPXP 756 Y PY P P P P P P PP PP P PP P PPP PP P Sbjct: 99 YPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPP-YPPPPNAPYPPSPNAPYPPPPNPPYP 157 Query: 757 P--XXPPLXGGVXGAPXTP 807 P PP AP P Sbjct: 158 PPLYPPPPNPPPPNAPYPP 176 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPP-XPPPXPPXPPXXPP 771 P P P P P PP PP P PP PP PPP P PP PP Sbjct: 183 PNPPYPPPPNPPYPP---PPNAPNPPPPNPPYPPPPNAPNPPYPPP 225 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 4/47 (8%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPP----XPPXPPXXPP 771 P P P P PPP PP P P PP PPP PP PP P Sbjct: 194 PYPPPPNAPNPPPPN-PPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 P P P P P PP PP P PP PP P P PP P Sbjct: 197 PPPNAPNPPPPNPP-YPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 41.9 bits (94), Expect = 7e-04 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 676 PPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 PP P P PP PP PPP P PP PP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPP 115 Score = 41.5 bits (93), Expect = 9e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P PP PP PP PP P PP PP PP Sbjct: 139 PYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPP-PPYPPP 182 Score = 37.5 bits (83), Expect = 0.014 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +1 Query: 676 PPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 PP PP P PP PP PP PP PP PP P P Sbjct: 92 PPYPPPPYPPYPPP--PPYPP--PPNPPYPPPPNAPYPPPPNPP 131 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 61.7 bits (143), Expect = 8e-10 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 PPP PPPPPP PP P PPPPP P PP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 56.4 bits (130), Expect = 3e-08 Identities = 22/38 (57%), Positives = 23/38 (60%) Frame = +3 Query: 621 IXQXDSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXP 734 + Q PP PPP PPPPPP PP P PPPPP P P Sbjct: 460 VGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPP-PTP 496 Score = 53.6 bits (123), Expect = 2e-07 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PPPPPP PP P PPPPP P PP P P PP Sbjct: 464 PPPPPP---PPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 51.6 bits (118), Expect = 8e-07 Identities = 19/32 (59%), Positives = 19/32 (59%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PPPPPP PP P PPPPP P P P P P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 49.2 bits (112), Expect = 4e-06 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = +1 Query: 673 PPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 PPP PP P PP PP PPP PP PP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 47.6 bits (108), Expect = 1e-05 Identities = 19/33 (57%), Positives = 19/33 (57%) Frame = +1 Query: 673 PPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 PPP PP P PP PP PPP PP PP PP Sbjct: 464 PPPPPPPPPPPPPPP--PPPPPPPPPFPPPPPP 494 Score = 45.2 bits (102), Expect = 7e-05 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPP 759 P PPP PP P PP PP PP PP PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 709 PPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 PP PP PPP PP PP PP P TP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 61.3 bits (142), Expect = 1e-09 Identities = 26/41 (63%), Positives = 26/41 (63%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG G GGGGG G GG GGGGGG GGG GG Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 60.5 bits (140), Expect = 2e-09 Identities = 26/41 (63%), Positives = 26/41 (63%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG G GGGGG G GG GGGGGG GGG GG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 59.3 bits (137), Expect = 4e-09 Identities = 25/43 (58%), Positives = 26/43 (60%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 + GG G G GG G GGGGG G GG GGGGGG GGG G Sbjct: 661 DGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 58.8 bits (136), Expect = 5e-09 Identities = 25/43 (58%), Positives = 26/43 (60%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 + G G G GG G GGGGG G GG GGGGGG GGG GG Sbjct: 658 DGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 58.0 bits (134), Expect = 9e-09 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G GG G GGGGG G GG GGGGGG GGG GG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 696 Score = 56.4 bits (130), Expect = 3e-08 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG G GGGGG G GG GGGGGG GG G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 56.4 bits (130), Expect = 3e-08 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG G GGGGG G GG GGGGGG GG G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 54.8 bits (126), Expect = 9e-08 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG G G GG G GGGGG G GG GGGGG G G G+ Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGD 711 Score = 52.0 bits (119), Expect = 6e-07 Identities = 22/42 (52%), Positives = 23/42 (54%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG G G GG G GGGGG G GG G GG G G G G+ Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGD 715 Score = 51.2 bits (117), Expect = 1e-06 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 GG GG GG GGG GG GG G GG GGG G G G G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 48.8 bits (111), Expect = 6e-06 Identities = 21/42 (50%), Positives = 22/42 (52%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG G G GG G GGGGG G GG GG G G G G+ Sbjct: 676 GGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDGD 717 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 G G GG GGG GG GG G GG GGG G G G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 GG GG GG GGG GG GG G GG GG G G G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/44 (45%), Positives = 22/44 (50%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GG G G GG G GGGGG G GG G G G G +S+ Sbjct: 678 GGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDGDVDSN 721 Score = 37.5 bits (83), Expect = 0.014 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG GGGG G G GG GG GG GGG GG GG G G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGG---GGGGGGGGGGGGGGG-GGGGAGGAGAGAGDDDG 714 Query: 677 GG 672 G Sbjct: 715 DG 716 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 59.3 bits (137), Expect = 4e-09 Identities = 27/51 (52%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = +3 Query: 621 IXQXDSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP----XPXAPP 761 I Q PP PPP PPPPPP P P PPPPP P PP P P PP Sbjct: 201 ITQPPPPPPRPPPSPPPPPPPPSPSP-PRPPPPPPPSPPRPLAAKLPEPPP 250 Score = 48.4 bits (110), Expect = 8e-06 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 P P P PPP PP P PP PP PPP PP P P Sbjct: 204 PPPPPPRPPPSPPPP--PPPPSPSPPRPPPPPPPSPPRP 240 Score = 47.6 bits (108), Expect = 1e-05 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P PPP PP P PP P PP PP PP PP Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 47.6 bits (108), Expect = 1e-05 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 7/48 (14%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXP-------PXPXPXAPP 761 PP PP PPPPP PP P PPPP P P P P P PP Sbjct: 212 PPSPPP---PPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPP 256 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P PPP PP P P P PPP P PP PP Sbjct: 217 PPPPPPSPSPPRPPP-PPPPSPPRPLAAKLPEPPPIPNMPPTLPP 260 Score = 46.4 bits (105), Expect = 3e-05 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P PPP PP P PP PP P P PP PP PP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPP---PPPPSPSPPRPPPPPP 234 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/51 (47%), Positives = 25/51 (49%), Gaps = 5/51 (9%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXP-----PXXPPL 774 P P P P P PPP PP P PP PP PPP PP P P PP+ Sbjct: 204 PPPPPPRPP-PSPPP-PPPPPSPSPP-RPPPPPPPSPPRPLAAKLPEPPPI 251 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PP PPPPPP P P P P P P PP Sbjct: 221 PPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 58.4 bits (135), Expect = 7e-09 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG G G GG G GGGGG G G GGGGGG GGG GG+ Sbjct: 785 GGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGD 826 Score = 56.0 bits (129), Expect = 4e-08 Identities = 33/77 (42%), Positives = 34/77 (44%), Gaps = 1/77 (1%) Frame = -1 Query: 856 GGXXWGGGXXXXEGXXXXXXXXXXXXXXXGEXGG-AXGXGXGGXGXGGGGGXGXXGGXXX 680 G GGG G G+ GG A G G GG G GGGGG G GG Sbjct: 808 GDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGG 867 Query: 679 GGGGGGXGGGXXGGESS 629 GGGGGG GG ESS Sbjct: 868 GGGGGGGGGVIKNEESS 884 Score = 55.6 bits (128), Expect = 5e-08 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G GG G GGGGG G GG G GGGG GGG GG Sbjct: 783 GDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGG 823 Score = 55.6 bits (128), Expect = 5e-08 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG G G GGG G G GGGGGG GGG GG Sbjct: 789 GGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Score = 54.0 bits (124), Expect = 2e-07 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G G GGGGG G GG GGGGGG GGG GG Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGG 806 Score = 53.6 bits (123), Expect = 2e-07 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG G G G G G GGG G GG GGGGGG GGG G+ Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGD 811 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/46 (56%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXG-----GGGGGXGGGXXGG 638 GG G G GG G GGGGG G GG G GGGGG GGG GG Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGG 824 Score = 53.6 bits (123), Expect = 2e-07 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG 641 + GG G G GG G GGGG G G GGGGGG GGG G Sbjct: 784 DGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 52.8 bits (121), Expect = 4e-07 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG G GGG G G G GGGGGG GGG G Sbjct: 787 GGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG 827 Score = 52.8 bits (121), Expect = 4e-07 Identities = 32/83 (38%), Positives = 33/83 (39%), Gaps = 1/83 (1%) Frame = -1 Query: 856 GGXXWGGGXXXXEGXXXXXXXXXXXXXXXGEXGGAXGXGXGGX-GXGGGGGXGXXGGXXX 680 GG GGG +G G G G G GG G GGG G GG Sbjct: 799 GGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGG 858 Query: 679 GGGGGGXGGGXXGGESSCXIYQE 611 GGGGGG GGG GG I E Sbjct: 859 GGGGGGGGGGGGGGGGGGVIKNE 881 Score = 52.0 bits (119), Expect = 6e-07 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG G G G G G GG GGGGGG GGG G Sbjct: 793 GGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDG 833 Score = 51.6 bits (118), Expect = 8e-07 Identities = 24/44 (54%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGG-GGGXGGGXXGG 638 + G G G GG G GGGGG G GG GGG G G GGG GG Sbjct: 775 DGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/37 (59%), Positives = 22/37 (59%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G GG G GGGG GG GGGGGG GGG GG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGG 805 Score = 50.4 bits (115), Expect = 2e-06 Identities = 22/41 (53%), Positives = 23/41 (56%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G G GG G GGG G G GG GGGGGG G G G+ Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGD 809 Score = 50.4 bits (115), Expect = 2e-06 Identities = 24/42 (57%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -1 Query: 760 GGAXGXGXGGX-GXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG G GGGGG G GG GG GGG G G GG Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGG 814 Score = 49.6 bits (113), Expect = 3e-06 Identities = 29/71 (40%), Positives = 29/71 (40%), Gaps = 2/71 (2%) Frame = -3 Query: 842 GGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGG--XXXGGXGXXGGXXXGGGX 669 GGGG G G GG GG GG GGG GG GG G GG G G Sbjct: 789 GGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGG 848 Query: 668 GXXGXGXXGXG 636 G G G G G Sbjct: 849 GGGGGGGGGGG 859 Score = 48.8 bits (111), Expect = 6e-06 Identities = 30/77 (38%), Positives = 30/77 (38%) Frame = -3 Query: 842 GGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGX 663 GGGG G G GG GG GG GGG G GG G GG GG G Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Query: 662 XGXGXXGXGIXLXYLSG 612 G G G G Y G Sbjct: 830 YGDG-GGFGDGGGYADG 845 Score = 47.6 bits (108), Expect = 1e-05 Identities = 29/74 (39%), Positives = 29/74 (39%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG GGGG G G G GG GG GGG GG GG G GG G Sbjct: 781 GGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGG-GGGDGGGYGDGGGFGDG 839 Query: 677 GGXGXXGXGXXGXG 636 GG G G G Sbjct: 840 GGYADGDGGGGGGG 853 Score = 46.0 bits (104), Expect = 4e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 GG GG GG GGG GG GG G GG GGG G G G G Sbjct: 769 GGGGGGDGGDGGG-GGDGGGGGGGGGGGGGGGGGGDGGGYGDGDG 812 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/76 (39%), Positives = 30/76 (39%), Gaps = 2/76 (2%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXG-GXGGGXGG-XXXGGXGXXGGXX 684 GG G GG G G GG GG G G GGG GG GG G GG Sbjct: 772 GGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYG 831 Query: 683 XGGGXGXXGXGXXGXG 636 GGG G G G G Sbjct: 832 DGGGFGDGGGYADGDG 847 Score = 44.4 bits (100), Expect = 1e-04 Identities = 27/74 (36%), Positives = 27/74 (36%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG GG G G G G GG G GGG GG G GG G Sbjct: 800 GGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGG 859 Query: 677 GGXGXXGXGXXGXG 636 GG G G G G G Sbjct: 860 GGGGGGGGGGGGGG 873 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXG 726 GG GGG G G GG GG GG GGG G Sbjct: 833 GGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 57.6 bits (133), Expect = 1e-08 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PP PPP PPPPPP PP PPPPP PP AP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 Score = 52.4 bits (120), Expect = 5e-07 Identities = 19/33 (57%), Positives = 19/33 (57%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PPPPPP PP P PPPP PP P P PP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 51.2 bits (117), Expect = 1e-06 Identities = 25/59 (42%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = +1 Query: 634 IPXPXXPXPXXPX-PPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 IP P P PPP PP P PP PP P PP PP PP+ GAP +P Sbjct: 669 IPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQS--GAPGSP 725 Score = 46.0 bits (104), Expect = 4e-05 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 PP PPP PPPPPP P P PPP P P +P S Sbjct: 688 PPPPPPPPPPPPPP--QPSTPPPPPPSTPPVQQSGAPGSPAGS 728 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PP PPP PPPP P PP P PP P +P Sbjct: 690 PPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSP 729 Score = 41.5 bits (93), Expect = 9e-04 Identities = 23/66 (34%), Positives = 27/66 (40%) Frame = +1 Query: 601 VXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXG 780 + +P +P P P P P PPP PP P P PP PP PP P G Sbjct: 671 IQILPIPIQTMVPPPPPPPPPPPPPPP---PP--PPQPSTPPPPPPSTPPVQQSGAP--G 723 Query: 781 GVXGAP 798 G+P Sbjct: 724 SPAGSP 729 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 GG G GG GG G GG G GG GG GG S Sbjct: 601 GGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNS 643 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 GG G GG GG G GG G GG GG GG + Sbjct: 575 GGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNT 617 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GG G G GG G GG G GG GG GG +S Sbjct: 605 GGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSGGSNS 648 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GG G GG GG G GG GG GG GG GG ++ Sbjct: 571 GGNTGGNNGG-NTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNN 613 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GG G GG GG G GG GG GG GG GG ++ Sbjct: 597 GGNTGGNNGG-NTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNN 639 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GG G G G G GG GG GG GG GG ++ Sbjct: 544 GGNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNN 587 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GG G G GG G GG G GG GG GG ++ Sbjct: 553 GGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNN 596 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GG G G GG G GG G GG GG GG ++ Sbjct: 579 GGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNN 622 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 G G GG GG G GG G GG GG GG + Sbjct: 540 GNNNGGNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNT 582 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 GG G G GG G GG G GG GG GG + Sbjct: 566 GGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNT 608 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 GG G G GG G GG G GG GG GG + Sbjct: 592 GGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNT 634 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 G G G GG G GG G GG GG GG + Sbjct: 549 GSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNT 591 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 GG G G GG G G G GG GG GG + Sbjct: 562 GGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNN 604 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 GG G G GG G G G GG GG GG + Sbjct: 588 GGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNN 630 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG+ G G GG G G GG GG GG G Sbjct: 548 GGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNG 588 Score = 31.5 bits (68), Expect = 0.94 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGG--GGGGXGGGXXGGESS 629 G GG GG G GG GG GG GG GG ++ Sbjct: 419 GNDKGGNTNGGNNNGGNNGGNNNGGNTGGDNNGGNNYGGNNN 460 Score = 31.5 bits (68), Expect = 0.94 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG G GG G GG GG G Sbjct: 583 GGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNG 623 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 G G GG GG G G GG GG GG + Sbjct: 584 GNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNT 626 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/74 (25%), Positives = 19/74 (25%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 G GG K G GG GG G GG GG G G Sbjct: 413 GNSNNGGNDKGGNTNGGNNNGGNNGGNNNGGNTGGDNNGGNNYGGNNNGGNNNVGNNNGG 472 Query: 677 GGXGXXGXGXXGXG 636 G G G Sbjct: 473 NNNGGNNNGGNNNG 486 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G GG GG G GG GG GG G Sbjct: 531 GNNNGENNGGNNNGGNNGGSNNGGNDGSNNNGGNTGGNNNG 571 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGG-GGGXGGGXXGGESS 629 G G G GG G GG GG G GG GG ++ Sbjct: 526 GNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNGGNTGGNNN 570 Score = 30.3 bits (65), Expect = 2.2 Identities = 23/70 (32%), Positives = 23/70 (32%), Gaps = 5/70 (7%) Frame = -3 Query: 836 GGKXXRRXXXGVXGAPXTPPXRGGXXGG--XGGXGGGXGGXXXGG---XGXXGGXXXGGG 672 GG G G GG GG GG GG G GG G GG GG Sbjct: 566 GGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGN 625 Query: 671 XGXXGXGXXG 642 G G G Sbjct: 626 TGGNNGGNTG 635 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/74 (24%), Positives = 18/74 (24%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG GG G GG G GG G G GG G Sbjct: 476 GGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNG 535 Query: 677 GGXGXXGXGXXGXG 636 G G G Sbjct: 536 ENNGGNNNGGNNGG 549 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGG---GGGGXGGGXXGGESS 629 G GG GG G G GG GG GG GG ++ Sbjct: 482 GNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNN 524 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 G GG GG GG GG GG G G ++ Sbjct: 521 GNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNN 560 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGG---GGGGXGGGXXGGESS 629 G GG GG GG GG GG GG GG ++ Sbjct: 487 GNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNN 529 Score = 29.1 bits (62), Expect = 5.0 Identities = 21/77 (27%), Positives = 21/77 (27%), Gaps = 3/77 (3%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGG---XGXXGGX 687 GG GG G GG G GG G GG G GG Sbjct: 491 GGNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGS 550 Query: 686 XXGGGXGXXGXGXXGXG 636 GG G G G Sbjct: 551 NNGGNDGSNNNGGNTGG 567 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGG---GGGGXGGGXXGGESS 629 G GG G G GG GG GG GG GG ++ Sbjct: 492 GNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNN 534 Score = 28.7 bits (61), Expect = 6.6 Identities = 21/79 (26%), Positives = 21/79 (26%), Gaps = 7/79 (8%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGG-------XGX 699 GG GG G G G GG GG GG G Sbjct: 505 GGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNGGN 564 Query: 698 XGGXXXGGGXGXXGXGXXG 642 GG GG G G G Sbjct: 565 TGGNNNGGNTGGNNGGNTG 583 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GG G G GG G GG GG GG ++ Sbjct: 442 GGNTGGDNNGGNNYGGNNNGGNNNVGNNNGGNNNGGNNNGGNNN 485 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/47 (31%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGG---GGGXGGGXXGGESS 629 G G G GG G G GG GG GG GE++ Sbjct: 492 GNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENN 538 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGG--GGGGXGGGXXGGESS 629 G GG GG G G G GG GG GG ++ Sbjct: 511 GNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNN 552 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGG-XGGGXXGGES 632 G G G GG G G GG GG GG GG + Sbjct: 535 GENNGGNNNGGNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNN 578 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 56.8 bits (131), Expect = 2e-08 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 PPP PPPPPP PP P PPPPP P PP P P Sbjct: 1157 PPPPPPPPPP---PPSSPSPPPPPPPPPPPPTP 1186 Score = 50.8 bits (116), Expect = 1e-06 Identities = 21/37 (56%), Positives = 21/37 (56%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 D P PPP PPPPP PP PPPPP P PP P Sbjct: 1154 DQIPPPPPPPPPPPPSSPSPP----PPPPPPPPPPTP 1186 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/33 (57%), Positives = 19/33 (57%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PPPPPP PP P PP P P PP P P PP Sbjct: 1157 PPPPPP---PP--PPPPSSPSPPPPPPPPPPPP 1184 Score = 41.5 bits (93), Expect = 9e-04 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 673 PPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 PPP PP P PP P PPP PP PP P Sbjct: 1157 PPPPPPPP--PPPPSSPSPPPPPPPPPPPPTP 1186 Score = 41.5 bits (93), Expect = 9e-04 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPP 759 P PPP PP P PP PP PPP PP P Sbjct: 1159 PPPPPPPPPPSSPSPP---PPPPPPPPPPTP 1186 Score = 38.3 bits (85), Expect = 0.008 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 691 PPXXPXPPXXXPPXPPPXPPXPPXXPP 771 PP P PP P P P PP PP PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 601 VXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPP 714 V + D+ P P P P P PPP PP P P Sbjct: 1149 VFSVRDQIPPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 724 PPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 PP PPP PP PP P TP Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 56.0 bits (129), Expect = 4e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 + GG G G GG G GGGGG G GG GGGGGG GGG G E Sbjct: 130 DDGGGGGGGGGGGGGGGGGGGGGGGG---GGGGGGGGGGGDGDE 170 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG G G GG G GGGGG G GG GGGGGG G G+ Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDGD 175 Score = 46.4 bits (105), Expect = 3e-05 Identities = 20/35 (57%), Positives = 20/35 (57%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXG 666 GG GG GG GGG GG GG G GG GGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 46.4 bits (105), Expect = 3e-05 Identities = 20/35 (57%), Positives = 20/35 (57%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXG 666 GG GG GG GGG GG GG G GG GGG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 45.6 bits (103), Expect = 5e-05 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -3 Query: 767 GXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXG 657 G GG GG GGG GG GG G GG GGG G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 56.0 bits (129), Expect = 4e-08 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 + GG G G GG G GGGGG G G GG GGG GGG GG Sbjct: 61 DGGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGG 103 Score = 55.6 bits (128), Expect = 5e-08 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG G GGGGG G G G GGGG GGG GG Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGG 104 Score = 55.6 bits (128), Expect = 5e-08 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG G GGGGG GG GGGGGG G G GG Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGG 106 Score = 55.6 bits (128), Expect = 5e-08 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG G GGGG G GG GGGGGG GG GG Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 Score = 53.2 bits (122), Expect = 3e-07 Identities = 26/49 (53%), Positives = 27/49 (55%), Gaps = 6/49 (12%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXG------XXGGXXXGGGGGGXGGGXXGG 638 + GG G G GG G GGGGG G GG GGGGGG GGG GG Sbjct: 60 DDGGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGG 108 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG 641 GG G G G G GGGG G GG GGGGGG GGG G Sbjct: 75 GGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 52.8 bits (121), Expect = 4e-07 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG G G GG G GG GG GGG GGG GG Sbjct: 72 GGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 52.0 bits (119), Expect = 6e-07 Identities = 22/38 (57%), Positives = 23/38 (60%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G GG G GGGGG G GG GGGG GGG GG+ Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGD 101 Score = 52.0 bits (119), Expect = 6e-07 Identities = 23/46 (50%), Positives = 24/46 (52%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXGI 633 GG GG GG GGG GG G G GG GGG G G G G G+ Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGV 113 Score = 50.4 bits (115), Expect = 2e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG 641 GG G GG G GGGGG G GG GGGGGG G G Sbjct: 80 GGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 Score = 49.6 bits (113), Expect = 3e-06 Identities = 22/43 (51%), Positives = 23/43 (53%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 GG G G GG GGGG G GG GGGGG GGG G + Sbjct: 74 GGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRA 116 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 GG GG GG GGG GG G G G GGG G G G G G Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/31 (58%), Positives = 19/31 (61%) Frame = -1 Query: 727 GXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G GGGGG G GG GGGGGG G GG+ Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGD 92 Score = 36.3 bits (80), Expect = 0.033 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -3 Query: 842 GGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGG 690 GGGG G G G GG GG GGG G GG G GG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 36.3 bits (80), Expect = 0.033 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -3 Query: 842 GGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGG 690 GGGG G G GG G GG GGG GG GG G G Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXG 726 GG GGGG G G GG GG GG GGG G Sbjct: 69 GGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 55.6 bits (128), Expect = 5e-08 Identities = 33/87 (37%), Positives = 35/87 (40%) Frame = -1 Query: 874 GKWWXXGGXXWGGGXXXXEGXXXXXXXXXXXXXXXGEXGGAXGXGXGGXGXGGGGGXGXX 695 G + GG GGG G GG G G GG G GGGGG Sbjct: 146 GGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGG--Y 203 Query: 694 GGXXXGGGGGGXGGGXXGGESSCXIYQ 614 GG GGGGG GGG GG S Y+ Sbjct: 204 GGSGYGGGGGYGGGGYGGGRSGGGGYE 230 Score = 54.0 bits (124), Expect = 2e-07 Identities = 30/74 (40%), Positives = 30/74 (40%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG GGG G G GG GG G GGG GG GG G GG G Sbjct: 139 GGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGG 198 Query: 677 GGXGXXGXGXXGXG 636 GG G G G G G Sbjct: 199 GGGGYGGSGYGGGG 212 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG 641 GG G G GG G GGGGG GG GGG G GGG G Sbjct: 125 GGRRGGGYGG-GRGGGGGYRSGGGYRGGGGYRGGGGGYRG 163 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/42 (52%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGG-GGGGXGGGXXGG 638 GG G GG GGGG G GG G GGGG GGG GG Sbjct: 137 GGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGG 178 Score = 41.5 bits (93), Expect = 9e-04 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG G GG GG GGGGG G G GG Sbjct: 129 GGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGG 169 Score = 39.9 bits (89), Expect = 0.003 Identities = 28/70 (40%), Positives = 29/70 (41%), Gaps = 1/70 (1%) Frame = -3 Query: 842 GGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXG-GXGXXGGXXXGGGXG 666 GGGG+ G G GG GG G GGG G G G G GG GGG G Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSG-GGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGG-G 180 Query: 665 XXGXGXXGXG 636 G G G G Sbjct: 181 YGGGGHGGGG 190 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 G G GG G G GGG G G GGGG GGG Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGG 158 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGG---GGGXGGGXXGG 638 GG G GG G GGG GG GGG G G GGG GG Sbjct: 130 GGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGG 173 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -1 Query: 742 GXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G G GGG G GG GGG G GG GG Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGG 158 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 742 GXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G GG GG GG GG GGG GGG GG Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGG 157 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 53.6 bits (123), Expect = 2e-07 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G GG G GGGGG G GG G GGGG GGG GG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGG 121 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GG G G GG G GGGG G GG GGGGGG GGG GG S Sbjct: 88 GGGGGFGGGGGGGFGGGGGGGFGGG--GGGGGGFGGGGGGGFGS 129 Score = 53.2 bits (122), Expect = 3e-07 Identities = 26/41 (63%), Positives = 26/41 (63%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG G GGGGG G GG GGGGGG GGG GG Sbjct: 84 GGGFGGG-GGFGGGGGGGFGGGGGGGFGGGGGG-GGGFGGG 122 Score = 52.0 bits (119), Expect = 6e-07 Identities = 24/46 (52%), Positives = 24/46 (52%) Frame = -3 Query: 773 RGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 RGG GG GG GGG GG GG G G GGG G G G G G Sbjct: 83 RGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 46.0 bits (104), Expect = 4e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 GG GG GG GGG GG GG G GG GGG G G G G Sbjct: 81 GGRGGGFGG-GGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGG 124 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 51.6 bits (118), Expect = 8e-07 Identities = 30/78 (38%), Positives = 30/78 (38%), Gaps = 1/78 (1%) Frame = -1 Query: 856 GGXXWGGGXXXXEGXXXXXXXXXXXXXXXGEXGGAXGXGXGGXGX-GGGGGXGXXGGXXX 680 GG GGG G G GG G GG G GGGGG GG Sbjct: 286 GGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVT 345 Query: 679 GGGGGGXGGGXXGGESSC 626 GGGGG GGG G C Sbjct: 346 GGGGGATGGGGGPGSGGC 363 Score = 49.6 bits (113), Expect = 3e-06 Identities = 29/81 (35%), Positives = 30/81 (37%), Gaps = 2/81 (2%) Frame = -1 Query: 874 GKWWXXGGXXWGGGXXXXEGXXXXXXXXXXXXXXXGEXGGAXGXGXGGXGXGGGGGXGXX 695 G+ G GGG G GG G GG GGGGG Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGG 298 Query: 694 GGXXXGGGGG--GXGGGXXGG 638 GG GGGGG G GGG GG Sbjct: 299 GGGATGGGGGATGVGGGATGG 319 Score = 46.8 bits (106), Expect = 2e-05 Identities = 27/76 (35%), Positives = 29/76 (38%) Frame = -1 Query: 856 GGXXWGGGXXXXEGXXXXXXXXXXXXXXXGEXGGAXGXGXGGXGXGGGGGXGXXGGXXXG 677 GG GGG G G GG G GG G GGGG GG Sbjct: 293 GGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGAT 352 Query: 676 GGGGGXGGGXXGGESS 629 GGGGG G G G + + Sbjct: 353 GGGGGPGSGGCGEDGT 368 Score = 45.6 bits (103), Expect = 5e-05 Identities = 30/76 (39%), Positives = 30/76 (39%), Gaps = 3/76 (3%) Frame = -1 Query: 856 GGXXWGGGXXXXEGXXXXXXXXXXXXXXXGEXGGAXGX-GXGGXGXGGGGGXGXXGGXXX 680 GG GGG G G GG G G GG GGGGG GG Sbjct: 251 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGAT 310 Query: 679 GGGGG--GXGGGXXGG 638 G GGG G GGG GG Sbjct: 311 GVGGGATGGGGGATGG 326 Score = 41.9 bits (94), Expect = 7e-04 Identities = 25/75 (33%), Positives = 26/75 (34%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG GGGG G GG G GG GG GG G G G Sbjct: 257 GGGATGGGGGATGGGGGATGGGGGAT---GGGGGATGGGGGATGGGGGATGGGGGATGVG 313 Query: 677 GGXGXXGXGXXGXGI 633 GG G G G G+ Sbjct: 314 GGATGGGGGATGGGV 328 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/43 (53%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGG-GXXGGES 632 GA G G G G GGGG G GG GGGG G GG G G E+ Sbjct: 329 GATGGGGGATG-GGGGVTGGGGGATGGGGGPGSGGCGEDGTEN 370 Score = 39.9 bits (89), Expect = 0.003 Identities = 27/71 (38%), Positives = 28/71 (39%), Gaps = 3/71 (4%) Frame = -3 Query: 839 GGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGX-GGGXGGXXXGGXG--XXGGXXXGGGX 669 GG + G G GG GG GG GGG GG GG G GG GGG Sbjct: 228 GGSRLSNDRSNGRLGGGGATGGGGGATGGGGGATGGG-GGATGGGGGATGGGGGATGGGG 286 Query: 668 GXXGXGXXGXG 636 G G G G Sbjct: 287 GATGGGGGATG 297 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 51.2 bits (117), Expect = 1e-06 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 SP PP PPPPPP P P PPPPP PP P Sbjct: 189 SPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGG 783 P P PPP PP P PP PPP PP P L GG Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPP--PALNGG 229 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAP 798 P P PP P PP P PP PP PP P + G P Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPP-PPFGAPPPPALNGGP 230 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 6/39 (15%) Frame = +3 Query: 639 PPXXPPPXPP------PPPPXXXPPXXPXPPPPPXPXPP 737 PP PPP PP PPPP PP PPP PP Sbjct: 195 PPPPPPPPPPGFPGGAPPPPP--PPFGAPPPPALNGGPP 231 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +1 Query: 628 KXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 K P P P P PPP P P PP PP P PP PP Sbjct: 187 KPSPMAGMPPPPPP-PPPPGFPGGAPPPP--PPPFGAPPPPALNGGPP 231 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 694 PXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P PP PP PPP P P PP GAP P Sbjct: 190 PMAGMPP---PPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 50.8 bits (116), Expect = 1e-06 Identities = 26/64 (40%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Frame = -1 Query: 766 EXGGAXGX--GXGGXGXGGGGGXGXXGGXXXGGGGG-GXGGGXXGGESSCXIYQEXVXHF 596 + GG G G GG G GGGGG G GG GGGGG G GG G+ + + H Sbjct: 72 DGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDGDDDTSVTPRHLSHI 131 Query: 595 LXRV 584 + V Sbjct: 132 ILEV 135 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/41 (56%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGG-GXGXXGGXXXGGGGGGXGGGXXGG 638 G G G GG GGGG G G GG GGGGG GGG GG Sbjct: 70 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGG 110 Score = 41.9 bits (94), Expect = 7e-04 Identities = 27/74 (36%), Positives = 27/74 (36%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG GGGG G GG GG GGG G GG G GG G Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDD----GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDG 103 Query: 677 GGXGXXGXGXXGXG 636 GG G G G G Sbjct: 104 GGGGDGGGGNDDDG 117 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/47 (46%), Positives = 23/47 (48%), Gaps = 6/47 (12%) Frame = -1 Query: 757 GAXGXGXGGXGXG----GGGGXGXXGGXXXGG--GGGGXGGGXXGGE 635 G G G GG G G G G G GG GG GGGG G G GG+ Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGD 94 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G G GG GG GG GGGGG G G GG+ Sbjct: 65 GDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGD 102 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 50.8 bits (116), Expect = 1e-06 Identities = 26/64 (40%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Frame = -1 Query: 766 EXGGAXGX--GXGGXGXGGGGGXGXXGGXXXGGGGG-GXGGGXXGGESSCXIYQEXVXHF 596 + GG G G GG G GGGGG G GG GGGGG G GG G+ + + H Sbjct: 87 DGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDGDDDTSVTPRHLSHI 146 Query: 595 LXRV 584 + V Sbjct: 147 ILEV 150 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/41 (56%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGG-GXGXXGGXXXGGGGGGXGGGXXGG 638 G G G GG GGGG G G GG GGGGG GGG GG Sbjct: 85 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGG 125 Score = 41.9 bits (94), Expect = 7e-04 Identities = 27/74 (36%), Positives = 27/74 (36%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG GGGG G GG GG GGG G GG G GG G Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDD----GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDG 118 Query: 677 GGXGXXGXGXXGXG 636 GG G G G G Sbjct: 119 GGGGDGGGGNDDDG 132 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/47 (46%), Positives = 23/47 (48%), Gaps = 6/47 (12%) Frame = -1 Query: 757 GAXGXGXGGXGXG----GGGGXGXXGGXXXGG--GGGGXGGGXXGGE 635 G G G GG G G G G G GG GG GGGG G G GG+ Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGD 109 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G G GG GG GG GGGGG G G GG+ Sbjct: 80 GDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGD 117 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 50.8 bits (116), Expect = 1e-06 Identities = 24/66 (36%), Positives = 24/66 (36%) Frame = +1 Query: 586 PYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXX 765 P N P P P P P PPP P P PP PP PPP PP Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Query: 766 PPLXGG 783 PP G Sbjct: 408 PPPTNG 413 Score = 50.8 bits (116), Expect = 1e-06 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAP 798 P P P P PPP P P PP PP PPP PP PP G P Sbjct: 355 PSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPP 408 Score = 49.2 bits (112), Expect = 4e-06 Identities = 22/45 (48%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPP--XPXPPXPXPXAPP 761 + PP PPP PPPP P P PPPPP P PP P PP Sbjct: 372 NKPPPPPPPTNGPPPP-PPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 48.8 bits (111), Expect = 6e-06 Identities = 23/84 (27%), Positives = 32/84 (38%) Frame = +1 Query: 547 TAHILYSXHAVYVPYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXP 726 T + +++ A Y + + + + + P P P PPP P PP P Sbjct: 315 THYTVFARVASYTDWIKRMTVVGTSGGGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKP 374 Query: 727 PXPPPXPPXPPXXPPLXGGVXGAP 798 P PPP PP PP G P Sbjct: 375 PPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 47.6 bits (108), Expect = 1e-05 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXT 804 P P P P PPP PP P P PP PPP PP PP G P T Sbjct: 358 PPPTNNTP--PPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPT 411 Score = 47.2 bits (107), Expect = 2e-05 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXT 804 P PPP PP P P PP PPP PP PP G P T Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPT 391 Score = 34.3 bits (75), Expect = 0.13 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXP 704 P P P PPPPPP PP P Sbjct: 72 PSTPAPPPPPPPPSSGPPLPP 92 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 693 PXXPXPPPPPXPXPPXP 743 P P PPPPP PP P Sbjct: 75 PAPPPPPPPPSSGPPLP 91 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 693 PXXPXPPPPPXPXPPXPXPXAPP 761 P P PPPP P PP P PP Sbjct: 72 PSTPAPPPP--PPPPSSGPPLPP 92 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 709 PPXXXPPXPPPXPPXPPXXPPLXG 780 P PP PPP P P PP G Sbjct: 72 PSTPAPPPPPPPPSSGPPLPPSNG 95 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPP 722 P P PPPP PP PP PP Sbjct: 72 PSTPAPPPP--PPPPSSGPPLPP 92 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 50.4 bits (115), Expect = 2e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G GG G GGGGG G G G GG G GGG GG Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGG 67 Score = 48.0 bits (109), Expect = 1e-05 Identities = 30/80 (37%), Positives = 31/80 (38%), Gaps = 2/80 (2%) Frame = -3 Query: 875 GKVVVXGGXXLGGGGKXXRRXXXGVX--GAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXG 702 G V GG +GGGG GV G GG GG G GGG GG GG Sbjct: 29 GVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAA 88 Query: 701 XXGGXXXGGGXGXXGXGXXG 642 G GG G G G G Sbjct: 89 GAAGAGAGGNVGGGGSGGVG 108 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -3 Query: 770 GGXXGGXGGXGGGXG-GXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 GG GG GG GGG G G GG G GG G G G G G G G Sbjct: 36 GGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGG 81 Score = 46.0 bits (104), Expect = 4e-05 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G G G GGG G G G G GG GGG GG Sbjct: 66 GGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGG 106 Score = 45.6 bits (103), Expect = 5e-05 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G G G GG G GG G GGGG G G GG Sbjct: 40 GGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGG 80 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXG--GGGGGXGGGXXGGESS 629 GG G G GG G G GG G G G GGGG G G GG S Sbjct: 70 GGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGGSGS 115 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGG--GGXGXXGGXXXGGGGGGXGGGXXG 641 G G G GG G GGG GG G G GGGGG GG G Sbjct: 48 GAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAG 89 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/42 (52%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXG-GGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G G G G GGG G GG G GGGG GG GG Sbjct: 46 GGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGG-GGAGNGG 86 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GA G G GG GG GG GG GGGGGG G G G Sbjct: 54 GAGGCGCGGGNDGGNGG----GGAGNGGGGGGAGNGGAAG 89 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXG-GGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 GG G GG G G GGGG G G G G G GG GG S Sbjct: 61 GGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGS 104 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -1 Query: 760 GGAXGXGXG-GXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G G G G GG G G G GGG G GGG G Sbjct: 42 GGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAG 83 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG 641 G G G G G GGGG G GG G GG G G Sbjct: 56 GGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAG 94 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG 641 G G GG G GG G G GG GG G G G G Sbjct: 59 GCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGG 97 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 767 GXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 G GG G GGG GG G G G GG G G G G G Sbjct: 33 GVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNG 76 Score = 35.5 bits (78), Expect = 0.058 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -1 Query: 736 GGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSC 626 GG G G GGG G GG GG GGG G G G C Sbjct: 28 GGVGVGVGGG-GVGGG---GGNGGGAGNGVGAGGCGC 60 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 50.4 bits (115), Expect = 2e-06 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P PP PPPP PP PPPP P PP P APP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPP 161 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 PP PPP P PPP P P PP PP PP P Sbjct: 133 PPVTPPPGPETPPP----PDTPAPPVPPTEAPPTAPP 165 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPP-PXPPXPPXXPPLXGGVXGAP 798 P P PPP PP PP P PP P PP PP G P Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKP 174 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = +3 Query: 639 PPXXP----PPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P PP P PPP P P P PP P P P APP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVP-PTEAPPTAPP 165 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 +P P P P PP P P PP PP PP PP Sbjct: 130 LPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKPP 175 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 50.0 bits (114), Expect = 3e-06 Identities = 24/45 (53%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGG-GXGXXGGXXXGGGGGGXGGGXXGGESS 629 GG G G GG G GGGG G G GG GG GG GG GG S+ Sbjct: 1805 GGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGGYSA 1849 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G G GG G GGGGG GG GGG GG GGE Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGE 1796 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/74 (37%), Positives = 28/74 (37%), Gaps = 1/74 (1%) Frame = -1 Query: 856 GGXXWGGGXXXXEGXXXXXXXXXXXXXXXGEXG-GAXGXGXGGXGXGGGGGXGXXGGXXX 680 GG GGG G G G G G GG G GGGGG GG Sbjct: 1765 GGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGM 1824 Query: 679 GGGGGGXGGGXXGG 638 G GGG G G GG Sbjct: 1825 GAAGGGMGAGGEGG 1838 Score = 43.2 bits (97), Expect = 3e-04 Identities = 27/75 (36%), Positives = 27/75 (36%), Gaps = 2/75 (2%) Frame = -1 Query: 856 GGXXWGGGXXXXEGXXXXXXXXXXXXXXXGEXGGAXGXGXGGXGXGGGGGXGXXGGXXXG 677 GG GG G GG G G G G GGG G G G G Sbjct: 1769 GGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAG 1828 Query: 676 G--GGGGXGGGXXGG 638 G G GG GGG GG Sbjct: 1829 GGMGAGGEGGGAGGG 1843 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG G GGG G GG GGG GG GG Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGG 1800 Score = 41.9 bits (94), Expect = 7e-04 Identities = 28/78 (35%), Positives = 30/78 (38%), Gaps = 3/78 (3%) Frame = -3 Query: 875 GKVVVXGGXXLGGGGKXXRRXXXGVX---GAPXTPPXRGGXXGGXGGXGGGXGGXXXGGX 705 G + GG +GGGG G G GG GG GG GGG G G Sbjct: 1770 GGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAG- 1828 Query: 704 GXXGGXXXGGGXGXXGXG 651 G G GGG G G G Sbjct: 1829 GGMGAGGEGGGAGGGGGG 1846 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GG G G GG G G GG GG G GGGG G SS Sbjct: 1812 GGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGGYSAQKSSSS 1855 Score = 41.5 bits (93), Expect = 9e-04 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G GG G GGGG GG GGG G G G GG Sbjct: 1761 GGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGG 1801 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGG--GGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G GG G GGG GG G GG GGG GGG G Sbjct: 1757 GFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMG 1799 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = -3 Query: 767 GXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXGI 633 G GG GG GGG G GG GG GGG G G G G+ Sbjct: 1759 GGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGM 1803 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -3 Query: 758 GGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 GG GG GGG GG GG GG GGG G G G G Sbjct: 1756 GGFGGGGGG-GGMGGGGGMAGGGGGMGGGGMAAGGGEFGGG 1795 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 754 AXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 A G GG G G GG GGGG GGG GG Sbjct: 1744 ASGRQMSSSSSTGGFGGGGGGGGMGGGGGMAGGGGGMGG 1782 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 49.6 bits (113), Expect = 3e-06 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG G G GG G G GGG G GG GG GG GGG GGE Sbjct: 136 GGGEGNGAGG-GIGRGGGRGRGGGEGGWGGRGGNGGGRGGGE 176 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G GG G GG G G GG GG G G GGG GG Sbjct: 152 GRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGG 192 Score = 44.8 bits (101), Expect = 9e-05 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G GG G G GGG G GG GG GGG GGG GG Sbjct: 142 GAGGGIGRGG-GRGRGGGEGGWGG--RGGNGGGRGGGEGGG 179 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/67 (38%), Positives = 26/67 (38%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG G GG R G G RGG GG GG GG G G G GG G Sbjct: 137 GGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDG 196 Query: 677 GGXGXXG 657 G G G Sbjct: 197 RGRGRGG 203 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/41 (53%), Positives = 22/41 (53%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G G G GG GG G GG G GGGG G G GG Sbjct: 150 GGGRGRGGGEGGWGGRGGNG--GGRGGGEGGGGRGRGTGGG 188 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/41 (58%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGG-GGXGXXGGXXXGGGGGGXGGGXXG 641 GG G G GG G GGG GG G GG GG GGG GGG G Sbjct: 144 GGGIGRG-GGRGRGGGEGGWGGRGG-NGGGRGGGEGGGGRG 182 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 773 RGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 RGG GG GG GG GG GG GG G G G G G G G Sbjct: 155 RGGGEGGWGGRGGNGGG--RGGGEGGGGRGRGTGGGSRGGGGDGRG 198 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -3 Query: 773 RGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 RGG GG G GGG G GG G GG GGG G G G G G Sbjct: 126 RGGR-GGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWG-GRGGNG 169 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXG----XXGGXXXGGGGGGXGGGXXGGESSCXI 620 GG G G G G GGG G G GG GGGG G G G G E I Sbjct: 160 GGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRGRGGTEERTRI 210 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGG--GGGXGXXGGXXXGGGGGGXGG-GXXGG 638 + GG G G G G GGG G GG GGG GG GG G GG Sbjct: 125 QRGGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGG 170 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = -3 Query: 773 RGGXXGGXGGXGGGXGG--XXXGGXGXXGGXXXGGGXGXXGXGXXG 642 RGG G GG G G GG GG G GG GG G G G G Sbjct: 129 RGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGG 174 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -1 Query: 760 GGAXGXGXGGX-GXGGGGGXGXXGGXXXGGGGGGXGGGXXG 641 GG G GG G GGG G G GG GGG G GGG G Sbjct: 122 GGVQRGGRGGWRGRGGGEGNGAGGGIGRGGGRG-RGGGEGG 161 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 773 RGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 RGG G G G G GG G G G GG G G G G G Sbjct: 135 RGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGG 180 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 49.6 bits (113), Expect = 3e-06 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P PPPPPP PP P PPPPP P P PP Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 48.4 bits (110), Expect = 8e-06 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P PPPPPP P P PPPPP P P PP Sbjct: 296 PADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 47.6 bits (108), Expect = 1e-05 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P PPPPP P P PPPP PP P P PP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPP 324 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P P PP PP PPPPP P PP APP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPP 332 Score = 46.8 bits (106), Expect = 2e-05 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 P P PPPPP PP P PPPPP P P P Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPX-PPPXPPXPPXXPPLXGGVXGAPXTP 807 P PPP P PP PP PP PP PP PP GG P P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 43.6 bits (98), Expect = 2e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPP 722 P PPP PPPPPP P PPPPP Sbjct: 310 PGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 +P P P PPP P P PP PP PP PP PP Sbjct: 291 VPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/33 (54%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Frame = +3 Query: 639 PPXXPP---PXPPPPPPXXXPPXXPXPPPPPXP 728 PP PP P PPPPPP P PPPPP P Sbjct: 305 PPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P P P PP PP PPP PP PP G GAP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPP-------GDGGAPPPP 334 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P PP PP PP PPP PP PP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPP--PPPPPPPPPGDGGAPP 332 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 49.2 bits (112), Expect = 4e-06 Identities = 30/89 (33%), Positives = 33/89 (37%) Frame = -3 Query: 881 EXGKVVVXGGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXG 702 + G GG GGGG G GG GG GG GG GG GG G Sbjct: 92 DGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGG 151 Query: 701 XXGGXXXGGGXGXXGXGXXGXGIXLXYLS 615 GG GGG G G G ++S Sbjct: 152 ATGG---GGGATGGGGGATGGVTMTCFIS 177 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/42 (57%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGG-GXGGGXXGG 638 GGA G G G G GGGG G GG GGGG G GGG GG Sbjct: 59 GGATGGGGGATG-GGGGATGGHGGATGGGGGATGDGGGATGG 99 Score = 46.8 bits (106), Expect = 2e-05 Identities = 25/69 (36%), Positives = 25/69 (36%) Frame = -1 Query: 856 GGXXWGGGXXXXEGXXXXXXXXXXXXXXXGEXGGAXGXGXGGXGXGGGGGXGXXGGXXXG 677 GG GGG G GG G GG GGGGG GG G Sbjct: 53 GGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATG 112 Query: 676 GGGGGXGGG 650 G GG GGG Sbjct: 113 GHGGATGGG 121 Score = 44.8 bits (101), Expect = 9e-05 Identities = 27/74 (36%), Positives = 27/74 (36%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG GGGG G GA G GG G GGG G G G GG G Sbjct: 47 GGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGG 106 Query: 677 GGXGXXGXGXXGXG 636 GG G G G Sbjct: 107 GGGATGGHGGATGG 120 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/39 (53%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGG--GXGGGXXGG 638 G GG G GGG G GG GGGGG G GGG GG Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGG 78 Score = 42.7 bits (96), Expect = 4e-04 Identities = 28/81 (34%), Positives = 29/81 (35%), Gaps = 1/81 (1%) Frame = -3 Query: 875 GKVVVXGGXXLG-GGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGX 699 G VVV G +G GG G G GG G GG GG GG G Sbjct: 27 GVVVVLLGVVVGHGGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGG 86 Query: 698 XGGXXXGGGXGXXGXGXXGXG 636 G GGG G G G G Sbjct: 87 GGATGDGGGATGGGGGATGGG 107 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG G GG GGGG G GG G GG GGG G+ Sbjct: 51 GGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGD 92 Score = 39.9 bits (89), Expect = 0.003 Identities = 25/73 (34%), Positives = 25/73 (34%), Gaps = 1/73 (1%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGX-GGGXGGXXXGGXGXXGGXXX 681 GG GGGG G GG GG GG GGG G G GG Sbjct: 65 GGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGA 124 Query: 680 GGGXGXXGXGXXG 642 GG G G G Sbjct: 125 TGGHGGATGGHGG 137 Score = 37.1 bits (82), Expect = 0.019 Identities = 24/73 (32%), Positives = 24/73 (32%) Frame = -1 Query: 856 GGXXWGGGXXXXEGXXXXXXXXXXXXXXXGEXGGAXGXGXGGXGXGGGGGXGXXGGXXXG 677 GG GGG G G G G GG G GGG G GG Sbjct: 58 GGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGA 117 Query: 676 GGGGGXGGGXXGG 638 GGG G GG Sbjct: 118 TGGGVGATGGHGG 130 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 48.8 bits (111), Expect = 6e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G GG G G GGG G GG GG GGG GGG GG Sbjct: 192 GGGYGGSKGGYGGGSGGG-GYGGGRGGGGYGGGHGGGGYGG 231 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G GG GGGG G GG G GGGG GGG GG Sbjct: 179 GGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGG 218 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 G G G GG G GGG G G GG GGG GG G GG S Sbjct: 200 GGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGS 241 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/42 (52%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGG-GGGXGGGXXGG 638 GG+ G G G G GG G GG GGG GGG GGG GG Sbjct: 181 GGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGG 222 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/41 (51%), Positives = 22/41 (53%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG+ G G GG GGG G G GG GGG GGG GG Sbjct: 204 GGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGG 244 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/37 (54%), Positives = 21/37 (56%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 GG+ G GG G GG GG GG G GGGG GGG Sbjct: 196 GGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGG 232 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/38 (55%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGG-GGXGXXGGXXXGGGGGGXGGG 650 GG G G GG G GGG GG G GG GGG GGG Sbjct: 208 GGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGGG 245 Score = 43.6 bits (98), Expect = 2e-04 Identities = 29/71 (40%), Positives = 31/71 (43%), Gaps = 2/71 (2%) Frame = -3 Query: 842 GGGGKXXRRXXXGVXGAPXTPPXRGGXXGG--XGGXGGGXGGXXXGGXGXXGGXXXGGGX 669 GGGG G G + +GG GG GG GGG GG GG G GG GGG Sbjct: 179 GGGGSQGGGYRSGGGGYGGS---KGGYGGGSGGGGYGGGRGGGGYGG-GHGGGGYGGGGR 234 Query: 668 GXXGXGXXGXG 636 G G G G Sbjct: 235 HDYGGGSKGGG 245 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGG--GGGXGGGXXGG 638 GG G GG G GG G GG GGG GGG GGG GG Sbjct: 185 GGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGG 227 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 767 GXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 G GG G GGG G G GG G G G G G G G Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGG 219 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 48.4 bits (110), Expect = 8e-06 Identities = 19/43 (44%), Positives = 21/43 (48%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 ++PP PPP PPP P P PP P PP P P PP Sbjct: 951 NAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +3 Query: 627 QXDSPPXXPPPXPPPPPPXXXPP---XXPXPPPPPXPXPPXPXPXAPP 761 Q P PP PPPP PP P PPPP PP P P PP Sbjct: 944 QPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPP 991 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPL 774 P P P PPP P P PP P PP PP PP PP+ Sbjct: 954 PPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPP--PPPPPPPPPM 995 Score = 43.2 bits (97), Expect = 3e-04 Identities = 27/80 (33%), Positives = 27/80 (33%), Gaps = 6/80 (7%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPP---PPPXPXPP---XPXPXAPPXSXXXXXXXXXX 797 SPP P PPPPPP P P PP P P PP P P PP Sbjct: 913 SPPGGSVP-PPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAP 971 Query: 798 XXXXXXXSXXFXPPPQXXPP 857 PPP PP Sbjct: 972 PLPPPPGGSAPPPPPPPPPP 991 Score = 41.5 bits (93), Expect = 9e-04 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P P PPP PP PPP PP PP GG P P Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPP 977 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 4/47 (8%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPP----XPXPPXPXPXAPP 761 +SP PP PPPP P PPPPP PP P APP Sbjct: 908 ESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPP 954 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 6/49 (12%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXX--PPXPPP----XPPXPPXXPP 771 P P P PP PP PP PP PPP PP PP PP Sbjct: 942 PSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPP 990 Score = 37.5 bits (83), Expect = 0.014 Identities = 21/74 (28%), Positives = 23/74 (31%) Frame = +1 Query: 586 PYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXX 765 P +N P + P PP PP P P P PPP P Sbjct: 885 PAHKNDGSFPRRNESPSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQ 944 Query: 766 PPLXGGVXGAPXTP 807 PP GG P P Sbjct: 945 PPPPGGNAPPPPPP 958 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 586 PYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPP 738 P N P P P P P PP PP P PP PP PP Sbjct: 947 PPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPP---PPPPP 994 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 48.4 bits (110), Expect = 8e-06 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 P PP PPPPPP P PPPPP P P P P Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPP 694 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 9/46 (19%) Frame = +3 Query: 639 PPXXPPPXP-------PPPPPXXXPPXXPXPPPPP--XPXPPXPXP 749 PP PPP P PPPPP P PPPPP PP P P Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +1 Query: 673 PPPXXXPPXXPXPPXXXPPXPPPXP--PXPPXXPPLXGGVXGAP 798 PPP PP PP PPP P PP PP+ GG P Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPP 703 Score = 36.3 bits (80), Expect = 0.033 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXP 728 +PP PPP P P PP PPPP P Sbjct: 675 APPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 35.9 bits (79), Expect = 0.044 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPP----XPPXXPPLXGG 783 P P P P PP P PP PPP PP PP PP GG Sbjct: 660 PPPPPPPPPGGQAGGAPP-PPPPPLPGGAAPPPPPPIGGGAPPPPPPGFGG 709 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 7/39 (17%) Frame = +1 Query: 712 PXXXPPXPPPXPPX-------PPXXPPLXGGVXGAPXTP 807 P PP PPP PP PP PPL GG P P Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPP 694 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 48.4 bits (110), Expect = 8e-06 Identities = 23/43 (53%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGX-GXXGGXXXGGGGGGXGGGXXGGE 635 GG G GG G GGG G G GG GG GGG GGG GG+ Sbjct: 443 GGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGGD 485 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/42 (52%), Positives = 23/42 (54%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G G G G GGGGG G G GG GGG GGG GG+ Sbjct: 437 GVGDGRGGDGGGDGGGGGDG-GGDGIDGGDGGGDGGGDGGGD 477 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = -1 Query: 760 GGAXGXGXG---GXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG G G G G G G G GG GGGG G G G GG+ Sbjct: 421 GGGRDDGDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGD 465 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = -3 Query: 767 GXXGGXGGXGG--GXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 G G GG GG G GG GG G GG G G G G G G Sbjct: 437 GVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDG 482 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTPXXX 816 P P P PPP P P PP P PPP PP P PP P P Sbjct: 53 PPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPHF 112 Query: 817 L 819 L Sbjct: 113 L 113 Score = 47.6 bits (108), Expect = 1e-05 Identities = 25/52 (48%), Positives = 25/52 (48%), Gaps = 10/52 (19%) Frame = +3 Query: 636 SPPXXPPPXPPPP-------PPXXXPPXXPXPPPP-PXPXPP--XPXPXAPP 761 SPP P PPPP PP PP P PPPP P P PP P P PP Sbjct: 56 SPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 7/49 (14%) Frame = +3 Query: 636 SPPXXPPPXPP------PPPPXXXPPXXPXP-PPPPXPXPPXPXPXAPP 761 S P PPP PP PPPP P P P PP P PP P P PP Sbjct: 48 SSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPP 96 Score = 46.0 bits (104), Expect = 4e-05 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PP PPPPPP PP PP P P PP P P Sbjct: 77 PPAAPPAAPPPPPPLPAPPP---PPAQPAPQPPPAPPHFLP 114 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/31 (54%), Positives = 18/31 (58%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXP 728 +PP PPP PPP P PP P P PPP P Sbjct: 80 APPAAPPP-PPPLPAPPPPPAQPAPQPPPAP 109 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/42 (47%), Positives = 21/42 (50%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 +PP P PPP PP P PPPPP P P P APP Sbjct: 74 APPPPAAPPAAPPP----PPPLPAPPPPPAQPAPQP-PPAPP 110 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPL 774 P P P P P PP P PP PP P PP PPL Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPP--PPL 91 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P PP P PP P PP PP P Sbjct: 72 PAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/45 (51%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGG---XGGGXXG 641 + GG G GG G GGGGG G GG GGGGG GGG G Sbjct: 72 DDGGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -1 Query: 736 GGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSC 626 GG GGGG G GG G GGGG GGG GG C Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGG--GGGDDC 108 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G G G G GGGGG G GG GGG GG GE Sbjct: 76 GDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGE 117 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/45 (42%), Positives = 22/45 (48%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 + GG G G GG G GGGG G GG GGG G G ++ Sbjct: 79 DGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDN 123 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 GG GG GG GGG GG GG G GGG G G Sbjct: 81 GGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDG 125 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/66 (30%), Positives = 27/66 (40%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSCXIYQEXVXHFLXRVH 581 GG G G GG G GGGG GG G GG G G + + + + R+ Sbjct: 89 GGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDGDEGISCAFSQLSQYLQRYRSRLK 148 Query: 580 TQRVYY 563 + + Y Sbjct: 149 AKNLMY 154 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/62 (32%), Positives = 25/62 (40%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSCXIYQEXVXHFLXRVH 581 GG G G G G GGGGG G GG G GG G+ + +L R Sbjct: 85 GGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDGDEGISCAFSQLSQYLQRYR 144 Query: 580 TQ 575 ++ Sbjct: 145 SR 146 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXGIXLXYLS 615 GG G GG GGG GG G GG G G G G LS Sbjct: 89 GGGGGVGGGGGGGGGG---GDDCEDGGGDDGEDGGSDNDGDEGISCAFSQLS 137 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 PP PPPPPP P PPPPP P P PP S Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPS 731 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 11/52 (21%) Frame = +3 Query: 639 PPXXPPPXP-----PPPPPXXXP--PXXPXPPPPPXP----XPPXPXPXAPP 761 PP PPP P PPPPP P P PPPPP P PP P P P Sbjct: 712 PPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVP 763 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 7/47 (14%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXP-------PPPPXPXPPXPXPXAPP 761 P PPP PPPP PP P P PPPP P PP PP Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPP 756 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/48 (41%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = +3 Query: 621 IXQXDSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXP-----XPPXPXP 749 + + S PPP PPPPP P PPPPP P PP P P Sbjct: 685 VIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSP 732 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/57 (43%), Positives = 25/57 (43%), Gaps = 15/57 (26%) Frame = +3 Query: 636 SPPXXPPPXPP---------PPPPXXXPPXXP-XPPPPPXPXP-----PXPXPXAPP 761 S P PPP PP PPPP PP PPPPP P P P P P PP Sbjct: 692 SVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 38.3 bits (85), Expect = 0.008 Identities = 24/73 (32%), Positives = 26/73 (35%), Gaps = 13/73 (17%) Frame = +1 Query: 628 KXIPXPXXPXPXX-------PXPPPXXXPPXX------PXPPXXXPPXPPPXPPXPPXXP 768 K +P P P P P PPP PP P PP PP PP PP Sbjct: 674 KKVPPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQ 733 Query: 769 PLXGGVXGAPXTP 807 P G+ P P Sbjct: 734 PGCAGLPPPPPPP 746 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 3/49 (6%) Frame = +1 Query: 637 PXPXXPXPXX---PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPL 774 P P P P P PPP P PP PP PP PP PP+ Sbjct: 713 PPPPPPPPGCAGLPPPPPSPQPGCAGLPPPP-PPPPPGCAGLPPPPPPI 760 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPL 774 P P P P PP P PP PPP PP PL Sbjct: 727 PPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKPL 767 Score = 35.5 bits (78), Expect = 0.058 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 3/60 (5%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPP---XXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P PPP PP P PP P PP PP PP G G P P Sbjct: 701 PPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP---GCAGLPPPP 757 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = +3 Query: 639 PPXXPPPX----PPPPPPXXXPPXXPXPPPPPXPXPPXP 743 PP P P PPPPPP PPPPP P P Sbjct: 728 PPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKP 766 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G GG G G GGG G GG GG GGG GGG GG Sbjct: 101 GGYGGSSRGGYGGGRGGG-GYGGGRGGGGYGGGRGGGYGGG 140 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G GG GG GG GG G GGGG GGG GG Sbjct: 100 GGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGG 136 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/41 (53%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGG-GXGXXGGXXXGGGGGGXGGGXXGG 638 GA G GG GGGG G GG G GGGG GGG GG Sbjct: 87 GAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGG 127 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -1 Query: 754 AXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 A G GG G GG G GG GG GGG GGG GG Sbjct: 93 AGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGG 131 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGG 653 GG G G GG G GGG G G GG GGG GG Sbjct: 117 GGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGSKGGG 152 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXG-GGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G GG G G GGGG G G GGG GGG GG Sbjct: 110 GYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGSKGG 151 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGG----GGGGXGGG 650 GG G G G G GGGG G GG GG GGG GGG Sbjct: 112 GGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGSKGGG 152 Score = 40.3 bits (90), Expect = 0.002 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG GGGG G G GG GG GG GGG GG GG GG G Sbjct: 94 GGYRSGGGGYGGSSR--GGYGGGRGGGGYGGGRGG-GGYGGGRGGGYGGGRRDYGGGSKG 150 Query: 677 GG 672 GG Sbjct: 151 GG 152 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = -3 Query: 773 RGGXXGGXGGXG--GGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 RGG GG GG G GG GG GG G G GGG G G G G Sbjct: 108 RGGYGGGRGGGGYGGGRGG---GGYGGGRGGGYGGGRRDYGGGSKGGG 152 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 742 GXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G GG GG G GG GGG GG Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGG 118 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/49 (46%), Positives = 25/49 (51%), Gaps = 5/49 (10%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXG-----GGGGGXGGGXXGGE 635 + GG G G GG G GGGGG G G GGGGG GGG G+ Sbjct: 40 DGGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGD 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 GG GG GG GGG G G G GGG G G G G Sbjct: 45 GGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDG 89 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = -1 Query: 718 GGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GGGG G GG GGGGGG G G G+++ Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDAN 70 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 46.8 bits (106), Expect = 2e-05 Identities = 25/77 (32%), Positives = 26/77 (33%), Gaps = 4/77 (5%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXP----XPPXPXPXAPPXSXXXXXXXXXXXXX 806 PP P PPPPP P PPPPP PP P P AP + Sbjct: 129 PPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASP 188 Query: 807 XXXXSXXFXPPPQXXPP 857 PPP PP Sbjct: 189 PPPSGGPPPPPPPPPPP 205 Score = 45.6 bits (103), Expect = 5e-05 Identities = 23/57 (40%), Positives = 24/57 (42%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXT 804 +P P P PPP PP PP PP PPP P PP G V GA T Sbjct: 176 VPAPAVPLAAASPPPPSGGPP----PPPPPPPPPPPPPILELAAPPPPGSVLGAALT 228 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P PPPP PP P PPPPP P PP APP Sbjct: 179 PAVPLAAASPPPPSGGPPPPPPPPPPP-PPPPILELAAPP 217 Score = 43.6 bits (98), Expect = 2e-04 Identities = 29/85 (34%), Positives = 30/85 (35%), Gaps = 8/85 (9%) Frame = +3 Query: 627 QXDSPPXXPPPXPP----PPPPXXXPPXXPXPPPPPXPXP----PXPXPXAPPXSXXXXX 782 Q SPP PPP P PPPP P PPPPP P P P P P + Sbjct: 122 QAPSPP--PPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAP 179 Query: 783 XXXXXXXXXXXXSXXFXPPPQXXPP 857 S PPP PP Sbjct: 180 AVPLAAASPPPPSGGPPPPPPPPPP 204 Score = 41.5 bits (93), Expect = 9e-04 Identities = 24/70 (34%), Positives = 26/70 (37%), Gaps = 4/70 (5%) Frame = +1 Query: 610 IPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXP-PXPPPXPP---XPPXXPPLX 777 +P P P P PPP PP P P P P PPP P PP PP+ Sbjct: 89 VPAGVEAPTPTPMVAQSVAPTPPP---PPRAPETPSQAPSPPPPPTSPATRAPPPPPPIA 145 Query: 778 GGVXGAPXTP 807 G P P Sbjct: 146 PATGGPPPPP 155 Score = 41.5 bits (93), Expect = 9e-04 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXP----XPPXPXPXAP 758 P P P PPPP P PPPPP PP P P AP Sbjct: 117 PETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAP 159 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPP 722 P PPP PPPPPP PP PPP Sbjct: 191 PSGGPPPPPPPPPPPPPPPILELAAPPP 218 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPPXPX----PPXPXPXAP 758 P PPPP P P PPPPP PP P P AP Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAP 146 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 3/60 (5%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPX---PPXXPPLXGGVXGAPXTP 807 P P P P P PP P PP PPP P PP PP+ G P P Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTS-PATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPP 168 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +3 Query: 639 PPXXP--PPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P P P PPP P PPPPP P P PP Sbjct: 113 PPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPP 155 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPPXXXP-PXXPXPPXXXPPXPPPXPPXPPXXP 768 P + P P P P PPP P P PP P PP PP P Sbjct: 120 PSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAP 172 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +3 Query: 639 PPXXPPPXPPPPP----PXXXPPXXPXPPPPPXPXPPXPXP 749 PP P P P PP PPPPP P PP P P Sbjct: 168 PPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPP 208 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXG 792 P P PPP PP P P PPP + GV G Sbjct: 190 PPSGGPPPPPPPPPPPPPPPILELAAPPPPGSVLGAALTGIKSGVVG 236 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P P PP P PP P PP PP P G P P Sbjct: 120 PSQAPSPPPPPTSPATRAPP--PPPPIAPATGGP--PPPPPIAPATGGPPPPPPIAP 172 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 46.0 bits (104), Expect = 4e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 736 GGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GG G GGGGG G GG GGGGGG GGG GG SS Sbjct: 337 GGSGRGGGGGGG--GGGGGGGGGGGRGGG--GGFSS 368 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGG 665 G G GG G GGGGG G GG GGGGG Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 G G G GG G GGGGG G GG GGG G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -3 Query: 758 GGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXG 651 GG G GGG GG GG G GG GGG G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 E GG G G GGG G GG G GGGG GGG GG S Sbjct: 90 ERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGS 134 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/43 (48%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = -1 Query: 760 GGAXGXGX--GGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG+ G G GG G GG G GG GG GGG GGG G Sbjct: 94 GGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYG 136 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 + GG G G G GG GG G GG GGG GG G GG S Sbjct: 310 QRGGGRGGGYRSGGGGGYGG-GRGGGRGYGGGRGGGGRRDYGGGS 353 Score = 39.1 bits (87), Expect = 0.005 Identities = 25/72 (34%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES-SCXIYQEXVXHFLXRV 584 GG G G GGG G G GG GGG G G GG S S ++ + + + Sbjct: 104 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGRRDYGGASISTKLFWKIISACIYYA 163 Query: 583 HTQRVYYTICEQ 548 RVY IC++ Sbjct: 164 VFTRVY--ICDR 173 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G GG G G GGG G GG GGG GGG G Sbjct: 317 GGYRSGGGGGYGGGRGGGRG-YGGGRGGGGRRDYGGGSRSG 356 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G GG G GG G G GGG G GG GG Sbjct: 98 GGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGG 138 Score = 36.3 bits (80), Expect = 0.033 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Frame = -1 Query: 736 GGXGXGGGG---GXGXXGGXXXGG-GGGGXGGGXXGGESSCXIY 617 GG G GGG G G GG GG GGG GGG GG Y Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSY 135 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 742 GXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G GGG GG G GG GGG GG Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGG 123 Score = 34.7 bits (76), Expect = 0.10 Identities = 24/72 (33%), Positives = 25/72 (34%), Gaps = 1/72 (1%) Frame = -3 Query: 773 RGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGG-XGXXGXGXXGXGIXLXYLSGMXXTF 597 RGG GG G GG G GG GGG G G G G Y T Sbjct: 91 RGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGRRDYGGASISTK 150 Query: 596 LX*GTYTACXLY 561 L +AC Y Sbjct: 151 LFWKIISACIYY 162 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -3 Query: 773 RGGXXGGXGGXGGGXG-GXXXGGXGXXGGXXXGGGXGXXGXG 651 RGG GG GGG G G GG GG GGG G G Sbjct: 311 RGGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGGG 352 Score = 29.5 bits (63), Expect = 3.8 Identities = 20/49 (40%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = -3 Query: 842 GGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXG--GGXGGXXXGGXG 702 GGGG G G + RGG GG GG G GG GG G G Sbjct: 92 GGGGSQGGGYRSGGGGYGGSS--RGGYGGGRGGGGYGGGRGGGGSYGGG 138 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 6/46 (13%) Frame = +3 Query: 639 PPXXPP---PXPPPPPPXXXPP---XXPXPPPPPXPXPPXPXPXAP 758 PP PP P PPPPP PP P PPPPP P P P P Sbjct: 365 PPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIP 410 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PPPP PP PPP P PP P PP Sbjct: 338 PPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPP 378 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 11/53 (20%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPP-----------XPXPPXPXPXAPP 761 +PP PPPPPP P P PPPPP P PP P APP Sbjct: 354 APPPVGGAAPPPPPP--PPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPP 404 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPX--PPXPXPXAPP 761 +PP P PPPP P PPPP PP P APP Sbjct: 304 APPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPP 347 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 +PP PPP PP P PP P PP P PP S Sbjct: 345 APPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSS 388 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 3/51 (5%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPP---XPPXXPPLXG 780 P P P P PPP PP PP PPP PP PP P + G Sbjct: 363 PPPPPPPPVGGPPPPP--PPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIPG 411 Score = 36.3 bits (80), Expect = 0.033 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 1/58 (1%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPP-XXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P PPP P P PP PP PP PP PP G P P Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPP--PPGRGAPPPGPMIP 410 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXG 780 P P P PP P PP PPP PP PP+ G Sbjct: 338 PPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEG 383 Score = 35.5 bits (78), Expect = 0.058 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 5/73 (6%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPP-----PPPXPXPPXPXPXAPPXSXXXXXXXXXXXX 803 PP P PPPP P P PP PPP P P PP S Sbjct: 287 PPPPPSRGAAPPPPSRGAP--PPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRG 344 Query: 804 XXXXXSXXFXPPP 842 S PPP Sbjct: 345 APPPPSMGMAPPP 357 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 673 PPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 PPP P PP P PPP P PP G P P Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPP 331 Score = 34.7 bits (76), Expect = 0.10 Identities = 23/75 (30%), Positives = 24/75 (32%), Gaps = 10/75 (13%) Frame = +1 Query: 586 PYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPP-----PXP- 747 P R P P P P PPP P PP P PP P P Sbjct: 299 PPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPV 358 Query: 748 ----PXPPXXPPLXG 780 P PP PP+ G Sbjct: 359 GGAAPPPPPPPPVGG 373 Score = 34.3 bits (75), Expect = 0.13 Identities = 22/72 (30%), Positives = 23/72 (31%), Gaps = 7/72 (9%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPP----XXXPPXXPXPPXXXPPXPPPXPPXPP---XXPP 771 P + P P P PPP PP P PP P P PP PP Sbjct: 297 PPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPP 356 Query: 772 LXGGVXGAPXTP 807 GG P P Sbjct: 357 PVGGAAPPPPPP 368 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PPPP PP PPP P P PP Sbjct: 330 PPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPP 370 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P PP P PP PPP PP PP G P P Sbjct: 347 PPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 I P P PPP P P PP PP P PP Sbjct: 285 IQPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPP 330 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 45.2 bits (102), Expect = 7e-05 Identities = 19/34 (55%), Positives = 20/34 (58%) Frame = -1 Query: 736 GGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG G GGGGG G GG GGGGGG G G + Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDGDD 86 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/45 (40%), Positives = 21/45 (46%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 + GG G G GG G GGGGG G GG G GG++ Sbjct: 52 DGGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDGDDDDDDDDGGDA 96 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 E GG G G GGG G GG G GGGG GGG GG Sbjct: 181 ERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGG 223 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/41 (48%), Positives = 21/41 (51%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG+ G GG GGG G G GG GGG GGG GG Sbjct: 200 GGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGG 240 Score = 41.5 bits (93), Expect = 9e-04 Identities = 20/37 (54%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -1 Query: 757 GAXGXGXGGXGXGGG-GGXGXXGGXXXGGGGGGXGGG 650 G G G GG G GGG GG G GG GGG GGG Sbjct: 205 GGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGGG 241 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G GG G GG G G GGG G GGG GG Sbjct: 189 GGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGG 229 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 GG G G GGG G G GG GGGG G G GG S Sbjct: 195 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGS 237 Score = 39.1 bits (87), Expect = 0.005 Identities = 27/64 (42%), Positives = 28/64 (43%) Frame = -3 Query: 842 GGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGX 663 GGGG G G + RGG GG G GGG GG GG G GG GG G Sbjct: 183 GGGGSQGGGYRSGGGGYGGSS--RGGYGGGRG--GGGYGGGRGGGGGYGGGRRDYGG-GS 237 Query: 662 XGXG 651 G G Sbjct: 238 KGGG 241 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GG G GG G G GGG G GG GGGGG GG G S Sbjct: 197 GGYGGSSRGGYGGGRGGG-GYGGGR--GGGGGYGGGRRDYGGGS 237 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 773 RGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 RGG GG G GG G GG GGG G G G G Sbjct: 182 RGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYG 227 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 45.2 bits (102), Expect = 7e-05 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 D PP PP PP PP PP P PP P P PP P Sbjct: 94 DPPPPATPP-PPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P PPP PP PPPP P PP P APP Sbjct: 95 PPPPATPPPPTMPPT---PPPPQTPAPPGPDTPAPP 127 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +1 Query: 673 PPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXT 804 PPP PP PP PP P P PP GG P T Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAPGGCGAKPHT 138 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXP-PPXPPXP 756 P PPP PP P P PP P P PP P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 31.5 bits (68), Expect = 0.94 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP---LXGGVXGAP 798 P P P P P PP PP P PP P P P P P + GG P Sbjct: 96 PPPATPPP--PTMPPTPPPPQTPAPPG--PDTPAPPAPGGCGAKPHTRIVGGTKAPP 148 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 703 PXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P PP PP P P PP P G AP P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 44.8 bits (101), Expect = 9e-05 Identities = 21/45 (46%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = +3 Query: 636 SPPXXPPPXPPP---PPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 +P PPP PP PPP PP PPPP P PP P PP Sbjct: 549 TPSEEPPPPPPGVDIPPPL--PPSEDPKPPPPPPEPPEECPPPPP 591 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPP 722 D PP PP P PPP P PPPPP Sbjct: 562 DIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P PPP P P PP P PPP P P PP Sbjct: 550 PSEEPPPPPPGVDIPP-PLPPSEDPKPPPPPPEPPEECPP 588 Score = 35.9 bits (79), Expect = 0.044 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 +P P P P PP PP P P PP PP P Sbjct: 539 VPIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPP 583 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPP 759 P P P PPP PP P PP PP P PP Sbjct: 554 PPPPPPGVDIPPPL--PPSEDPKPPPPPPEPPEECPPPP 590 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P PP P PP PP P PP PP Sbjct: 546 PAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPP 580 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P PP PPP PP PP Sbjct: 542 PAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPP 576 Score = 28.7 bits (61), Expect = 6.6 Identities = 20/64 (31%), Positives = 21/64 (32%) Frame = +1 Query: 547 TAHILYSXHAVYVPYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXP 726 TAH AV + P IP P P PPP P PP P Sbjct: 534 TAHYQVPIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPP------PPEPPEECP 587 Query: 727 PXPP 738 P PP Sbjct: 588 PPPP 591 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 6/44 (13%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXX---XPPXPP---PXPPXPPXXPP 771 P P P PP PP PP P PP PP PP Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPP 583 >SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 GG G G G GG GG G GG GGG GG GGG Sbjct: 338 GGGRGGRGGRPGRGGRGGRGASGGRGRGGGRGGFGGG 374 Score = 35.1 bits (77), Expect = 0.076 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = -3 Query: 773 RGGXXGGXGGX---GGGXGGXXXGGXGXXGGXXX-GGGXGXXGXG 651 RGG GG GG GG G GG G GG GGG G G G Sbjct: 337 RGGGRGGRGGRPGRGGRGGRGASGGRGRGGGRGGFGGGAGPQGEG 381 Score = 31.5 bits (68), Expect = 0.94 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = -3 Query: 839 GGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXG-GXXXGG 675 GG R G +GG GG G GG G GG G G G GG Sbjct: 113 GGFNRSREDGGQEGGDSPVKVEQGGDRGGFGSRGGNRGARGTGGRGRGGFGANRGG 168 Score = 31.5 bits (68), Expect = 0.94 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -1 Query: 733 GXGXGGGGGXGXXGGXXXGGGGGGXG-GGXXGG 638 G G GG GG GG G GG G GG GG Sbjct: 338 GGGRGGRGGRPGRGGRGGRGASGGRGRGGGRGG 370 Score = 31.5 bits (68), Expect = 0.94 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXX-GGGGGGXGGG 650 GG G G G G G GG G GG GGG G G G Sbjct: 345 GGRPGRGGRG-GRGASGGRGRGGGRGGFGGGAGPQGEG 381 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 742 GXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG 641 G G G GG G G GG GG G GGG G Sbjct: 338 GGGRGGRGGRPGRGGRGGRG-ASGGRGRGGGRGG 370 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/42 (50%), Positives = 22/42 (52%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG G GG GG GG G GG GGGGG GG GG+ Sbjct: 176 GGGDDGGDGGDDGGGSGGGGDDGGSD-GGGGGNDGGRDDGGD 216 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/43 (44%), Positives = 21/43 (48%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 + GG+ G G G G GG G GG GG G GGG GG Sbjct: 168 DGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGGNDGG 210 Score = 41.5 bits (93), Expect = 9e-04 Identities = 22/45 (48%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGX-GXXGGXXXGG-GGGGXGGGXXGG 638 + GG G GG G GGG G GG GG GGGG GG GG Sbjct: 159 DDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGG 203 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/43 (44%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = -1 Query: 760 GGAXGXGXG-GXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G G G G G GGG G GGG G GGG GG+ Sbjct: 141 GDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGD 183 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G G GGG GG GG GG GGG GG Sbjct: 155 GGGSDDG-GDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGG 194 Score = 35.5 bits (78), Expect = 0.058 Identities = 19/47 (40%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGG--GGXGXXGGXXXGGGGGGXGGGXXGGES 632 + GG+ G G GGG G G G G GGG GGG G S Sbjct: 154 DGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGS 200 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -1 Query: 748 GXGXG-GXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G G G G G G G G G G G G GG GG+ Sbjct: 125 GDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGGGSDDGGD 163 Score = 30.7 bits (66), Expect = 1.6 Identities = 20/61 (32%), Positives = 22/61 (36%) Frame = -1 Query: 856 GGXXWGGGXXXXEGXXXXXXXXXXXXXXXGEXGGAXGXGXGGXGXGGGGGXGXXGGXXXG 677 GG GG +G G+ GG G G G GGGG G GG G Sbjct: 156 GGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGG-GNDGGRDDG 214 Query: 676 G 674 G Sbjct: 215 G 215 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = -3 Query: 767 GXXGGXGGXGG--GXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 G G GG G GG GG G G GGG G G G Sbjct: 161 GGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGG 206 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 PPP PPPPP P PPPPP P P P Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPPNPAPDVP 35 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 PP PPPPPP P PPPP P P P P S Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPP----PNPAPDVPAES 38 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 7/46 (15%) Frame = +3 Query: 651 PPPXPPPP-------PPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 PPP PPPP PP PP P P P P A P S Sbjct: 6 PPPPPPPPIAAEFTAPPAPPPPPNPAPDVPAESVNTQPNSQAAPTS 51 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 691 PPXXPXPPXXXPPXPPPXPPXPPXXPP 771 PP P PP PP PP PP P Sbjct: 6 PPPPPPPPIAAEFTAPPAPPPPPNPAP 32 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 P PPP PP PP PPP P P P Sbjct: 5 PPPPP---PPPPIAAEFTAPPAPPPPPNPAPDVP 35 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/33 (60%), Positives = 21/33 (63%) Frame = -1 Query: 733 GXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G GGGGG G GG GGGGGG GGG G+ Sbjct: 304 GDGDGGGGGDGGGGGGG-GGGGGGDGGGDGDGD 335 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/38 (50%), Positives = 20/38 (52%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G GG G GGGG G GG GGG G G G G+ Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGD 341 Score = 42.3 bits (95), Expect = 5e-04 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = -1 Query: 733 GXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG 641 G G G GGG G GG GGGGGG GG G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGGDG 332 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG G G GG G GGGGG G G G G G G G+ Sbjct: 308 GGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGD 349 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG G G GG G GGGG G G G G G G G G+ Sbjct: 310 GGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGD 351 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -1 Query: 721 GGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G G GG GGGGGG GGG GG Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGG 329 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/43 (46%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXG-GGGGGXGGGXXG 641 + GG G G GG G GGG G G G G G G G G G G Sbjct: 313 DGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDG 355 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 758 GGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 G G GGG G GG G GG GGG G G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDG 342 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = +3 Query: 621 IXQXDSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 I D P PPP PP PP PP P PP PP P P PP Sbjct: 171 IFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIP-PIDPP 216 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +3 Query: 621 IXQXDSPPXXPPPXPP-PPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 I D P PPP PP PP PP P PP P P P P P Sbjct: 184 IPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFPQPTTP 230 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +3 Query: 621 IXQXDSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 I D P PPP P PP PP P PP PP P P PP Sbjct: 158 ISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIP-PIDPP 203 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 5/51 (9%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXP--XPPXXXPPXPPPXPP---XPPXXPPL 774 P P P P PP PP P PP PP PP P PP PP+ Sbjct: 163 PPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPI 213 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 PP PP PPP P PP PP P P P P Sbjct: 198 PPIDPPRTQPPPIPPIDPPRTQPPPIFPQPTTPAP 232 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXP--XPPXXXPPXPPPXPPXPPXXPPL 774 P P P P PP PP P PP PP PP P PP+ Sbjct: 176 PPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPI 223 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PP PP P PP P P P P PP P P Sbjct: 181 PPPIPPIDPPRTQPPPIPPIDP-PRTQPPPIPPIDPPRTQP 220 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPP--PPXPXPPXPXPXAPP 761 +P PP P PP PP P PP P P PP P P Sbjct: 151 APMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQP 194 Score = 35.1 bits (77), Expect = 0.076 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 621 IXQXDSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXP 734 I D P PPP PP PP PP P P P P P Sbjct: 197 IPPIDPPRTQPPPIPPIDPPRTQPP--PIFPQPTTPAP 232 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 5/51 (9%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXX-PX-PPXXXPPXPPPXPP---XPPXXPPL 774 P P P P PP PP P PP PP PP P PP PP+ Sbjct: 150 PAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPI 200 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXP-PXPPPXPPXPPXXPP 771 P P P P PP PP P PP P PPP P P P Sbjct: 189 PPRTQPPPIPPIDPPRTQPP--PIPPIDPPRTQPPPIFPQPTTPAP 232 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P P PP P P PPP P P PP Sbjct: 156 PPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPP 196 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +1 Query: 628 KXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPP--PXPPXPPXXPP 771 K + P P P PP P PP P PP PP PP PP Sbjct: 142 KPVMTPTTPAP-MTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPP 190 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/76 (26%), Positives = 21/76 (27%), Gaps = 4/76 (5%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPP----PPPXPXPPXPXPXAPPXSXXXXXXXXXXXXXX 809 P P P PP PP PP PP PP P PP + Sbjct: 147 PTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQ 206 Query: 810 XXXSXXFXPPPQXXPP 857 PP PP Sbjct: 207 PPPIPPIDPPRTQPPP 222 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 IP P P PP P P P PP PP PP P Sbjct: 184 IPPIDPPRTQPPPIPPIDPPRTQPPP---IPPIDPPRTQPPPIFP 225 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPP---PPXPXPPXPXPXAPP 761 P P P P PP P PP PP P P PP Sbjct: 143 PVMTPTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPP 182 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -1 Query: 727 GXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G GGG G GG GGGGGG GGG G E Sbjct: 26 GGGHGGGHGYGGGPNGGGGGGGGGGGGGGDE 56 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/31 (58%), Positives = 19/31 (61%) Frame = -1 Query: 727 GXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G GG GG GG GGGGGG GGG GG+ Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGGGD 55 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -1 Query: 742 GXGGXGXGGGGGXGXXGGXXXGGGGGGXGG 653 G GG G G G G G GG GGGGGG GG Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGGG 54 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = -1 Query: 736 GGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 GG G GGG G G GGGGGG GGG +S Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDS 59 Score = 36.7 bits (81), Expect = 0.025 Identities = 20/42 (47%), Positives = 22/42 (52%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 G G G GG G GGG G GG GGGGGG G G++ Sbjct: 25 GGGGHG-GGHGYGGGPNGGGGGG---GGGGGGGGDEDDSGKN 62 Score = 36.3 bits (80), Expect = 0.033 Identities = 20/46 (43%), Positives = 21/46 (45%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 + GG G G G G GGG G GG GGGG G G E S Sbjct: 24 DGGGGHGGGHGYGGGPNGGGGG--GGGGGGGGGDEDDSGKNGKEYS 67 Score = 31.5 bits (68), Expect = 0.94 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG G GG G GGGGG G G GGE Sbjct: 36 GGGPNGGGGGGGGGGGGGGDEDDSGKNGKEYSGKNKWNNGGE 77 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGG 672 GG G GG GG GG GG G GG G Sbjct: 30 GGGHGYGGGPNGGGGG--GGGGGGGGGDEDDSG 60 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 D P PP PP PP P P PPP P PP P P Sbjct: 1017 DPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXPPP-XPPXPPXXPP 771 P P P PP P P PP PP PPP PP PP P Sbjct: 1016 PDPL-PTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDP 1055 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 P P P P PP P P PP PP PP P PP P Sbjct: 1018 PLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPP--PTDPPTQP 1059 Score = 37.5 bits (83), Expect = 0.014 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +3 Query: 657 PXP-PPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P P PP P P PPP P PP P PP Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPP 1051 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 736 GGXGXGGGGGXGXXGGXXXGGGGGGXGG 653 GG G GGG G GG GGG GG Sbjct: 802 GGMGMSGGGSMGAHGGGGMAGGGSSMGG 829 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPP-XPPXPPXXPP 771 +P P P P P P PP PPP PP PP P Sbjct: 1001 LPTSGPTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEP 1047 Score = 31.9 bits (69), Expect = 0.71 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG 641 GG+ G GG GGG G G GG GGG G Sbjct: 809 GGSMGAHGGGGMAGGGSSMGGAGSTVHGGLDMDGGGGVIG 848 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 GG G G G GGGG GG GG G GG Sbjct: 802 GGMGMSGGGSMGAHGGGGMA-GGGSSMGGAGSTVHGG 837 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPP-XPXPXAPP 761 D PP PPPP PP P PPPP PP P P PP Sbjct: 1244 DGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPP 1287 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/53 (41%), Positives = 23/53 (43%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 PD K + P P P PP PP P PP PP PP PP PP P Sbjct: 1243 PDGPPKFMGLPPPPPGMRPMPPQ---PPFMPPPPRMQPPG-PPGPPGPPGPQP 1291 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 PP P PP PP PP P PP P PP P P Sbjct: 1255 PPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPP--XPXPPXPXPXAPP 761 PP PP PP P PPPPP P PP P P PP Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQP-PFMPP 1271 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPP---PXPPXPPXXPP 771 P P PPP PP P PP PP P PP PP PP Sbjct: 1224 PPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPP 1271 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXP--PXPPPXPPXPPXXPPLXGGVXGAP 798 P P P P P PP P P PP PP P PP G G P Sbjct: 1237 PPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPP 1287 Score = 31.9 bits (69), Expect = 0.71 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +1 Query: 658 PXXPXPPPXXXPPXX--PXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P PP P P PP P PP P PP G G P P Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPP 1287 Score = 31.9 bits (69), Expect = 0.71 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXG 792 P P PPP P P PP PP PP P P PP G G Sbjct: 1243 PDGPPKFMGLPPPP--PGMRPMPPQ--PPFMPPPPRMQPPGPPGPPGPPG 1288 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 5/41 (12%) Frame = +1 Query: 667 PXPPPXXXPPXX-PXPPXXXPPXPPPX----PPXPPXXPPL 774 P PPP P PP PP PP PP PP P+ Sbjct: 1222 PRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPM 1262 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPP----XPXPPXPXPXAPPXS 767 P PP PP P PP P PP PP P PP P PP S Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGS 217 Score = 42.7 bits (96), Expect = 4e-04 Identities = 25/81 (30%), Positives = 28/81 (34%) Frame = +1 Query: 565 SXHAVYVPYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPX 744 S H P ++ P K I P P P P PP P P P P PP Sbjct: 217 SPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPN---PSIPPA 273 Query: 745 PPXPPXXPPLXGGVXGAPXTP 807 PP P P + AP P Sbjct: 274 PPNPSIPAPPNPSIPLAPPNP 294 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/68 (35%), Positives = 24/68 (35%), Gaps = 3/68 (4%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPP-XXXPPXXPXPPXXXPPXPPPXPPXP--PXXPPLXGG 783 P K P P P P PP PP P P PP P PP P P PP Sbjct: 176 PPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPN 235 Query: 784 VXGAPXTP 807 A TP Sbjct: 236 PSKAIATP 243 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP--XPXAPP 761 +P P P PP PP PP PP PP P P P P PP Sbjct: 181 APSTIPTPPTPPAPP--SPPIPTAPPTPPMPETPLPPGSPHIPP 222 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = +1 Query: 637 PXPXXPXPXXPXP--PPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P P P P PP P P PP P PP P PP P L + AP P Sbjct: 257 PNPFIP-PASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLF--IPSAPPNP 312 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/65 (33%), Positives = 23/65 (35%) Frame = +1 Query: 580 YVPYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPP 759 Y+P IP P P P P PP P P PP P PP P PP Sbjct: 295 YIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPP--NPSIPPAPPNPSIPPAPPNPSIPP 352 Query: 760 XXPPL 774 P L Sbjct: 353 APPNL 357 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P P PP P PP P PP PP P PL G P P Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMP--ETPLPPGSPHIPPAP 224 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXP-XPPXP-XPXAPP 761 PP P P PP PP P P PP P P PP P P APP Sbjct: 262 PPASPNPSIPPAPPN---PSIPAPPNPSIPLAPPNPYIPPAPP 301 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/43 (44%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPP-PPXPXPPXPXPXAPP 761 +PP P P PP PP P P P PP P P P APP Sbjct: 193 APPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPH-IPPAPP 234 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P P PP P P PP P P P P PP P P Sbjct: 192 PAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPP 246 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +3 Query: 639 PPXXPPP-XPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P P P PP PP P P PP P P P APP Sbjct: 315 PPAPPNPYIPTAPPNPSIPPAPPNPSIPPAP-PNPSIPPAPP 355 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 +PP P P P PP P P PP P P P PP Sbjct: 190 TPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPP 231 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP-XPXAPP 761 P P P PP PP P P P P P PP P P APP Sbjct: 306 PSAPPNPHIPPAPPNPYIPTAP-PNPSIPPAPPNPSIPPAPP 346 Score = 35.5 bits (78), Expect = 0.058 Identities = 20/73 (27%), Positives = 21/73 (28%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXSXXXXXXXXXXXXXXXX 815 SPP P PP P PP P PP P P P P + Sbjct: 196 SPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPA 255 Query: 816 XSXXFXPPPQXXP 854 F PP P Sbjct: 256 TPNPFIPPASPNP 268 Score = 35.5 bits (78), Expect = 0.058 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +3 Query: 636 SPPXXPP-PXPPPPPPXXXPPXXPXPPPPPXPXPPXP-XPXAPP 761 S P PP P PP PP P P P P P PP P P APP Sbjct: 286 SIPLAPPNPYIPPAPPNLFIPSAP-PNPHIPPAPPNPYIPTAPP 328 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 5/47 (10%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPP----XPXPPXP-XPXAPP 761 +PP P PP P PP PP PP PP P P APP Sbjct: 273 APPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPP 319 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +1 Query: 637 PXPXXPXPXXP-XPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 P P P P P P P P PP P PP P PP P Sbjct: 275 PNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPP 319 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 +PP P PP PP PP P P PP P P P A P Sbjct: 326 APPN--PSIPPAPPNPSIPPAPPNPSIPPAP-PNLFIPPATP 364 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTPXXXL 819 P P P P P P PP P PP P P P AP P L Sbjct: 231 PAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPL 289 Score = 32.3 bits (70), Expect = 0.54 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = +3 Query: 636 SPPXXPPPXPPPPP-PXXXPPXXPXPPPPPXPXPPXP---XPXAPP 761 SP PP PP P P P P PP P P P P APP Sbjct: 265 SPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPP 310 Score = 31.9 bits (69), Expect = 0.71 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +1 Query: 610 IPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPL 774 IP IP P P P PP P P P P P P P P P + Sbjct: 279 IPAPPNPSIPLAP-PNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSI 332 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +1 Query: 637 PXPXXPX--PXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 P P P P PP P P PP P PP PP P Sbjct: 319 PNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPPNLFIPPATP 364 Score = 28.3 bits (60), Expect = 8.7 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXP-----PPPPXPXPPXPXPXAPP 761 +PP P PP PP P P P PP P P P PP Sbjct: 290 APPN--PYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPP 334 >SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) Length = 370 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/43 (48%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -1 Query: 760 GGAXGXGXG-GXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G G G G G G G G G G G GGGG GGG GG+ Sbjct: 299 GDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGGGGDGGGDDGGD 341 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/43 (46%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -1 Query: 760 GGAXGXGXG-GXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G G G G G G G G G G G GGGG GGG G+ Sbjct: 230 GDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGGGGGGGGDGDGD 272 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/43 (46%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -1 Query: 760 GGAXGXGXG-GXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G G G G G G G G G G GGGGGG G G G+ Sbjct: 232 GDGDGDGDGDGDGDGDGDGDGDGDGDGDGGGGGGGGDGDGDGD 274 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/43 (46%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -1 Query: 760 GGAXGXGXG-GXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G G G G G G G G G G GGGGGG G G G+ Sbjct: 234 GDGDGDGDGDGDGDGDGDGDGDGDGDGGGGGGGGDGDGDGDGD 276 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 651 PPPXPPPPP-PXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P P P P P P PPPP P PP P P + P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 Score = 35.1 bits (77), Expect = 0.076 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPL 774 P P P P P P P PP PPP PP P P+ Sbjct: 358 PSTPAPTPAPLSSTPCAPFAP---PPPPPPPPPPAPGSTPV 395 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 673 PPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXG 780 PP P P P PP PP PP PP G Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPP-PPPPPPAPG 391 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 43.2 bits (97), Expect = 3e-04 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPP 759 P PPP P P PP PP PP PP PP Sbjct: 179 PAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGG 783 P P P PP PP P P P PP P PP PP+ GG Sbjct: 165 PAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPPVGGG 213 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = +3 Query: 654 PPXPPPPP--PXXXPPXXPXPPPPPXP-XPPXPXPXAPP 761 PP PP PP P P P PPPP P PP P PP Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPP 199 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/32 (50%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = +3 Query: 636 SPPXXPPPXPP---PPPPXXXPPXXPXPPPPP 722 +PP PPP P P PP PP P PPP P Sbjct: 177 APPAPPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPX--PPXXPP 771 P P P P P P PP P PP PP PP PP Sbjct: 162 PQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPP 203 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 673 PPPXXXPPXXPX-PPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 PP PP P P P PPP P P PP GG AP P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPF-GGPPSAPPPP 205 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 S P P PP P P P PP P P P APP Sbjct: 153 SGPSIASQPPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPP 194 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXG 780 P P PP P P PP PP PP PP PP PP G Sbjct: 219 PRPPTTQTPPTKAPTDPPVPPTN-PPVPPTNPPAPPTNPPKPG 260 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 +PP P PP PP PP P PP P PP P Sbjct: 226 TPPTKAPTDPPVPP--TNPPVPPTNPPAPPTNPPKP 259 Score = 35.1 bits (77), Expect = 0.076 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +1 Query: 628 KXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 K +P P PP PP PP PP PP P PP Sbjct: 206 KILPGNGVVPTQAPRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPP 253 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXP 756 P P P PP PP P P PP PP PP P Sbjct: 222 PTTQTPPTKAPTDPPV--PPTNPPVPPTNPPAPPTNPPKP 259 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P PP PP P PP P PP P P PP Sbjct: 219 PRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAP-PTNPP 257 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +1 Query: 691 PPXXPXPPXXXPPXP--PPXPPXPPXXPPLXGGVXGAPXT 804 P P PP P P PP PP PP+ AP T Sbjct: 215 PTQAPRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPT 254 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 +S P PPP PPPPP P P PP PP P APP Sbjct: 778 NSIPTTPPPEYPPPPPGLARP-NPPPPNPPLQVTSIPGEPAPP 819 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 P P P P PPP P PP PP P P P Sbjct: 781 PTTPPPEYPPPPPGLA---RPNPPPPNPPLQVTSIPGEPAPP 819 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +1 Query: 709 PPXXXPPXPP--PXPPXPPXXPPL-XGGVXGAPXTPXXXL 819 PP PP PP P PP PPL + G P P L Sbjct: 784 PPPEYPPPPPGLARPNPPPPNPPLQVTSIPGEPAPPFVKL 823 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PP P P PP P PPPPP PP P P P Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 41.5 bits (93), Expect = 9e-04 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXA 755 P P PPPP PP PPPP P PP P A Sbjct: 218 PDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKPAA 255 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +1 Query: 619 KXXKXIPX-PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPP 759 K K P P P P PPP P P P PP PPP P P Sbjct: 206 KQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPX-PPXPPXXPPL 774 P P P P P P P P PP PP PP PP PP+ Sbjct: 205 PKQQKATPVNP-PEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPV 250 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXP 726 PD P P P P P PP PP P PP P Sbjct: 218 PDYLEPTPPPPAAPAP--PPPPAAAPPPPPPPPPVKKP 253 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/49 (30%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +3 Query: 621 IXQXDSPPXXPPPXPPPPPPXXXPPXXPXPPPPP--XPXPPXPXPXAPP 761 + + P P P P P PPP P PP P APP Sbjct: 194 VHKKTKPSAAAPKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPP 242 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/50 (28%), Positives = 14/50 (28%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P P P P PPP P PP P P Sbjct: 200 PSAAAPKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPP 719 PP PPP PPPPPP PP P PP P Sbjct: 1307 PPESPPPPPPPPPP---PPPPPLPPTP 1330 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 PP PPPPPP P PPPPP P PP P Sbjct: 1307 PPESPPPPPP-------PPPPPPPPPLPPTP 1330 Score = 38.3 bits (85), Expect = 0.008 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +3 Query: 621 IXQXDSPPXXPPPXPPPPPPXXXP 692 I +SPP PPP PPPPPP P Sbjct: 1305 IQPPESPPPPPPPPPPPPPPPLPP 1328 Score = 37.1 bits (82), Expect = 0.019 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 690 PPXXPXPPPPPXPXPPXPXPXAP 758 P P PPPPP P PP P P P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 Score = 35.9 bits (79), Expect = 0.044 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 690 PPXXPXPPPPPXPXPPXPXPXAP 758 PP P PPPPP P PP P P P Sbjct: 1307 PPESP-PPPPPPPPPPPPPPLPP 1328 Score = 35.9 bits (79), Expect = 0.044 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 691 PPXXPXPPXXXPPXPPPXPPXPP 759 PP P PP PP PPP PP PP Sbjct: 1307 PPESPPPPPPPPP-PPPPPPLPP 1328 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +1 Query: 709 PPXXXPPXPPPXPPXPPXXPPL 774 PP PP PPP PP PP PPL Sbjct: 1307 PPESPPPPPPPPPPPPP--PPL 1326 Score = 34.3 bits (75), Expect = 0.13 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 709 PPXXXPPXPPPXPPXPPXXPP 771 P PP PPP PP PP PP Sbjct: 1308 PESPPPPPPPPPPPPPPPLPP 1328 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGG---GGGGXGGGXXGGES 632 G G G G G GGGG G GG GG GGGG GGG G S Sbjct: 752 GNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGS 797 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/45 (53%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGG--GXGXXGGXXXGGGGGGXGGGXXGGESS 629 G G GG G GGGG G G GG GGGG G GGG GG S Sbjct: 756 GGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYG-GGGHRGGSYS 799 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 4/59 (6%) Frame = -3 Query: 839 GGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGG----XGGGXGGXXXGGXGXXGGXXXGG 675 GGG RR G G RGG G GG GGG GG GG G GG GG Sbjct: 738 GGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGG 796 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGG--GGGGXGGGXXGG 638 G G GG GGGG G GG GG GGG GGG GG Sbjct: 749 GGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGG 790 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGG--GGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G GG G GGG GG G GG GG G G G Sbjct: 766 GGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSG 808 Score = 34.7 bits (76), Expect = 0.10 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 2/71 (2%) Frame = -3 Query: 842 GGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGX--GGXXXGGXGXXGGXXXGGGX 669 GG K +R G G R GG G GG GG GG G GG GGG Sbjct: 721 GGWQKDYQRGGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGG--GGYRGGGGY 778 Query: 668 GXXGXGXXGXG 636 G G G G Sbjct: 779 GGGHRGGGGYG 789 Score = 31.5 bits (68), Expect = 0.94 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G G G GGGG G GG G G G GG Sbjct: 770 GGYRGGGGYGGGHRGGGGYG-GGGHRGGSYSGYRGSYKSGG 809 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 7/47 (14%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXG-------GGGGGXGGGXXGG 638 G G G G G GG GG G GG G GG G GG G Sbjct: 774 GGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYGQG 820 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 10/47 (21%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXX----------GGXXXGGGGGGXGGG 650 GG G GG G GGGG G GG G GG G G G Sbjct: 776 GGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYGQGSG 822 Score = 29.1 bits (62), Expect = 5.0 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 5/51 (9%) Frame = -3 Query: 773 RGGXXGGXGGXGGG--XGGXXXGG--XGXXGGXXXGG-GXGXXGXGXXGXG 636 RGG G G GGG GG GG G G GG G G G G G Sbjct: 773 RGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYGQGSGG 823 >SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/42 (50%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGX-GXXGGXXXGGGGGGXGGGXXGGE 635 G G G GG G GGGGG G GG G GG GG GG+ Sbjct: 5 GGGGDGDGGDGDGGGGGDGGGDGGDCDGDGGDCDGGDDDGGD 46 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 733 GXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSC 626 G GGG G G G GG GGG GG G C Sbjct: 2 GYDGGGGDGDGGDGDGGGGGDGGGDGGDCDGDGGDC 37 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G G GG G GGG G G GG GG GG+ Sbjct: 10 GDGGDGDGGGGGDGGGDGGDCDGDGGDCDGGDDDGGDDGGD 50 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGG 653 GG G G GG G GG GG GG GG GG Sbjct: 19 GGGDGGGDGGDCDGDGG--DCDGGDDDGGDDGGDGG 52 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 3/57 (5%) Frame = +1 Query: 610 IPDKXXKXIPXPXXPXPXXPXP--PPXXXP-PXXPXPPXXXPPXPPPXPPXPPXXPP 771 IP IP P P P P P PP P P P P P PPP P P PP Sbjct: 49 IPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPP 105 Score = 41.9 bits (94), Expect = 7e-04 Identities = 25/68 (36%), Positives = 26/68 (38%), Gaps = 3/68 (4%) Frame = +1 Query: 610 IPDKXXKXIPXPXXPXPXXPXP--PPXXXP-PXXPXPPXXXPPXPPPXPPXPPXXPPLXG 780 IP P P P P P P PP P P P P P PPP P P PP Sbjct: 59 IPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPP-NT 117 Query: 781 GVXGAPXT 804 + G P T Sbjct: 118 PIQGDPLT 125 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 5/47 (10%) Frame = +3 Query: 633 DSPPXXPPPXPPPPP---PXXXPPXXPXP--PPPPXPXPPXPXPXAP 758 D PP P P PPP P PP P P PPP P P P P P Sbjct: 42 DRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTP 88 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 5/47 (10%) Frame = +3 Query: 633 DSPPXXPPPXPPPPP---PXXXPPXXPXP--PPPPXPXPPXPXPXAP 758 D PP P P PPP P PP P P PPP P P P P P Sbjct: 72 DPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTP 118 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = +1 Query: 610 IPDKXXKXIPXPXXPXPXXPXP--PPXXXP-PXXPXPPXXXPPXPPPXPPXPPXXPP 771 IP P P P P P P PP P P P P P PPP P P PP Sbjct: 39 IPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPP 95 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 5/47 (10%) Frame = +3 Query: 633 DSPPXXPPPXPPPPP---PXXXPPXXPXP--PPPPXPXPPXPXPXAP 758 D PP P P PPP P PP P P PPP P P P P P Sbjct: 52 DPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTP 98 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 5/47 (10%) Frame = +3 Query: 633 DSPPXXPPPXPPPPP---PXXXPPXXPXP--PPPPXPXPPXPXPXAP 758 D PP P PPP P PP P P PPP P P P P P Sbjct: 22 DPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTP 68 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +3 Query: 633 DSPPXXPPPXPPPPP---PXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 D PP P P PPP P PP P P PP P P P Sbjct: 82 DPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIQGDPLTIP 127 Score = 32.7 bits (71), Expect = 0.41 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPP--XPPXXPPLXGGV 786 P P P P PPP P P P P PPP P P PL G+ Sbjct: 83 PPPNTPIPG--NPPPNTPIPGDPPPNTPIPGDPPPNTPIQGDPLTIPLFQGI 132 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +1 Query: 634 IPXPXXPXPXXP-XPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 IP P P PPP P P P P PP P P PP Sbjct: 9 IPGDPPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPP 55 Score = 31.9 bits (69), Expect = 0.71 Identities = 23/72 (31%), Positives = 24/72 (33%), Gaps = 6/72 (8%) Frame = +1 Query: 610 IPDKXXKXIPXPXXPXPXXPXP---PPXXXPPXXPXPPXXXPPXPPPXPPXP---PXXPP 771 IP P P P P PP P P P P PPP P P P P Sbjct: 19 IPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTP 78 Query: 772 LXGGVXGAPXTP 807 + G P TP Sbjct: 79 IPG--DPPPNTP 88 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = +3 Query: 633 DSPPXXPPPXPPPPP---PXXXPP--XXPXPPPPPXPXPPXPXPXAP 758 D PP P PPP P PP P PP P P P P P Sbjct: 12 DPPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIP 58 Score = 28.3 bits (60), Expect = 8.7 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 636 SPPXXPPPXPPPPP---PXXXPP--XXPXPPPP----PXPXPP-XPXPXAPP 761 +PP P PPP P PP P PPP P PP P P PP Sbjct: 3 TPPNTAIPGDPPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPP 54 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGG---GGXGGGXXGGESS 629 GG G G GG GGG G G G G GG GG GGG GG SS Sbjct: 426 GGHKGAG-GGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGGASS 471 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GG+ G G G G G G G G GGG GG G S Sbjct: 433 GGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGGASSSGSKS 476 Score = 36.7 bits (81), Expect = 0.025 Identities = 20/50 (40%), Positives = 22/50 (44%), Gaps = 6/50 (12%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXG------GGGGGXGGGXXGGESS 629 GG+ GG G GGG GG G G GG GGG GG S+ Sbjct: 417 GGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGST 466 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 G G G GG GG GGG GGG G + Sbjct: 405 GGSSSGTGASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGST 446 Score = 31.9 bits (69), Expect = 0.71 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG G G G G GG GG G G G G G GG G Sbjct: 405 GGSSSGTGASSAGGSSAGASGGGHK--GAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAG 462 Query: 677 GG 672 GG Sbjct: 463 GG 464 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXG-GXXXGGGXGXXGXGXXGXG 636 G GG G GGG G G G G GG G G G G Sbjct: 422 GASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTG 467 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = -3 Query: 857 GGXXLG--GGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXG 693 GG G GGG G + G G G GGG GG GG G Sbjct: 417 GGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGGASSSG 473 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 G+ G G G GG GG G GG G GG G SS Sbjct: 442 GSGSTGNGNAGNGGAGG-GGAGG---GSTGGASSSGSKSSSSS 480 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = +3 Query: 636 SPPXX---PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 SPP PPP P PPP P P P PP P P P P PP Sbjct: 1034 SPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPP-PSEPAPPPRQPP 1077 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/72 (27%), Positives = 23/72 (31%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXSXXXXXXXXXXXXXXXXXS 821 P PP P PPP P P PPP P P PP + + Sbjct: 1040 PLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPA 1099 Query: 822 XXFXPPPQXXPP 857 PPP+ P Sbjct: 1100 HPTEPPPRQPKP 1111 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 5/51 (9%) Frame = +1 Query: 634 IPXPXXPXPXX---PXPPPXXX--PPXXPXPPXXXPPXPPPXPPXPPXXPP 771 +P P P P P PPP PP P PP PP P P PP P Sbjct: 1041 LPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQP 1091 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = +1 Query: 652 PXPXXPXPPPXXXP---PXXPXPPXXXPPXPPPXPPXPPXXPPL 774 P P P PPP P P P PP P PP PP P P+ Sbjct: 1042 PPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPV 1085 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 SPP P PPP P PP PPP P PP PP Sbjct: 1048 SPPPSAVPIPPPRKPS--PPPSEPAPPPRQPPPPSTSQPVPP 1087 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXP--PXXPP 771 P P P P PPP PP P P P P P P P PP Sbjct: 1059 PRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPP 1105 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P P PP P PP P PP PP Sbjct: 1035 PPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPP 1077 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXP-PXXP 768 P +P P P P P PP P PP P PPP P P P P Sbjct: 1047 PSPPPSAVPIPPPRKP-SPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNP 1098 Score = 35.1 bits (77), Expect = 0.076 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +3 Query: 639 PPXXPPPXP---PPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PPP P PPP P P P P P P P P Sbjct: 1072 PPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAP 1115 Score = 34.3 bits (75), Expect = 0.13 Identities = 22/75 (29%), Positives = 24/75 (32%) Frame = +1 Query: 574 AVYVPYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPX 753 AV +P R P + P P P PPP P P P PPP P Sbjct: 1053 AVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNP--AHPTEPPPRQPK 1110 Query: 754 PPXXPPLXGGVXGAP 798 P P V P Sbjct: 1111 PTPAPRPRSWVESQP 1125 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXX-PXPPPPPXPXPPXPXPXAPP 761 P P P PP PP P PPP PP P PP Sbjct: 1019 PPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPP 1059 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/53 (33%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPX-PPXPPXXP 768 P + +P P P P PP P PP P PPP P PP P Sbjct: 1020 PGPTEQPVPPKRKASPPSAQPLP---PPRKPSPPPSAVPIPPPRKPSPPPSEP 1069 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P PP P PP PP P PP P PP Sbjct: 1015 PHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPP 1051 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXP-XPPPPPXPXPPXPXPXAPP 761 P P PP PP PPP P PP P PP Sbjct: 1026 PVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPP 1066 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +3 Query: 633 DSPPXXPPPXPPPPP-PXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 D P PP P P P P P P P P P P A P Sbjct: 1012 DPVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVP 1055 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPP--XXXPPXXPXPPPPPXPXP 734 + PP P P P P P P PPPP P P Sbjct: 1103 EPPPRQPKPTPAPRPRSWVESQPELHRPPPPIKPKP 1138 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/42 (33%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXPPPX-PPXPPXXPPL 774 P P P PP P P PPP P PP P+ Sbjct: 1015 PHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPI 1056 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/49 (44%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGG---GGGXGGGXXGGESS 629 E GG G GG G GG GG GGG GGG GG GG +S Sbjct: 112 EAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTS 160 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGG--GGGGXGGGXXGG 638 E GG G GG GGG G G GG GGGG GG GG Sbjct: 108 EGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGG 152 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG G G GGGG G G GGG G GG GG+ Sbjct: 109 GGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQ 150 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 3/49 (6%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGG---GGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 E GG G G G G GGG GG GG GG GG G SS Sbjct: 116 EAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSS 164 Score = 36.7 bits (81), Expect = 0.025 Identities = 23/68 (33%), Positives = 24/68 (35%), Gaps = 2/68 (2%) Frame = -3 Query: 854 GXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGG--XGXXGGXXX 681 G GG + G G GG GG G GGG GG GG G G Sbjct: 109 GGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGAT 168 Query: 680 GGGXGXXG 657 GG G G Sbjct: 169 SGGGGVSG 176 Score = 35.9 bits (79), Expect = 0.044 Identities = 22/79 (27%), Positives = 23/79 (29%) Frame = -1 Query: 856 GGXXWGGGXXXXEGXXXXXXXXXXXXXXXGEXGGAXGXGXGGXGXGGGGGXGXXGGXXXG 677 GG GGG E + GG G G G G GG Sbjct: 104 GGTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSS 163 Query: 676 GGGGGXGGGXXGGESSCXI 620 GG GGG G S I Sbjct: 164 SGGATSGGGGVSGSSGTSI 182 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 GG GG GG GG G GG GG GGG G G G Sbjct: 118 GGQAGG-GGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSG 161 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGG---GGGXGGGXXGGES 632 G G GG GGGG G G GGG G G G GG S Sbjct: 157 GSTSGSSSGGATSGGGGVSGSSGTSIAGGGSSAGAGAGATSAGGSS 202 Score = 32.7 bits (71), Expect = 0.41 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -3 Query: 770 GGXXGGX-GGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXG 642 GG GG GG GG GG G G G GG G G G G Sbjct: 110 GGEAGGEAGGQAGG-GGQAGGQAGSQAGGGAAGGGGQEGGGQGG 152 Score = 32.3 bits (70), Expect = 0.54 Identities = 21/69 (30%), Positives = 23/69 (33%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG GGGG+ G + GG G GG G G GG G G Sbjct: 136 GGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSGSSGTSIAGG-----GSSAG 190 Query: 677 GGXGXXGXG 651 G G G Sbjct: 191 AGAGATSAG 199 Score = 31.5 bits (68), Expect = 0.94 Identities = 13/39 (33%), Positives = 15/39 (38%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 + GG+ G GGGG G GGG G G Sbjct: 154 QAGGSTSGSSSGGATSGGGGVSGSSGTSIAGGGSSAGAG 192 Score = 29.9 bits (64), Expect = 2.9 Identities = 25/75 (33%), Positives = 26/75 (34%), Gaps = 6/75 (8%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGG--XGG--XGGGXGGXXXGGXGXXG- 693 GG GGG + GA GG GG GG G GG GG G G Sbjct: 118 GGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSGS 177 Query: 692 -GXXXGGGXGXXGXG 651 G GG G G Sbjct: 178 SGTSIAGGGSSAGAG 192 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 11/55 (20%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGG-----------GGXGGGXXGGESS 629 GG G G GG GG GG GGGG GG G G +S Sbjct: 143 GGQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSGSSGTSIAGGGSSAGAGAGATS 197 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 41.9 bits (94), Expect = 7e-04 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P P PPP PP P PPPPP P PP + P Sbjct: 860 PRPRPRRPPP---PPPPPPPPPPPPPPPPASSTGSTP 893 Score = 41.5 bits (93), Expect = 9e-04 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXP 728 P P PPPPPP PP P PPPPP P Sbjct: 860 PRPRPRRPPPPPP---PPPPPPPPPPPPP 885 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 PP PPP PPPPPP PP P P P Sbjct: 867 PPPPPPPPPPPPPPPPPPPASSTGSTPGGDKVPSVGP 903 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 694 PXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P PP PP PPP PP PP G G P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPPASSTGSTPGGDKVP 899 Score = 36.3 bits (80), Expect = 0.033 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 703 PXPPXXXPPXPPPXPPXPPXXPP 771 P P PP PPP PP PP PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPP 882 Score = 31.5 bits (68), Expect = 0.94 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXP-XPPXPXPXAPPXS 767 SP P P P P P P P P P P P P P P + P S Sbjct: 468 SPISNPSPRPHPSP---HPSSNPSPNPSPNPSSDPSPNPSSNPSS 509 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +3 Query: 636 SPPXXPPPXP---PPPPPXXXPPXXPXPPPPPXP-XPPXPXPXAPPXS 767 SP P P P P P P P P P P P P P P + P S Sbjct: 474 SPRPHPSPHPSSNPSPNPSPNPSSDPSPNPSSNPSSDPSPNPSSNPSS 521 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 41.9 bits (94), Expect = 7e-04 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPP 737 D P PP PPPPPP P PPPPP PP Sbjct: 75 DGPAAVIPPPPPPPPP---ASNVPAPPPPPPVMPP 106 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = +3 Query: 675 PPXXXPPXXPXPPPPPX---PXPPXPXPXAPP 761 P PP P PPPPP P PP P P PP Sbjct: 77 PAAVIPP--PPPPPPPASNVPAPPPPPPVMPP 106 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPP 759 P P PPP P PP P PPP PP P Sbjct: 77 PAAVIPPPPP-------PPPPASNVPAPPPPPPVMP 105 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 666 PPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PPPPP P PP P P PP Sbjct: 584 PPPPPQMNNTSAPPPPNKEKQTAKPPAPLPPP 615 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 694 PXXPXPPXXXPPXPPPXPPXPPXXPPL 774 P PP PP P P PP PP+ Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPV 103 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/50 (44%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -1 Query: 757 GAXGXGX-GGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSCXIYQE 611 GA G G GG G G G G G GGG GG GGG GG + Y + Sbjct: 185 GAGGRGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQ 234 Score = 41.1 bits (92), Expect = 0.001 Identities = 25/60 (41%), Positives = 26/60 (43%) Frame = -3 Query: 845 LGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXG 666 LG GG+ R G GAP G GG GG GGG GG G GG GG G Sbjct: 184 LGAGGRGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGG----SYGGYGNYGGYSQGGYGG 239 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = -1 Query: 760 GGAXGXGXGGXGX-GGGGGXGXXGGXXXGGGG--GGXGGGXXGG 638 GG G G G GGGGG G GG GG G GG G GG Sbjct: 196 GGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYGG 239 Score = 31.5 bits (68), Expect = 0.94 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = -3 Query: 773 RGGXXGGXGGXGGGXG-GXXXGGXGXXGGXXXG--GGXGXXG 657 RGG G GG G G G GG G GG G GG G G Sbjct: 189 RGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYG 230 Score = 30.7 bits (66), Expect = 1.6 Identities = 23/58 (39%), Positives = 24/58 (41%), Gaps = 14/58 (24%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGG--GGXGXXGGXXXGGGGGGX------------GGGXXGGESS 629 GG G G G G GGG GG G GG GG GG GG GG+ S Sbjct: 206 GGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYGGYADNSWSGGYGSYDGGYGNGGDYS 263 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPP 722 PP P PPPPPP PP P PPPPP Sbjct: 96 PPACCAPPPPPPPP---PPPPPPPPPPP 120 Score = 41.5 bits (93), Expect = 9e-04 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 P P PP P P PPPPP P PP P P Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/67 (29%), Positives = 21/67 (31%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXSXXXXXXXXXXXXXXXXXSXXFXPPP 842 P P P PPPPP P PP P P PP + PP Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPA 147 Query: 843 QXXPPXH 863 PP H Sbjct: 148 PCMPPCH 154 Score = 40.7 bits (91), Expect = 0.002 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPP 722 P PP PPPP PP P PPPPP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPP 119 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +1 Query: 619 KXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPP 750 K K P P PP P P PP PP PPP PP Sbjct: 77 KGDKKCDVSCMPTSCAPACPPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 8/45 (17%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXP--------PPPPXPXPPXPXPXAPP 761 PPP PPPPP PP PP P PP P P PP Sbjct: 138 PPPPPPPPPAPCMPPCHQTQVVHSVQLHASPPGP-PPAPMPAPPP 181 Score = 35.5 bits (78), Expect = 0.058 Identities = 20/64 (31%), Positives = 22/64 (34%), Gaps = 10/64 (15%) Frame = +1 Query: 598 NVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXP----------PXXXPPXPPPXP 747 +V +P P P P PPP PP P P P PPP P Sbjct: 83 DVSCMPTSCAPACPPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPP 142 Query: 748 PXPP 759 P PP Sbjct: 143 PPPP 146 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPP----XXPXPPPPPXPXPPXPXPXAPP 761 SPP PP P PPP P P P P P P PP Sbjct: 167 SPPGPPPAPMPAPPPMVVPSHRHVFHHVTHPAPPPMQMAPAPCMPP 212 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPX--PPPPPXPXPPXPXP 749 DSP P P PP P P P PPPPP P PP P P Sbjct: 333 DSPSTTTPTTPQPPTPTT-PKTHPQLGPPPPPPPPPPTPPP 372 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 6/41 (14%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPX------PPPXPPXPPXXPP 771 P P P P PP P PPP PP PP PP Sbjct: 331 PSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPP 371 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P P PP PPP P PP PP Sbjct: 330 PPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPP--PPPPTPPP 372 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 ++PP P P P P P P P PP P P P Sbjct: 328 NAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTP 370 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 627 QXDSPPXXPPPXPPPPP 677 Q PP PPP P PPP Sbjct: 356 QLGPPPPPPPPPPTPPP 372 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 41.5 bits (93), Expect = 9e-04 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PPPPPP PP P PP P P P P P P Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGP-PGFPGPQGP 59 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P P PP PP P P P PP P PP P G G P P Sbjct: 32 PPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPP----GFQGPPGNP 84 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXX-PPXPPPXPPXP-PXXPPLXGGVXGAP 798 P PP PP P PP PP PP P P P PP G G P Sbjct: 273 PGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPP 318 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +3 Query: 639 PPXXP-PPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 PP P PP P PP PP P P PP P P P Sbjct: 791 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 828 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPX--PPPXPPXPPXXPPLXGGVXGAP 798 P PPP PP P PP P P P P P PP G G P Sbjct: 30 PPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPP 75 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXP-PPXPPXPPXXPPLXGGVXGAPXTP 807 P P P P PP P P P P P PP PP P G G P P Sbjct: 39 PPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIGPPGLP 94 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +3 Query: 639 PPXXP-PPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 PP P PP P PP PP P P PP P P P Sbjct: 706 PPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPP 743 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 691 PPXXPXPPXXXPPXPPPXPPXP--PXXPPLXGGVXGAP 798 PP P PP P PP PP P P PP G G P Sbjct: 876 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGCLGPP 913 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPPXP-XPPXP-XPXAPP 761 P P PP PP P PP PP P PP P P PP Sbjct: 621 PAGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 658 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 691 PPXXPXPPXXXPPXPPPXPPXP--PXXPPLXGGVXGAP 798 PP P PP P PP PP P P PP G G P Sbjct: 706 PPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPP 743 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 691 PPXXPXPPXXXPPXPPPXPPXP--PXXPPLXGGVXGAP 798 PP P PP P PP PP P P PP G G P Sbjct: 791 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 828 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPPXP-XPPXP 743 PP P PP PP P PP PP P PP P Sbjct: 876 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGP 906 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +3 Query: 633 DSPPXXPP-PXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 ++PP PP PPPPP P P P P P P P P Sbjct: 27 ETPPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLP 69 Score = 36.3 bits (80), Expect = 0.033 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PP PP PP P PP P P P P AP Sbjct: 272 PPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAP 303 Score = 35.5 bits (78), Expect = 0.058 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPPXPXPP 737 PP PP PP PP P P PP P P Sbjct: 111 PPGPPGPPGPQMPPGPPGLPGPPGPAGP 138 Score = 35.5 bits (78), Expect = 0.058 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXT 804 P P P PP PP PP P P PP PP P G G P T Sbjct: 179 PGPNGPLGPPG--PPGDMGPPGLPGPQGPQMPPGPPGLPGAP-GPKGPPGT 226 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGA 795 P P PP PP P PP P PP P P P G A Sbjct: 707 PGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPPGECGPAGNA 752 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGA 795 P P PP PP P PP P PP P P P G A Sbjct: 792 PGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPPGECGPAGNA 837 Score = 35.5 bits (78), Expect = 0.058 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +3 Query: 639 PPXXP-PPXPPPPPPXXXPPXXPXPPPPPXP 728 PP P PP P PP PP P P PP P Sbjct: 876 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGP 906 Score = 35.1 bits (77), Expect = 0.076 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPP--PPPXPXPPXP 743 ++PP P P P PP P P P PP P PP P Sbjct: 36 EAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGP 74 Score = 35.1 bits (77), Expect = 0.076 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 P P P PP PP PP P P PP P P P Sbjct: 625 PGPPGPASPPSPP--GPPGPPGPKGPPGPNGPLGPP 658 Score = 34.7 bits (76), Expect = 0.10 Identities = 25/69 (36%), Positives = 25/69 (36%), Gaps = 7/69 (10%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPPXXX----PPXXPXPPXXX-PPXPP--PXPPXPPXXPP 771 P I P P P PP PP P PP PP PP P PP P PP Sbjct: 81 PGNPAGAIGPPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGP-AGPP 139 Query: 772 LXGGVXGAP 798 G G P Sbjct: 140 GTNGELGPP 148 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 5/46 (10%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXP-----PPPPXPXPPXPXPXAPP 761 P P PP PP PP P P PP P P P P PP Sbjct: 179 PGPNGPLGPPGPPGDMGPPGLPGPQGPQMPPGPPGLPGAPGPKGPP 224 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXPPPXPP---XPPXXPPLXGGVXGAPXTP 807 P P PP PP P PP P PP P PP G GA P Sbjct: 877 PGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGCLGPPGDAGPAGNTGGAGCQP 929 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXG 792 P PP PP P PP P PP P P PP G G Sbjct: 625 PGPPGPASPPSPPGPPGPPGPKGPPG-PNGPLGPPGESGPAG 665 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/49 (40%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = +1 Query: 667 PXPPPX-XXPPXXPXPPXXXPPXPPPXP-PXPPXXPPLXGGVXGAPXTP 807 P PPP PP P PP P PP P P P P G+ G P P Sbjct: 29 PPPPPPYEAPPPPPGPP--GPDGPPGFPGPQGPNGPKGPPGLPGPPGPP 75 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +3 Query: 654 PPXPPPP--PPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PP PP P P PP P P P P PP Sbjct: 272 PPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPP 309 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 691 PPXXPXPPXXXPPXPPPXPPXP--PXXPPLXGGVXGAP 798 P P PP P PP PP P P PP G G P Sbjct: 621 PAGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 658 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPP 759 P P P P PP PP P PP P P P PP Sbjct: 707 PGLPGPPGPASPP--SPPGPPGPPGPNGPPGPNGPLGPP 743 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPP 759 P P P P PP PP P PP P P P PP Sbjct: 792 PGLPGPPGPASPP--SPPGPPGPPGPKGPPGPNGPLGPP 828 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P P PP PP P P PP P PP Sbjct: 114 PPGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPGDVGPP 154 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PP P PP P PP P P P P AP Sbjct: 357 PPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAP 388 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PP P PP P PP P P P P AP Sbjct: 442 PPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAP 473 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PP P PP P PP P P P P AP Sbjct: 527 PPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAP 558 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXG 792 P P P PP PP P PP P P P PP G G Sbjct: 625 PGPPGPASPPS--PPGPPGPPGPKGPPGPNGPLGPPGESGPAGNAGG 669 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 + PP PP PP PP PP PP P P P PP Sbjct: 100 NGPPGELGDMGPPGPPG--PPGPQMPPGPPG-LPGPPGPAGPP 139 Score = 31.9 bits (69), Expect = 0.71 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 2/66 (3%) Frame = +1 Query: 616 DKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP--PLXGGVX 789 D +P P P P PP P PP P PP PP P P G Sbjct: 193 DMGPPGLPGPQGPQ-MPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNH 251 Query: 790 GAPXTP 807 G P P Sbjct: 252 GNPAGP 257 Score = 31.9 bits (69), Expect = 0.71 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P PP PP P P P PP P PP G G P P Sbjct: 452 PGLPGPPGPQMPPGPPGLPGAPGPNGPPG-INGPLGPPGEAGPPGNPGGP 500 Score = 31.9 bits (69), Expect = 0.71 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P PP PP P P P PP P PP G G P P Sbjct: 537 PGLPGPPGPQMPPGPPGLPGAPGPNGPPG-INGPLGPPGEAGPPGNPGGP 585 Score = 31.5 bits (68), Expect = 0.94 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 D PP P P P P PP P PP PP P P Sbjct: 48 DGPPGFPGPQGPNGP--KGPPGLPGPPGPPGFQGPPGNP 84 Score = 31.5 bits (68), Expect = 0.94 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P PP PP P P P PP P PP G G P P Sbjct: 282 PGLPGPPGPQMPPGPPGLPGAPGPKGPPG-TNGPLGPPGDVGPPGNPGGP 330 Score = 31.5 bits (68), Expect = 0.94 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +3 Query: 627 QXDSPPXXPPPXP--PPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 Q P PP P PP P P PP P P P P PP Sbjct: 348 QPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPKGPP 394 Score = 31.5 bits (68), Expect = 0.94 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P PP PP P P P PP P PP G G P P Sbjct: 367 PGLPGPPGPQMPPGPPGLPGAPGPKGPPG-TNGPLGPPGDVGPPGNPGGP 415 Score = 31.5 bits (68), Expect = 0.94 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +3 Query: 627 QXDSPPXXPPPXP--PPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 Q P PP P PP P P PP P P P P PP Sbjct: 433 QPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPP 479 Score = 31.5 bits (68), Expect = 0.94 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 2/60 (3%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP--PLXGGVXGAPXTP 807 +P P P P PP P PP P PP PP P P G G P P Sbjct: 454 LPGPPGPQ-MPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPGYQGNHGNPAGP 512 Score = 31.5 bits (68), Expect = 0.94 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +3 Query: 627 QXDSPPXXPPPXP--PPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 Q P PP P PP P P PP P P P P PP Sbjct: 518 QPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPP 564 Score = 31.5 bits (68), Expect = 0.94 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 2/60 (3%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP--PLXGGVXGAPXTP 807 +P P P P PP P PP P PP PP P P G G P P Sbjct: 539 LPGPPGPQ-MPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPGYQGNHGNPAGP 597 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 673 PPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 PP P PP PP PP PP P + G G P P Sbjct: 90 PPGLPGPNGVNGPPGELGDMGPPGPPGPP-GPQMPPGPPGLPGPP 133 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 6/47 (12%) Frame = +3 Query: 639 PPXXP----PPXPPPPPPXXXPPXXPXPPPPPXP-XPPXP-XPXAPP 761 PP P PP P PP PP P P P P PP P PP Sbjct: 272 PPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPP 318 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +3 Query: 639 PPXXP-PPXPPPPPPXXXPPXXPXPPPPPXPXPP--XPXPXAPP 761 PP P PP P PP P P P PP P P PP Sbjct: 366 PPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPP 409 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = +3 Query: 639 PPXXP-PPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P PP P PP PP P P P P P P PP Sbjct: 451 PPGLPGPPGPQMPP---GPPGLPGAPGPNGP-PGINGPLGPP 488 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = +3 Query: 639 PPXXP-PPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P PP P PP PP P P P P P P PP Sbjct: 536 PPGLPGPPGPQMPP---GPPGLPGAPGPNGP-PGINGPLGPP 573 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PP P PP P P P P P PP Sbjct: 782 PPGQVGEMGPPGLPGPPGPASP-PSPPGPPGPP 813 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PP P PP P P P P P PP Sbjct: 867 PPGQVGEMGPPGLPGPPGPASPPSP-PGPPGPP 898 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXG--GVXGAPXT 804 P P P PP P PP P PP P L G G G P T Sbjct: 91 PGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAGPPGT 141 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGV 786 P P P P PP PP P P P P PP GGV Sbjct: 625 PGPPGPASPPSPPG--PPGPPGPKGPPGPNGPLGPPGESGPAGNAGGV 670 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PP P PP P P P P P PP Sbjct: 697 PPGQIGEMGPPGLPGPPGPASP-PSPPGPPGPP 728 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 675 PPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P P PP P P P P PP Sbjct: 706 PPGLPGPPGPASPPSPPGPPGPPGPNGPP 734 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPP 737 SPP PP PP PP PP P PP P Sbjct: 717 SPPS--PPGPPGPPGPNGPPGPNGPLGPPGECGP 748 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 675 PPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P P PP P P P P PP Sbjct: 791 PPGLPGPPGPASPPSPPGPPGPPGPKGPP 819 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPP 737 SPP PP PP PP PP P PP P Sbjct: 802 SPPS--PPGPPGPPGPKGPPGPNGPLGPPGECGP 833 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 675 PPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P P PP P P P P PP Sbjct: 876 PPGLPGPPGPASPPSPPGPPGPPGPKGPP 904 Score = 29.9 bits (64), Expect = 2.9 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP-LXG--GVXGAP 798 P P P P P PP P PP PP P PP L G GV G P Sbjct: 51 PGFPGPQGPNGPKG--PPGLPGPPGPPGFQGPPGNPAGAIGPPGLPGPNGVNGPP 103 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPP 737 PP P PP PP PP PP P P P Sbjct: 627 PPGPASPPSPPGPP--GPPGPKGPPGPNGPLGP 657 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Frame = +1 Query: 643 PXXPXPXXPXPPPX-XXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 P P P P PP PP PP PP PP P Sbjct: 115 PGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPGDVGPPGNP 157 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +1 Query: 667 PXPPPXXXPPXX---PXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXT 804 P PP PP PP P P PP PP P G G P T Sbjct: 349 PGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAP-GPKGPPGT 396 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGV 786 P P P P PP PP P P P P PP GGV Sbjct: 795 PGPPGPASPPSPPG--PPGPPGPKGPPGPNGPLGPPGECGPAGNAGGV 840 Score = 29.1 bits (62), Expect = 5.0 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 8/63 (12%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXP------XPPXXXPPXPPPXPPXPPXXP--PLXGGVXGAP 798 P P P P PP PP P PP P PP PP P P G G P Sbjct: 282 PGLPGPPGPQMPP--GPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNP 339 Query: 799 XTP 807 P Sbjct: 340 AGP 342 Score = 29.1 bits (62), Expect = 5.0 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 8/63 (12%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXP------XPPXXXPPXPPPXPPXPPXXP--PLXGGVXGAP 798 P P P P PP PP P PP P PP PP P P G G P Sbjct: 367 PGLPGPPGPQMPP--GPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNP 424 Query: 799 XTP 807 P Sbjct: 425 AGP 427 Score = 29.1 bits (62), Expect = 5.0 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXG--GVXGAPXTP 807 P P PP P PP P PP PP P P G G+ G P Sbjct: 443 PGPLGDVGPPGLPGPPG---PQMPPGPPGLPGAPGPNGPPGINGPLGPP 488 Score = 29.1 bits (62), Expect = 5.0 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXG--GVXGAPXTP 807 P P PP P PP P PP PP P P G G+ G P Sbjct: 528 PGPLGDVGPPGLPGPPG---PQMPPGPPGLPGAPGPNGPPGINGPLGPP 573 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGV 786 P P P P PP PP P P P P PP GGV Sbjct: 710 PGPPGPASPPSPPG--PPGPPGPNGPPGPNGPLGPPGECGPAGNAGGV 755 Score = 28.7 bits (61), Expect = 6.6 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +3 Query: 639 PPXXP-PPXP--PPPPPXXXPPXXPXPPPPPXPXPP--XPXPXAPP 761 PP P PP P PP PP P P P PP P P PP Sbjct: 281 PPGLPGPPGPQMPPGPPGL--PGAPGPKGPPGTNGPLGPPGDVGPP 324 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAP 798 P PP PP P P P P P P PP G+ GAP Sbjct: 434 PGPPGINGPPG-PLGDVGPPGLPGPPGPQMPPGPP---GLPGAP 473 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = +1 Query: 667 PXPPPXXXPPXX---PXPPXXXPPXPPPXPPXPPXXPPLXG 780 P PP PP PP P P PP PP P G Sbjct: 519 PGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPG 559 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPP 716 SPP P P PP P P P PP Sbjct: 632 SPPSPPGPPGPPGPKGPPGPNGPLGPP 658 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP-XPXAP 758 + PP PP P P P PP P P PP P P P Sbjct: 780 NGPPGQVGEMGPPGLPGPPGPASPPSPPGP-PGPPGPKGPPGP 821 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP-XPXAP 758 + PP PP P P P PP P P PP P P P Sbjct: 865 NGPPGQVGEMGPPGLPGPPGPASPPSPPGP-PGPPGPKGPPGP 906 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPP-PPXPXPPXPXPXAP 758 PP P P PP P PP PP P P P P Sbjct: 90 PPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLP 130 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = +3 Query: 639 PPXXPPPXP----PPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 P P P P PP PP P P P P P P AP Sbjct: 175 PNGLPGPNGPLGPPGPPGDMGPPGLPGPQGPQMPPGPPGLPGAP 218 Score = 28.3 bits (60), Expect = 8.7 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXG--GVXGAPXT 804 P P PP P PP P PP P L G G G P T Sbjct: 264 PGPNGILGPPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGT 311 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP-XPXAP 758 + PP PP P P P PP P P PP P P P Sbjct: 695 NGPPGQIGEMGPPGLPGPPGPASPPSPPGP-PGPPGPNGPPGP 736 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +3 Query: 651 PPPXPPPPPPXXX--PPXXPXPPPPPXPXPPXPXPXAP 758 PPP PPP P PP P PP P PP P P P Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKP 814 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/49 (40%), Positives = 21/49 (42%), Gaps = 7/49 (14%) Frame = +3 Query: 636 SPPXXPPPXPPPPP------PXXXPPXXPXPPPPPXPXPPXP-XPXAPP 761 +PP PPP P P P P P PPPPP P P P PP Sbjct: 776 APPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPP 824 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +1 Query: 616 DKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 DK P P P P P P PP P P P PPP PP P P Sbjct: 770 DKKALGAPPPPPP-PTKPATP--RVPPNIPSRPPGARPTPPPPPPGKPTKP 817 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P PPP P P P P PP P PP PP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPP 811 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPL 774 P P P P PP P P PP PPP P P P L Sbjct: 779 PPPPPTKPATPRVPPNI--PSRPPGARPTPPPPPPGKPTKPTKPSL 822 Score = 32.7 bits (71), Expect = 0.41 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPP 722 PP P PPPPP P P PP P Sbjct: 799 PPGARPTPPPPPPGKPTKPTKPSLPPVP 826 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 P PP P PP P P P P P P P P Sbjct: 789 PRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 >SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) Length = 1049 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/51 (41%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -1 Query: 760 GGAXGXGXG-GXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSCXIYQE 611 GG G G G G G G G G G G GG GGG GGG + I+ + Sbjct: 241 GGGDGDGDGDGDGDGDGDGDGDGDGDGDGGVGGGGGGGSCNDKGLITIFDK 291 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/44 (45%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -1 Query: 766 EXGGAXGXGXG-GXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 + G G G G G G G G G G G G G GG GGG GG Sbjct: 235 DDGDGDGGGDGDGDGDGDGDGDGDGDGDGDGDGDGGVGGGGGGG 278 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 41.5 bits (93), Expect = 9e-04 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P P P PP P P P P PP PP P P G GAP P Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLP-GPQGIPGYPGAPAGP 1715 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 3/58 (5%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXP-PXPPPXPPXPPXXPPLXG--GVXGAPXTP 807 P P P PPP P P P P P P P PP P L G G+ G P P Sbjct: 1655 PVFHYPAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAP 1712 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 +PP PPP P PP P P P P P P P P P Sbjct: 1661 APPPPPPPAPGPPGP-DGPMGLPGPQGPDGPKGPPGPPGLP 1700 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P PP P P PP P P P PP PP G G P P Sbjct: 1815 PGNPAGPPGLDGP--PGPPGPQGPKGWPGVPGPP-GPPGAYGWKGYPGNP 1861 Score = 29.5 bits (63), Expect = 3.8 Identities = 21/61 (34%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +1 Query: 628 KXIPXPXXPXPXXPXPPPXXXPPXXPX-PPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXT 804 K +P P P P P P P PP P PP P P P GV G P Sbjct: 1794 KGMPGPPGP-PGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWP----GVPGPPGP 1848 Query: 805 P 807 P Sbjct: 1849 P 1849 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P PP P P P P P P P PP Sbjct: 1815 PGNPAGPPGLDGPPGPPGPQGPKGWPGVPGPPGPP 1849 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 806 GVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXG 693 G GAP PP R G G G GG G G G Sbjct: 1707 GYPGAPAGPPGRDGPMGPPGPSGGQGPPGDMGSMGPMG 1744 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 P P P PPP PP P PP P P P P P Sbjct: 1652 PWYPVFHYPAPPPP--PPPAPGPPGPDGPM-GLPGPQGP 1687 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 10/45 (22%) Frame = +3 Query: 654 PPXPPPPP----------PXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PP PP PP PP PP PP P P P P Sbjct: 1799 PPGPPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWPGVP 1843 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPP 722 P PP PP P P P PP PP Sbjct: 1822 PGLDGPPGPPGPQGPKGWPGVPGPPGPP 1849 >SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 41.5 bits (93), Expect = 9e-04 Identities = 20/41 (48%), Positives = 21/41 (51%) Frame = -1 Query: 742 GXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSCXI 620 G GG G GGG G G GGGG G GG GG+ S I Sbjct: 56 GQGGGGQGGGQGVGGQEVGGQGGGGQGVGGQEVGGQGSSQI 96 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 767 GXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 G G GG GGG G G G G GGG G G G G Sbjct: 49 GVGQGVGGQGGGGQGGGQGVGGQEVGGQGGGGQGVGGQEVGGQG 92 >SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2492 Score = 41.5 bits (93), Expect = 9e-04 Identities = 19/41 (46%), Positives = 21/41 (51%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G+ G GG G GGG G GG GG GG GG GG+ Sbjct: 1201 GSDDGGDGGYGGSDGGGDGGYGGIDSGGDGGCDGGIDGGGD 1241 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGG 662 GG+ G G GG G GG G G GGG GG Sbjct: 1211 GGSDGGGDGGYGGIDSGGDGGCDGGIDGGGDGG 1243 Score = 35.5 bits (78), Expect = 0.058 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXG--GXXXGGGGGGXGGGXXGG 638 GG G GG G GG G G G GG GG GG GG Sbjct: 1197 GGYDGSDDGGDGGYGGSDGGGDGGYGGIDSGGDGGCDGGIDGG 1239 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -1 Query: 736 GGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSC 626 GG GG G GG GGG GG GG GG+ C Sbjct: 1197 GGYDGSDDGGDGGYGGSD-GGGDGGYGGIDSGGDGGC 1232 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 6/47 (12%) Frame = +3 Query: 639 PPXXPPPXPP------PPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P PPP PP PPP P P PPP P P P P PP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGG 783 P P P PPP P PP P P PP PP PP+ GG Sbjct: 280 PPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPP--PPMLGG 326 Score = 31.5 bits (68), Expect = 0.94 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +1 Query: 679 PXXXPPXXPXPPXXXPPXPPPX---PPXPPXXPPLXGGVXGAPXTP 807 P PP P PP PPP P P PPL GV P P Sbjct: 276 PTSQPP--PPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPP 319 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPP 741 +P P P PPP P P PP PP PPP Sbjct: 291 LPPPFGGHPAAAPPPP-PLPAGVPAPP---PPPPPP 322 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 41.1 bits (92), Expect = 0.001 Identities = 25/67 (37%), Positives = 30/67 (44%), Gaps = 6/67 (8%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGG------GGGXGGGXXGGESSCXIYQEXV 605 E GG G G G G G GGG GG GGG GGG GGG + + + V Sbjct: 98 ERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGGCYEIQIEPSLQHKGV 157 Query: 604 XHFLXRV 584 FL ++ Sbjct: 158 GKFLMQI 164 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGG 653 GG G G G G GGG G GG GGGGG GG Sbjct: 94 GGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGG 129 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/38 (52%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGG-GGXGXXGGXXXGGGGGGXGGG 650 GG GG G GGG GG G GG GGGG GGG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGG 129 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 E G G G G GGGGG G GG GGGG GGG GG Sbjct: 89 ENRGGGGRRERG-GRGGGGGYGGGGGY--GGGGRSYGGGGGGG 128 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -1 Query: 736 GGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSCXIYQE 611 GG G GG G GG GGG GG G GG YQ+ Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQD 133 Score = 35.1 bits (77), Expect = 0.076 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -3 Query: 773 RGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 RGG GG GG GG GG GG GG GGG G G G Sbjct: 99 RGGRGGG-GGYGG--GGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G GGGG GG GGG GGG GG Sbjct: 93 GGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGG 129 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXG 657 GG GG GGG GG GG GG GGG G G Sbjct: 93 GGGRRERGGRGGG-GGYGGGGGYGGGGRSYGGGGGGGG 129 Score = 33.5 bits (73), Expect = 0.23 Identities = 24/64 (37%), Positives = 25/64 (39%) Frame = -3 Query: 842 GGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGX 663 GGGG+ R G GG GG GG GG GG GG G GG G Sbjct: 92 GGGGRRERGGRGG-----------GGGYGGGGGYGG--GGRSYGGGGGGGGFYQDSYGGG 138 Query: 662 XGXG 651 G G Sbjct: 139 GGGG 142 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P P PP P P P PP PP PP+ P TP Sbjct: 894 PPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTP 940 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 P P P P PPP P P PP PP PPP P P Sbjct: 898 PTTPKPTTPAPPPPL--PLAPEPPPPLPPPPPPIQTTRPTVP 937 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 666 PPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PPPP PP P PP P PP P P P Sbjct: 951 PPPPTSALPPPIPATQVPPPPLPPLPPPPPP 981 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = +3 Query: 642 PXXPPPX---PPP-PPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 P PPP PPP P PP P PPPP P P PP S Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPPAS 994 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 +P P P PPPP P P P PPP P P P Sbjct: 897 TPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVP 937 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P PPPP P P P PPPPP P P Sbjct: 901 PKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTP 940 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXP-PXXPXPP----PPPXPXPPXPXPXAPP 761 P PPP PPPPPP P P P P PP P PP Sbjct: 916 PEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPP 960 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P P P PPP P P PPPP P PP P P Sbjct: 898 PTTPKPTTPAPPPPL--PLAPEPPPP-LPPPPPPIQTTRP 934 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +3 Query: 666 PPPPPXXXPPXXPXPPPP-P-XPXPPXPXPXAPP 761 PP P P P PPPP P P PP P P PP Sbjct: 894 PPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPP 927 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPL 774 P PPP P P PP PP PP PP PP+ Sbjct: 949 PTPPPPTSALPPPIPATQVPP--PPLPPLPPPPPPV 982 Score = 35.1 bits (77), Expect = 0.076 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P P P P PP PP PP P PP Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPLPPLP-PPPPPVQTTTAPTLPP 992 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXP-PPPPXPXPPXPXPXAPP 761 P PP P P PPPP P P P P PP Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPPPPLPLAPEPPPPLPP 924 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXP 728 PP PP PPPPPP PP P Sbjct: 968 PPPPLPPLPPPPPPVQTTTAPTLPPASCMP 997 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPP 737 +PP P P PPPP PP P P P Sbjct: 907 APPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTP 940 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 7/54 (12%) Frame = +1 Query: 634 IPXPXXPX----PXXPXPPPXXXPPXXPXPPXXXPPXPPPXPP---XPPXXPPL 774 +P P P P P P P PP PPP P PP PPL Sbjct: 922 LPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPL 975 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXP 734 P P PPPPP P PP P P Sbjct: 1112 PLPPPPPPPTEIPPAQETFEGSPPCPSP 1139 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/62 (29%), Positives = 20/62 (32%), Gaps = 4/62 (6%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXP--PXXPXPP--XXXPPXPPPXPPXPPXXPPLXGGVXGAPX 801 +P P P P PPP P P P P P PP PP+ P Sbjct: 912 LPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPP 971 Query: 802 TP 807 P Sbjct: 972 LP 973 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPP 737 PPP PP PPP P PP P Sbjct: 969 PPPLPPLPPPPPPVQTTTAPTLPPASCMP 997 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Frame = +3 Query: 639 PPXXPPPXPPP---PPPXXXPPXXPXP--PPPPXPXPPXPXPXAP 758 PP P P PP P P PP P P PPP P P P P AP Sbjct: 423 PPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAP 467 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Frame = +3 Query: 639 PPXXPPPXPPP---PPPXXXPPXXPXP--PPPPXPXPPXPXPXAP 758 PP P P PP P P PP P P PPP P P P P AP Sbjct: 443 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 487 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Frame = +3 Query: 639 PPXXPPPXPPP---PPPXXXPPXXPXP--PPPPXPXPPXPXPXAP 758 PP P P PP P P PP P P PPP P P P P AP Sbjct: 453 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 497 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Frame = +3 Query: 639 PPXXPPPXPPP---PPPXXXPPXXPXP--PPPPXPXPPXPXPXAP 758 PP P P PP P P PP P P PPP P P P P AP Sbjct: 503 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 547 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/53 (35%), Positives = 21/53 (39%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P + +P P P P P PP P P P P PPP P P PP Sbjct: 494 PGAPHQRVPPPGAPHPRVP--PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 544 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P +P P P P P PP P P P P PPP P P PP Sbjct: 554 PGASHPRVPPPGAPHPRVP--PPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPP 604 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +1 Query: 637 PXPXXPXPXXPXP---PPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P P PP P P P P PPP P P PP Sbjct: 427 PHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 474 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +1 Query: 637 PXPXXPXPXXPXP---PPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P P PP P P P P PPP P P PP Sbjct: 437 PHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 484 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +1 Query: 637 PXPXXPXPXXPXP---PPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P P PP P P P P PPP P P PP Sbjct: 447 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 494 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +1 Query: 637 PXPXXPXPXXPX---PPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P PPP P P P P PPP P P PP Sbjct: 487 PHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 534 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +1 Query: 637 PXPXXPXPXXPXP---PPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P P PP P P P P PPP P P PP Sbjct: 507 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 554 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +1 Query: 637 PXPXXPXPXXPXP---PPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P P PP P P P P PPP P P PP Sbjct: 527 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPP 574 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +1 Query: 637 PXPXXPXPXXPXP---PPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P P PP P P P P PPP P P PP Sbjct: 537 PHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPP 584 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +3 Query: 639 PPXXPPPXPPPP---PPXXXPPXXPXP--PPPPXPXPPXPXPXAP 758 PP P P PPP P PP P P PPP P P P P P Sbjct: 543 PPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTP 587 Score = 39.5 bits (88), Expect = 0.004 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 10/51 (19%) Frame = +3 Query: 636 SPPXXPPPXPP----PPP----PXXXPPXXPXP--PPPPXPXPPXPXPXAP 758 S P PPP P PPP P PP P P PPP P P P P AP Sbjct: 557 SHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAP 607 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 5/44 (11%) Frame = +3 Query: 639 PPXXPPPXPPP---PPPXXXPPXXPXP--PPPPXPXPPXPXPXA 755 PP P P PP P P PP P P PPP P P P P A Sbjct: 513 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGA 556 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +3 Query: 639 PPXXPPPXPPPP---PPXXXPPXXPXP--PPPPXPXPPXPXPXAP 758 PP P P PPP PP P P PPP P P P P AP Sbjct: 403 PPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAP 447 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +3 Query: 639 PPXXPPPXPPP---PPPXXXPPXXPXP--PPPPXPXPPXPXPXAP 758 PP P P PP P P PP P P PPP P P P AP Sbjct: 463 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAP 507 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +3 Query: 639 PPXXPPPXPPP---PPPXXXPPXXPXP--PPPPXPXPPXPXPXAP 758 PP P P PP P P PP P PPP P P P P AP Sbjct: 473 PPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAP 517 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +3 Query: 639 PPXXPPPXPPP---PPPXXXPPXXPXP--PPPPXPXPPXPXPXAP 758 PP P P PP P PP P P PPP P P P P AP Sbjct: 483 PPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAP 527 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +3 Query: 639 PPXXPPPXPPP---PPPXXXPPXXPXP--PPPPXPXPPXPXPXAP 758 PP P P PP P P PP P P PPP P P P AP Sbjct: 523 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAP 567 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 8/61 (13%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXP--------PPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 P +P P P P P P PP P P P P PPP P P P Sbjct: 394 PGASHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPP 453 Query: 769 P 771 P Sbjct: 454 P 454 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +1 Query: 637 PXPXXPXPXXPXP---PPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P P PP P P P P PPP P PP Sbjct: 457 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPP 504 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +1 Query: 637 PXPXXPXPXXPXP---PPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P P PP P P P PPP P P PP Sbjct: 467 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPP 514 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +1 Query: 637 PXPXXPXPXXPXP---PPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P P PP P P P PPP P P PP Sbjct: 477 PHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPP 524 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +1 Query: 637 PXPXXPXPXXPXP---PPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P P PP P P P P PPP P PP Sbjct: 517 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPP 564 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +3 Query: 642 PXXPPPX---PPPPPPXXXPPXXPXP--PPPPXPXPPXPXPXAPP 761 P PPP P PPP P P P P P P P P P PP Sbjct: 549 PRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPP 593 Score = 35.1 bits (77), Expect = 0.076 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P PPP P P P P PPP P P PP Sbjct: 377 PYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPPP 414 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXP--PPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGV 786 P +P P P P P P P PP P PP P PP P Sbjct: 444 PGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPP 503 Query: 787 XGAP 798 GAP Sbjct: 504 PGAP 507 Score = 33.5 bits (73), Expect = 0.23 Identities = 21/61 (34%), Positives = 22/61 (36%), Gaps = 8/61 (13%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPP---PXXXPPXXPXPPXXXP----P-XPPPXPPXPPXXP 768 P +P P P P P P P PP P P P P PPP P P P Sbjct: 534 PGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPP 593 Query: 769 P 771 P Sbjct: 594 P 594 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 637 PXPXXPXPXXP---XPPPXXXPPXXPXPPXXXPPXPPPXPP 750 P P P P P PPP P P P P PPP P Sbjct: 567 PHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAP 607 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +1 Query: 637 PXPXXPXPXXPXP--PPXXXP-PXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P P PP P P P PPP PP PP Sbjct: 587 PHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQRVPPP 634 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXP---PPPPXPXPPXPXP 749 P PPP P P P P P PPP P PP P Sbjct: 297 PGYPPPQYMPHPRMRPPTRIPPPGMGPPPRIPPPPIRAP 335 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXP--PPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 P +P P P P P P P P P PP PP PP P Sbjct: 584 PGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQRVPPPGAP 637 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P PPP P P P P P P PP Sbjct: 373 PPGEPYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPP 413 Score = 29.1 bits (62), Expect = 5.0 Identities = 18/65 (27%), Positives = 19/65 (29%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXG 792 P+ P P P P P P P PP PP P P G Sbjct: 287 PESDMSYQTAPGYPPPQYMPHPRMRPPTRIPPPGMGPPPRIPPPPIRAPVDVYPPRAPQG 346 Query: 793 APXTP 807 A TP Sbjct: 347 ASQTP 351 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PP PPP PP P P P PP Sbjct: 312 PPTRIPPPGMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPP 352 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXP--PPPPXPXPPXPXPXA 755 P PPP P P PP P P PPP P P A Sbjct: 579 PRVPPPG--TPHPRVPPPGAPHPKVPPPGAPYQRLPYSGA 616 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PPP PPPP PP PPPP PP P P Sbjct: 477 PPPRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQRMP 512 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +1 Query: 673 PPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 PPP P P PP P P P PP PP GG+ G P P Sbjct: 429 PPPQHTGPPQPRPPHGMPQGGGP-PQLPPNLPPPPGGMRGMPPPP 472 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 5/46 (10%) Frame = +3 Query: 639 PPXXPPPXP-----PPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PPP PPPP PP PPPP P PP PP Sbjct: 455 PPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPP 500 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +3 Query: 627 QXDSPPXXPPPXPPPPPPXXXPPXXPXPP-PPPXPXPPXPXPXAPP 761 Q PP PP PPPP P P PPP PP P PP Sbjct: 447 QGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPP 492 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PPP PPP PP PPPP PP P PP Sbjct: 470 PPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPP 506 Score = 36.3 bits (80), Expect = 0.033 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 PPP PPPP PP PPPP P P Sbjct: 484 PPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQGP 516 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPP--PXPPXPPXXPP 771 P + +P P P PP PP PP P PP PP P PP Sbjct: 451 PPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPP 505 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXX--PXPPXXXPPXPPPXPPXPP 759 P P PPP PP P PP P PP P PP Sbjct: 470 PPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPP 507 Score = 31.9 bits (69), Expect = 0.71 Identities = 22/78 (28%), Positives = 23/78 (29%), Gaps = 5/78 (6%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPP--PPPXPXPPXPXPXAPPXSXXXXXXXXXXXXXXX 812 PP PP P P P PP PP P PP PP Sbjct: 428 PPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPF 487 Query: 813 XXSXXF---XPPPQXXPP 857 F PPP+ PP Sbjct: 488 GPPPPFYRGPPPPRGMPP 505 Score = 31.5 bits (68), Expect = 0.94 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPP---XXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P PPP PP P PP P PPP P PP Sbjct: 472 PMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMP--PPPRQRMPSQGPP 517 Score = 29.9 bits (64), Expect = 2.9 Identities = 21/80 (26%), Positives = 22/80 (27%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXSXXXXXXXXXXXXXXXX 815 S P PPPP P P P PP P PP Sbjct: 419 STPAANMRLPPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPP-PPGGMRGMPPPPMGMYP 477 Query: 816 XSXXFXPPPQXXPPXHHHFP 875 F PPP PP + P Sbjct: 478 PPRGFPPPPFGPPPPFYRGP 497 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGG--GXXGGES 632 GGA G G GG G GG G G GG GG GG G GG S Sbjct: 777 GGASG-GAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSS 820 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GGA G G G G GG G G GG GG GG G SS Sbjct: 788 GGANG-GAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSS 830 Score = 38.3 bits (85), Expect = 0.008 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 5/49 (10%) Frame = -1 Query: 760 GGAXGX---GXGGXGXGGGGGXGXXGGXXXG--GGGGGXGGGXXGGESS 629 GGA G GG G GG G GG G GG GG GG GG S Sbjct: 781 GGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGS 829 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GGA G G GG G GG G G GG G GG G + Sbjct: 799 GGASG-GAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGAD 839 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 GGA G G G GG G GG G GG GG GG + Sbjct: 803 GGAGGSSGGASGGAGGSSGGASGG--AGSSSGGASGGADGGSN 843 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 G GG G GG G GG G G GG G G G G Sbjct: 773 GSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAG 817 Score = 36.3 bits (80), Expect = 0.033 Identities = 20/64 (31%), Positives = 21/64 (32%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG G GG + GG GG G GG G GG G G G Sbjct: 777 GGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASG 836 Query: 677 GGXG 666 G G Sbjct: 837 GADG 840 Score = 35.1 bits (77), Expect = 0.076 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GGA G G GG G GG GG G G G +S Sbjct: 792 GGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGAS 835 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXG--GGGGGXGGGXXGG 638 + G G G G GG G GG G GG G GG GG Sbjct: 760 DSSGGDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGG 804 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 G + G GG G GG G G GG G GG GG S Sbjct: 773 GSSSGGASGGAGGSSGGANGGAGSS--SGGASGGAGGSSGGAS 813 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG--GGXGXXGXGXXG 642 GG GG GG GG G G GG G GG G G G Sbjct: 792 GGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASG 836 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGG-----GXGGGXXGGES 632 GG+ G GG G GG G GG G GG G G G S Sbjct: 784 GGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSS 831 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 G G GG G GG G G GG GG G S Sbjct: 803 GGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADGGSNKS 845 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGG--GXXGGES 632 G G G G GG G G GG G GG G GG S Sbjct: 766 GHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSS 809 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 758 GGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 G GG GG GG G G GG G G G G Sbjct: 800 GASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADG 840 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXG 642 G GG G GG G GG G G GG G G Sbjct: 795 GSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGG 837 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGG 675 GG GG GG GG G G G GG Sbjct: 810 GGASGGAGGSSGGASGGAGSSSGGASGGADGG 841 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 736 GGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GG G G GG GG GG GG G SS Sbjct: 763 GGDGHASSGAGSSSGGAS-GGAGGSSGGANGGAGSS 797 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 PP PPPPPP PP P PPPPP P P Sbjct: 54 PPPPPPPPP---PP--PPPPPPPSSSPSRP 78 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PPPPPP P PPPPP P PP P P Sbjct: 54 PPPPPP-------PPPPPPPPPPPPSSSPSRP 78 Score = 38.7 bits (86), Expect = 0.006 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPP 713 PP PPP PPPPPP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 36.7 bits (81), Expect = 0.025 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 708 PPPPPXPXPPXPXPXAPPXS 767 PPPPP P PP P P PP S Sbjct: 54 PPPPPPPPPPPPPPPPPPSS 73 Score = 35.9 bits (79), Expect = 0.044 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +3 Query: 690 PPXXPXPPPPPXPXPPXPXPXAPP 761 PP P PPPPP P PP P P + P Sbjct: 54 PP--PPPPPPPPPPPPPPPPSSSP 75 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 724 PPXPPPXPPXPPXXPPLXGGVXGAPXT 804 PP PPP PP PP PP P T Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRPLT 80 Score = 34.3 bits (75), Expect = 0.13 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 709 PPXXXPPXPPPXPPXPPXXPP 771 PP PP PPP PP PP P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSP 75 Score = 33.9 bits (74), Expect = 0.18 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 703 PXPPXXXPPXPPPXPPXPPXXP 768 P PP PP PPP PP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 33.5 bits (73), Expect = 0.23 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 690 PPXXPXPPPPPXPXPPXPXPXAPP 761 PP P PPPPP P PP + P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 33.5 bits (73), Expect = 0.23 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 702 PXPPPPPXPXPPXPXPXAPPXS 767 P PPPPP P PP P P + S Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPS 76 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 694 PXXPXPPXXXPPXPPPXPPXPPXXP 768 P P PP PP PPP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 31.9 bits (69), Expect = 0.71 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 691 PPXXPXPPXXXPPXPPPXPPXPPXXPPL 774 PP P PP PP PPP PP PL Sbjct: 54 PPPPPPPPP--PPPPPPPPPSSSPSRPL 79 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 733 PPPXPPXPPXXPPLXGGVXGAPXTP 807 PPP PP PP PP +P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +1 Query: 694 PXXPXPPXXXPPXPPPXPPXPPXXPPLXGG 783 P P PP PP PPP PP PP PP GG Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPP--PPPSGG 86 Score = 38.3 bits (85), Expect = 0.008 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPP 695 PP PPP PPPPPP PP Sbjct: 64 PPTLPPPPPPPPPPLPPPP 82 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/28 (60%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +3 Query: 642 PXXP-PPXPPPPPPXXXPPXXPXPPPPP 722 P P PP PPPPP PP P PPPPP Sbjct: 59 PTVPIPPTLPPPPP---PPPPPLPPPPP 83 Score = 35.1 bits (77), Expect = 0.076 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 675 PPXXXPPXXPXPPPPPXPXPPXPXP 749 P PP P PPPPP P P P P Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPP 737 P P P PP P PPPPP P PP Sbjct: 59 PTVPIPPTLPPPPP-PPPPPLPPPP 82 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 669 PPPPXXXPPXXPXPPPPPXPXPPXP 743 P PP PP PPPPP P PP P Sbjct: 62 PIPPTLPPP----PPPPPPPLPPPP 82 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 693 PXXPXPPPPPXPXPPXPXPXAPP 761 P P PP P P PP P P PP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPP 81 Score = 31.9 bits (69), Expect = 0.71 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 676 PPXXXPPXXPXPPXXXPPXPPPXPP 750 P PP P PP PP PP PP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 693 PXXPXPPPPPXPXPPXPXPXAPP 761 P P PPPP P PP P P PP Sbjct: 62 PIPPTLPPPP-PPPPPPLPPPPP 83 Score = 31.9 bits (69), Expect = 0.71 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXP 728 PP PPPPPP P P PPP P Sbjct: 64 PPTLPPPPPPP------PPPLPPPPP 83 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPP 695 P PPP PPPPP PP Sbjct: 65 PTLPPPPPPPPPPLPPPPP 83 >SB_19562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/42 (47%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -1 Query: 757 GAXGXGXG-GXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G G G G G G G G G G G GGGG GGG G+ Sbjct: 212 GGDGNGDGEGEGEGEGDGDGDGDGNGDGDGGGGDGGGDGDGD 253 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 755 GXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXG 642 G GG G G G G G G G G G G G G Sbjct: 210 GDGGDGNGDGEGEGEGEGDGDGDGDGNGDGDGGGGDGG 247 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +1 Query: 694 PXXPXPPXXXPPXPPPXPPXPPXXPPLXGG 783 P P PP PP PPP PP PP PP GG Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPP--PPPSGG 310 Score = 38.3 bits (85), Expect = 0.008 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPP 695 PP PPP PPPPPP PP Sbjct: 288 PPTLPPPPPPPPPPLPPPP 306 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/28 (60%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +3 Query: 642 PXXP-PPXPPPPPPXXXPPXXPXPPPPP 722 P P PP PPPPP PP P PPPPP Sbjct: 283 PTVPIPPTLPPPPP---PPPPPLPPPPP 307 Score = 35.1 bits (77), Expect = 0.076 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 675 PPXXXPPXXPXPPPPPXPXPPXPXP 749 P PP P PPPPP P P P P Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPP 737 P P P PP P PPPPP P PP Sbjct: 283 PTVPIPPTLPPPPP-PPPPPLPPPP 306 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 669 PPPPXXXPPXXPXPPPPPXPXPPXP 743 P PP PP PPPPP P PP P Sbjct: 286 PIPPTLPPP----PPPPPPPLPPPP 306 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 693 PXXPXPPPPPXPXPPXPXPXAPP 761 P P PP P P PP P P PP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPP 305 Score = 31.9 bits (69), Expect = 0.71 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 676 PPXXXPPXXPXPPXXXPPXPPPXPP 750 P PP P PP PP PP PP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 693 PXXPXPPPPPXPXPPXPXPXAPP 761 P P PPPP P PP P P PP Sbjct: 286 PIPPTLPPPP-PPPPPPLPPPPP 307 Score = 31.9 bits (69), Expect = 0.71 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXP 728 PP PPPPPP P P PPP P Sbjct: 288 PPTLPPPPPPP------PPPLPPPPP 307 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPP 695 P PPP PPPPP PP Sbjct: 289 PTLPPPPPPPPPPLPPPPP 307 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PPPPPP P P PPPPP P P P P Sbjct: 424 PPPPPPPA--PLPPPPPPPPQPTTALPDPLQGP 454 Score = 36.3 bits (80), Expect = 0.033 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P P P PPPPP P PP P P P Sbjct: 409 PFPTPNRRRRRSLVQPPPPPPPAPLPPPPPPPPQP 443 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 691 PPXXPXPPXXXPPXPPPXPPXPPXXPPLXG 780 PP P P PP PPP P PL G Sbjct: 424 PPPPPPPAPLPPPPPPPPQPTTALPDPLQG 453 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/60 (28%), Positives = 20/60 (33%) Frame = +1 Query: 562 YSXHAVYVPYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPP 741 YS +Y R + P + P P PPP PP P PP P P Sbjct: 394 YSEQVIYDLRGRTIRPFPTPNRRRRRSLVQPPPP---PPPAPLPPPPPPPPQPTTALPDP 450 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 673 PPPXXXPPXXPXPPXXXPPXPPPXP 747 PPP PP P PP PP PPP P Sbjct: 424 PPPP--PPPAPLPP---PPPPPPQP 443 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 703 PXPPXXXPPXPPPXPPXPPXXPPLXGGVXG 792 P PP P PPP PP P L + G Sbjct: 424 PPPPPPPAPLPPPPPPPPQPTTALPDPLQG 453 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 P PPP P P PP PP P P P P Sbjct: 424 PPPPPPPAPLPPPPPP---PPQPTTALPDPLQGP 454 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/45 (46%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGG-GGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GG G GG GGG G GG GGGGGG GG G +S Sbjct: 474 GGVGGRSIWNVVPGGFGGGGGASGGGGGGGGGGGFSGGACGDFTS 518 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 7/48 (14%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGG-------GGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG GG G GG GGGGGG GGG GG Sbjct: 464 GGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGGGGGGGGGFSGG 511 Score = 36.7 bits (81), Expect = 0.025 Identities = 27/82 (32%), Positives = 29/82 (35%), Gaps = 1/82 (1%) Frame = -3 Query: 842 GGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGG-GXGGXXXGGXGXXGGXXXGGGXG 666 GGGG G P GG GG GG GG G GG GGG G Sbjct: 443 GGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGAS-GGGGG 501 Query: 665 XXGXGXXGXGIXLXYLSGMXXT 600 G G G + SG+ T Sbjct: 502 GGGGGGFSGGACGDFTSGLSPT 523 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 GG G GG G GGGG G G G GGG Sbjct: 491 GGGGASGGGGGGGGGGGFSGGACGDFTSGLSPTCGGG 527 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = -3 Query: 842 GGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGX 663 G GGK G P G GG G GGG GG G G G Sbjct: 465 GEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGGGGGGGGGFSGGACGDFTSGLSPTC 524 Query: 662 XGXG 651 G G Sbjct: 525 GGGG 528 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 GGA G G GG G GGG G G G GGG Sbjct: 493 GGASGGGGGG-GGGGGFSGGACGDFTSGLSPTCGGGG 528 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/29 (55%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +3 Query: 636 SPPXXPPPXPPP-PPPXXXPPXXPXPPPP 719 +PP PPP PPP PPP PP PP P Sbjct: 429 TPPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 37.1 bits (82), Expect = 0.019 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXP 734 PPP PPP PP PP P P P P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 PPP PP PP P PP PP P P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPP-PQP 457 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 691 PPXXPXPPXXXPPXPPPXPPXPPXXPP 771 PP P PP PP PPP P PP Sbjct: 430 PP--PTPPPTPPPTPPPTTLPPTTQPP 454 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXPP 738 P P P P PP PP PP P Sbjct: 431 PPTPPPTPPPTPPPTTLPPTTQPPPQP 457 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXG-XXGGXXXGGGGGGXGGGXXGG 638 GG G GG G G GGG G GG G GGG G G GG Sbjct: 305 GGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGG 346 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXG-XXGGXXXGGGGGGXGGGXXGG 638 GG G G G G G GGG G GG G G G G G GG Sbjct: 242 GGGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGG 283 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGG-GGGXGGGXXGG 638 G G G GG G G GGG G G G G GGG G G GG Sbjct: 251 GWGRGSG-GGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGG 291 Score = 35.5 bits (78), Expect = 0.058 Identities = 25/79 (31%), Positives = 25/79 (31%), Gaps = 2/79 (2%) Frame = -1 Query: 868 WWXXGGXXWGGGXXXX--EGXXXXXXXXXXXXXXXGEXGGAXGXGXGGXGXGGGGGXGXX 695 W G WG G G G GG GG G G GGG G Sbjct: 252 WGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRM 311 Query: 694 GGXXXGGGGGGXGGGXXGG 638 G G GGG G GG Sbjct: 312 QGGMGRGPGGGWGRMQGGG 330 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G G GGG G G G GGG G G G G Sbjct: 229 GPGIGRGSGSPMWGGGMGQGPRGWGRGSGGGWGQGPGGGWG 269 Score = 33.1 bits (72), Expect = 0.31 Identities = 26/83 (31%), Positives = 26/83 (31%), Gaps = 4/83 (4%) Frame = -1 Query: 874 GKWWXXGGXXWGGGXXXXEGXXXXXXXXXXXXXXXGEXGGAXGXGXGGX---GXGGGGGX 704 G W G WG G GG G GG G GGG G Sbjct: 282 GGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGR 341 Query: 703 GXXGG-XXXGGGGGGXGGGXXGG 638 G GG GGG G G G G Sbjct: 342 GPGGGWGRMQGGGMGRGPGQGWG 364 Score = 31.9 bits (69), Expect = 0.71 Identities = 25/74 (33%), Positives = 25/74 (33%), Gaps = 2/74 (2%) Frame = -1 Query: 853 GXXWGGGXXXXEGXXXXXXXXXXXXXXXGEXGGAXGXGXGGX-GXGGGGGXGXXGGXXXG 677 G WG G G G G G G GG G GGG G G G Sbjct: 281 GGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLG 340 Query: 676 -GGGGGXGGGXXGG 638 G GGG G GG Sbjct: 341 RGPGGGWGRMQGGG 354 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 4/45 (8%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPP----XPXPXAPP 761 PP PPPPP P PPPPP PP P P PP Sbjct: 349 PPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/78 (30%), Positives = 26/78 (33%), Gaps = 3/78 (3%) Frame = +3 Query: 633 DSPPXXPPPX---PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXSXXXXXXXXXXXX 803 D P PPP PPPPPP P PPP P P P + P + Sbjct: 305 DQAPAPPPPLNATPPPPPPSRDQVPLP-PPPLRGQIAPPPPPISKPPTSTRSAPPPPPGR 363 Query: 804 XXXXXSXXFXPPPQXXPP 857 PPP PP Sbjct: 364 APQPLGGPPPPPPGRRPP 381 Score = 38.7 bits (86), Expect = 0.006 Identities = 26/83 (31%), Positives = 26/83 (31%), Gaps = 10/83 (12%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPP-----PXPXPP-----XPXPXAPPXSXXXXXXX 788 PP PPPPPP P PPP P P PP P P P S Sbjct: 207 PPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPP 266 Query: 789 XXXXXXXXXXSXXFXPPPQXXPP 857 S PPP PP Sbjct: 267 KNAPPPPKRGSSNPPPPPTRGPP 289 Score = 37.9 bits (84), Expect = 0.011 Identities = 22/70 (31%), Positives = 25/70 (35%), Gaps = 5/70 (7%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPPXXXPPXX----PXPPXXXPPXP-PPXPPXPPXXPPLX 777 P + +P P P PPP PP P PP P P PP PP P Sbjct: 323 PSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPS 382 Query: 778 GGVXGAPXTP 807 G + P P Sbjct: 383 GKINPPPPPP 392 Score = 36.7 bits (81), Expect = 0.025 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPP 719 PP PPP PPPPP P P PPP Sbjct: 2 PPPPPPPGPPPPP---SAPSGPVKPPP 25 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P PP P P P PP PPP P PP G P P Sbjct: 299 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPP 345 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 5/38 (13%) Frame = +3 Query: 639 PPXXPPPX--PPPPPPXXXPPXX---PXPPPPPXPXPP 737 P P P PPPPPP PP P PPPPP P Sbjct: 361 PGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKP 398 Score = 35.5 bits (78), Expect = 0.058 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 14/55 (25%) Frame = +3 Query: 639 PPXXPPPXP------PPPPPXXXPP----XXPXPPPPP----XPXPPXPXPXAPP 761 PP PP P PPPPP PP PP PP P PP P PP Sbjct: 265 PPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPP 319 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P PPPP PP P P P PP APP Sbjct: 302 PSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPP 342 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 P PP PP PP P P P PP P P P S Sbjct: 341 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPS 382 Score = 35.5 bits (78), Expect = 0.058 Identities = 24/78 (30%), Positives = 26/78 (33%), Gaps = 8/78 (10%) Frame = +3 Query: 636 SPPXXPPP-------XPPPPPPXXXPPXXP-XPPPPPXPXPPXPXPXAPPXSXXXXXXXX 791 S P PP PPPPPP PP PPPPP P P P S Sbjct: 355 SAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKPSFTNGPVSNNIMDSKN 414 Query: 792 XXXXXXXXXSXXFXPPPQ 845 + PPP+ Sbjct: 415 SFECRFNFRTLNELPPPE 432 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 6/42 (14%) Frame = +3 Query: 651 PPPXPPPPPP------XXXPPXXPXPPPPPXPXPPXPXPXAP 758 PPP PPPP P PPPPP PP P P Sbjct: 141 PPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKP 182 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PP P P PP PP PPPPP P P P Sbjct: 298 PPLPPSRDQAPAPP---PPLNATPPPPPPSRDQVPLPPPP 334 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 9/57 (15%) Frame = +1 Query: 628 KXIPXPXXPXPXXPXPPPXXXPPXX-------PXPPXXX--PPXPPPXPPXPPXXPP 771 K P P P PPP PP P PP P PPP PP PP Sbjct: 267 KNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPP 323 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 666 PPPPPXXXPPXXPXPPPPPXPXPP 737 PPPPP PP P P P PP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 32.3 bits (70), Expect = 0.54 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXP 734 PPPPPP PP P P P P Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 32.3 bits (70), Expect = 0.54 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 702 PXPPPPPXPXPPXPXPXAP 758 P PPPPP P PP P P Sbjct: 2 PPPPPPPGPPPPPSAPSGP 20 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 E + G GGG G GG GGGG GG GG Sbjct: 59 EKKSSSGGNLSSSSSSTGGGGGFSGGGGGSMGGGGLGGLFAGG 101 Score = 32.3 bits (70), Expect = 0.54 Identities = 23/80 (28%), Positives = 27/80 (33%), Gaps = 6/80 (7%) Frame = +1 Query: 586 PYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPX------P 747 P R++ P + +P P P P PPP P PP PPP P Sbjct: 224 PSQRSLAPPPTGSSRPLPAPP-PGENRP-PPPMRGPTSGGEPPPPKNAPPPPKRGSSNPP 281 Query: 748 PXPPXXPPLXGGVXGAPXTP 807 P P PP P P Sbjct: 282 PPPTRGPPSNSFTTQGPPLP 301 Score = 31.9 bits (69), Expect = 0.71 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPPPPXP 728 P PPPPP PP P P P P Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 31.9 bits (69), Expect = 0.71 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 6/63 (9%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPP------XPPXPPXXPPLXGGVXGAP 798 P P PPP P P P P PPP PP PP P AP Sbjct: 299 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKP-PTSTRSAP 357 Query: 799 XTP 807 P Sbjct: 358 PPP 360 Score = 31.1 bits (67), Expect = 1.2 Identities = 23/78 (29%), Positives = 25/78 (32%), Gaps = 3/78 (3%) Frame = +1 Query: 583 VPYXRNVXXIPDKXXKXIPXPXXP-XPXXPXPPPXXXPPXXPXPPXXXPPXPP--PXPPX 753 +P R+ P P P P P PPP P PP P PP Sbjct: 300 LPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPP 359 Query: 754 PPXXPPLXGGVXGAPXTP 807 PP P G G P P Sbjct: 360 PPGRAPQPLG--GPPPPP 375 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 666 PPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PPPPP P PPP PP P P P Sbjct: 194 PPPPPHSRHGSAP-PPPERSSGPPPPPPGRGP 224 Score = 30.3 bits (65), Expect = 2.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 724 PPXPPPXPPXPPXXP 768 PP PPP PP PP P Sbjct: 3 PPPPPPGPPPPPSAP 17 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 690 PPXXPXPPPPPXPXPPXPXPXAPPXS 767 PP P P PPP P P P PP S Sbjct: 2 PPPPPPPGPPPPPSAP-SGPVKPPPS 26 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 669 PPPPXXXPPXXPXPPPPPXPXPPXPXP 749 PPPP PP P PPP P P P Sbjct: 2 PPPP---PPPGPPPPPSAPSGPVKPPP 25 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 703 PXPPXXXPPXPPPXPPXPPXXPP 771 P PP PP PP P P PP Sbjct: 3 PPPPPPGPPPPPSAPSGPVKPPP 25 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PP PP PPP P P PP Sbjct: 298 PPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPP 333 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 703 PXPPXXXPPXPPPXPPXPPXXPP 771 P PP P PPP P P PP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPP 24 Score = 29.5 bits (63), Expect = 3.8 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 13/58 (22%) Frame = +3 Query: 627 QXDSPPXXPPPXPPPPPPXXXPP-------XXPXPPPPP------XPXPPXPXPXAPP 761 Q PP PPP PPPP P PPPPP P PP PP Sbjct: 162 QGSFPP--PPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPP 217 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +3 Query: 651 PPPXP-----PPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PPP P PPP P PPPPP P APP Sbjct: 194 PPPPPHSRHGSAPPP---PERSSGPPPPPPGRGPSQRSLAPP 232 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 10/51 (19%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXP------PPXPPX----PPXXPPL 774 P P PPP P PP PP PP PP P PPL Sbjct: 264 PPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPL 314 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +1 Query: 673 PPPXXXPPXXPXPPXXXPPXPPPXPP----XPPXXPPLXGGVXGAP 798 PP P PP PPP PP P PPL G + P Sbjct: 298 PPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPP 343 Score = 28.3 bits (60), Expect = 8.7 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 8/50 (16%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXP--------PXXPXPPPPPXPXPPXPXPXAPPXS 767 P PP PPPP P P PPP P P P P S Sbjct: 241 PAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPS 290 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXP---XPPPPPXPXPPXPXPXAPPXS 767 S P P PPPPP PP P PPPP P P A P S Sbjct: 208 SGPLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAPGS 254 Score = 31.5 bits (68), Expect = 0.94 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P PP PP P PP P PP P Sbjct: 210 PLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAP 252 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 P P PP PP PPP P P P P Sbjct: 206 PRSGPLPPTAAPPPPPTTGAPPPTPVTNKPPPPRP 240 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 4/45 (8%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPP----XPXPXAPP 761 PP PPPPP P PPPPP PP P P PP Sbjct: 261 PPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/78 (30%), Positives = 26/78 (33%), Gaps = 3/78 (3%) Frame = +3 Query: 633 DSPPXXPPPX---PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXSXXXXXXXXXXXX 803 D P PPP PPPPPP P PPP P P P + P + Sbjct: 217 DQAPAPPPPLNATPPPPPPSRDQVPLP-PPPLRGQIAPPPPPISKPPTSTRSAPPPPPGR 275 Query: 804 XXXXXSXXFXPPPQXXPP 857 PPP PP Sbjct: 276 APQPLGGPPPPPPGRRPP 293 Score = 38.7 bits (86), Expect = 0.006 Identities = 26/83 (31%), Positives = 26/83 (31%), Gaps = 10/83 (12%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPP-----PXPXPP-----XPXPXAPPXSXXXXXXX 788 PP PPPPPP P PPP P P PP P P P S Sbjct: 119 PPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPP 178 Query: 789 XXXXXXXXXXSXXFXPPPQXXPP 857 S PPP PP Sbjct: 179 KNAPPPPKRGSSNPPPPPTRGPP 201 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/69 (30%), Positives = 23/69 (33%), Gaps = 4/69 (5%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPPXXXPP----XXPXPPXXXPPXPPPXPPXPPXXPPLXG 780 P + +P P P PPP PP P PP P P PP PP Sbjct: 235 PSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPS 294 Query: 781 GVXGAPXTP 807 G P P Sbjct: 295 GKINPPPPP 303 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P PP P P P PP PPP P PP G P P Sbjct: 211 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPP 257 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 5/38 (13%) Frame = +3 Query: 639 PPXXPPPX--PPPPPPXXXPPXX---PXPPPPPXPXPP 737 P P P PPPPPP PP P PPPPP P Sbjct: 273 PGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKP 310 Score = 35.5 bits (78), Expect = 0.058 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 14/55 (25%) Frame = +3 Query: 639 PPXXPPPXP------PPPPPXXXPP----XXPXPPPPP----XPXPPXPXPXAPP 761 PP PP P PPPPP PP PP PP P PP P PP Sbjct: 177 PPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPP 231 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P PPPP PP P P P PP APP Sbjct: 214 PSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPP 254 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 P PP PP PP P P P PP P P P S Sbjct: 253 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPS 294 Score = 35.5 bits (78), Expect = 0.058 Identities = 24/78 (30%), Positives = 26/78 (33%), Gaps = 8/78 (10%) Frame = +3 Query: 636 SPPXXPPP-------XPPPPPPXXXPPXXP-XPPPPPXPXPPXPXPXAPPXSXXXXXXXX 791 S P PP PPPPPP PP PPPPP P P P S Sbjct: 267 SAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKPSFTNGPVSNNIMDSKN 326 Query: 792 XXXXXXXXXSXXFXPPPQ 845 + PPP+ Sbjct: 327 SFECRFNFRTLNELPPPE 344 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 6/42 (14%) Frame = +3 Query: 651 PPPXPPPPPP------XXXPPXXPXPPPPPXPXPPXPXPXAP 758 PPP PPPP P PPPPP PP P P Sbjct: 53 PPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKP 94 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PP P P PP PP PPPPP P P P Sbjct: 210 PPLPPSRDQAPAPP---PPLNATPPPPPPSRDQVPLPPPP 246 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 9/57 (15%) Frame = +1 Query: 628 KXIPXPXXPXPXXPXPPPXXXPPXX-------PXPPXXX--PPXPPPXPPXPPXXPP 771 K P P P PPP PP P PP P PPP PP PP Sbjct: 179 KNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPP 235 Score = 32.3 bits (70), Expect = 0.54 Identities = 22/67 (32%), Positives = 26/67 (38%), Gaps = 2/67 (2%) Frame = +1 Query: 586 PYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXX--PXPPXXXPPXPPPXPPXPP 759 P R++ P + +P P P P PPP P P PP PP P PP Sbjct: 136 PSQRSLAPPPTGSSRPLPAPP-PGENRP-PPPMRGPTSGGEPPPPKNAPPPPKRGSSNPP 193 Query: 760 XXPPLXG 780 PP G Sbjct: 194 -PPPTRG 199 Score = 31.9 bits (69), Expect = 0.71 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 6/63 (9%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPP------XPPXPPXXPPLXGGVXGAP 798 P P PPP P P P P PPP PP PP P AP Sbjct: 211 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKP-PTSTRSAP 269 Query: 799 XTP 807 P Sbjct: 270 PPP 272 Score = 31.1 bits (67), Expect = 1.2 Identities = 23/78 (29%), Positives = 25/78 (32%), Gaps = 3/78 (3%) Frame = +1 Query: 583 VPYXRNVXXIPDKXXKXIPXPXXP-XPXXPXPPPXXXPPXXPXPPXXXPPXPP--PXPPX 753 +P R+ P P P P P PPP P PP P PP Sbjct: 212 LPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPP 271 Query: 754 PPXXPPLXGGVXGAPXTP 807 PP P G G P P Sbjct: 272 PPGRAPQPLG--GPPPPP 287 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 666 PPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PPPPP P PPP PP P P P Sbjct: 106 PPPPPHSRHGSAP-PPPERSSGPPPPPPGRGP 136 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PP PP PPP P P PP Sbjct: 210 PPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPP 245 Score = 29.5 bits (63), Expect = 3.8 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 13/58 (22%) Frame = +3 Query: 627 QXDSPPXXPPPXPPPPPPXXXPP-------XXPXPPPPP------XPXPPXPXPXAPP 761 Q PP PPP PPPP P PPPPP P PP PP Sbjct: 74 QGSFPP--PPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPP 129 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +3 Query: 651 PPPXP-----PPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PPP P PPP P PPPPP P APP Sbjct: 106 PPPPPHSRHGSAPPP---PERSSGPPPPPPGRGPSQRSLAPP 144 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 10/51 (19%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXP------PPXPPX----PPXXPPL 774 P P PPP P PP PP PP PP P PPL Sbjct: 176 PPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPL 226 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +1 Query: 673 PPPXXXPPXXPXPPXXXPPXPPPXPP----XPPXXPPLXGGVXGAP 798 PP P PP PPP PP P PPL G + P Sbjct: 210 PPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPP 255 Score = 28.3 bits (60), Expect = 8.7 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 8/50 (16%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXP--------PXXPXPPPPPXPXPPXPXPXAPPXS 767 P PP PPPP P P PPP P P P P S Sbjct: 153 PAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPS 202 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G GG G GGG GG GG GGG GGG GG Sbjct: 154 GGGMGGMMGG-GSMGGGMMSMAGGGMGGGMGGGMGGGMEGG 193 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG GGG G G G GG GG GGG GG Sbjct: 129 GGEGGMG-GGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGG 168 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 5/46 (10%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGG-----GGGXGGGXXGG 638 GG G G G GGG G G GG GGG GGG GGG GG Sbjct: 141 GGGMGGGMSMGGMGGGMG-GMMGGGSMGGGMMSMAGGGMGGGMGGG 185 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG GG GG G G GGG GG GG Sbjct: 179 GGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGG 219 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXG-GGGGGXGGGXXGG 638 GG G G GG G GGG G GG G G G GGG GG Sbjct: 175 GGGMGGGMGG-GMGGGMEGGMGGGMMEGMQGMGSMGGGMMGG 215 Score = 35.1 bits (77), Expect = 0.076 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = -1 Query: 760 GGAXGXGXGGXGX---GGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G G G GGG G GG GG GG GGG G Sbjct: 158 GGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMGGGMMEG 201 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXX---GGGGGGXGGGXXGG 638 GG G G G GG G G GG GGG GG GG GG Sbjct: 145 GGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGG 188 Score = 33.5 bits (73), Expect = 0.23 Identities = 23/70 (32%), Positives = 25/70 (35%) Frame = -3 Query: 842 GGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGX 663 G GG G G + GG GG G G GG G GG GGG G Sbjct: 130 GEGGMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGM-GGGMGG 188 Query: 662 XGXGXXGXGI 633 G G G+ Sbjct: 189 GMEGGMGGGM 198 Score = 32.3 bits (70), Expect = 0.54 Identities = 26/86 (30%), Positives = 31/86 (36%), Gaps = 3/86 (3%) Frame = -3 Query: 881 EXGKVVVXGGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXG--- 711 E G+ + GG +GGG G+ G G GG GG G G Sbjct: 128 EGGEGGMGGGMSMGGG-MGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGM 186 Query: 710 GXGXXGGXXXGGGXGXXGXGXXGXGI 633 G G GG G G G G G G+ Sbjct: 187 GGGMEGGMGGGMMEGMQGMGSMGGGM 212 Score = 31.9 bits (69), Expect = 0.71 Identities = 25/75 (33%), Positives = 26/75 (34%), Gaps = 1/75 (1%) Frame = -3 Query: 872 KVVVXGGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGG-XGXX 696 K + GG GGG G GG GG G GGG GG G Sbjct: 124 KQFIEGGEGGMGGGMSMGGGMGGGMSMGGMGGGMGGMMGG-GSMGGGMMSMAGGGMGGGM 182 Query: 695 GGXXXGGGXGXXGXG 651 GG GG G G G Sbjct: 183 GGGMGGGMEGGMGGG 197 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 G G G G G GGG G G GG GG GGG Sbjct: 204 GMGSMGGGMMGGGMGGGMG-FNGMEDGGKEGGMGGG 238 Score = 31.5 bits (68), Expect = 0.94 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 7/48 (14%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGG-GGGXG------GGXXGG 638 GG G GG G G G GG GGG GGG G GG GG Sbjct: 187 GGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGMEDGGKEGG 234 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G GG GG GG GG GGG GGG GG Sbjct: 41 GAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGG 81 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/52 (38%), Positives = 23/52 (44%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSCXIYQEXV 605 GG G G GG GGGG GG GG GGG G G+ + + V Sbjct: 49 GGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGGRGVFIARGKEDALVTKNLV 100 Score = 35.5 bits (78), Expect = 0.058 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGG-----XGGGXXGG 638 G G G G GGG G GG G GGGG GGG GG Sbjct: 33 GRPGFSPRGAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGG 77 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 773 RGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXG 666 RGG GG G G G GG G G GGG G Sbjct: 48 RGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGGRG 83 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 773 RGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXG 666 RGG GG G G G G GG G GGG G Sbjct: 44 RGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRG 79 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -1 Query: 742 GXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 G G G G G GG GGG GG GG G +S Sbjct: 33 GRPGFSPRGAGRGGGRGGPR-GGGRGGGRGGGGGFKS 68 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG G GGG G G GGGG GGG G Sbjct: 166 GGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYG 206 Score = 39.5 bits (88), Expect = 0.004 Identities = 24/67 (35%), Positives = 24/67 (35%) Frame = -3 Query: 842 GGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGX 663 GGGG G G RGG GG G G G GG G G GGG Sbjct: 141 GGGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYG 200 Query: 662 XGXGXXG 642 G G G Sbjct: 201 GGPGYGG 207 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXG-XXGGXXXGGGGGGXGGGXXGGESS 629 GG G G GG GG G G GG GGG G GGG G S Sbjct: 171 GGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGYGSYS 215 Score = 35.1 bits (77), Expect = 0.076 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 GG G GG GGG G G GG G GGG GG G S Sbjct: 152 GGYRGGYRGGRDRGGGYGGGGEGGY--GMGGGDYSGGCGYGSS 192 Score = 33.1 bits (72), Expect = 0.31 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGG-GGXGXXGGXXXGGGGGG---XGGGXXGG 638 G G GG GGG GG G GG GG G G GGG GG Sbjct: 157 GYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGG 201 Score = 31.5 bits (68), Expect = 0.94 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GG G G GG G GG GGG GG G G GG+ S Sbjct: 143 GGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMG--GGDYS 184 Score = 31.5 bits (68), Expect = 0.94 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGG-GXGGGXXGG 638 GG G G G GGG GG GGG G G G GG Sbjct: 179 GGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGYGSYSGGGGG 220 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/70 (25%), Positives = 27/70 (38%), Gaps = 1/70 (1%) Frame = -1 Query: 760 GGAXGXGXGGXGX-GGGGGXGXXGGXXXGGGGGGXGGGXXGGESSCXIYQEXVXHFLXRV 584 G G GG G GGG G G G GGGG G ++ + + ++ Sbjct: 186 GCGYGSSYGGGGDYGGGPGYGGGQGYGSYSGGGGGNYDYQGNKTLHHLIDRRLLDVHSKM 245 Query: 583 HTQRVYYTIC 554 H + + +C Sbjct: 246 HKEALLVFLC 255 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PPPPPP P PPPPP P P P PP Sbjct: 301 PPPPPPTDFAP----PPPPPEPTSELPPPPPPP 329 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +3 Query: 651 PPPXPPPP---PPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PPP PPPP P PPPPP P P P P Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEP 318 Score = 37.9 bits (84), Expect = 0.011 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPP 722 PP P PPPPP P PPPPP Sbjct: 302 PPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +3 Query: 639 PPXXPPPX--PPPPPPXXXPPXXPXPPPPPXP 728 PP PP PPPPPP P PPPPP P Sbjct: 301 PPPPPPTDFAPPPPPPE---PTSELPPPPPPP 329 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 11/49 (22%) Frame = +1 Query: 658 PXXPXPPPXXXP---------PXXPXPPXXXPPXPPPXP--PXPPXXPP 771 P P PPP P P P P PP PPP P PP PP Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPP 328 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +1 Query: 619 KXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 K IP P PPP P PP PPP PP PP Sbjct: 266 KGHPPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPP 316 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 672 PPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PPP PP P PPPPP P P P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPP 737 PPP PPPP PP P PPPPP P Sbjct: 73 PPPLCAPPPP---PPPPPPPPPPPGAKKP 98 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXA 755 PP PP PPPPPP P PPPP P P A Sbjct: 74 PPLCAPPPPPPPPP-------PPPPPPGAKKPDDPVANA 105 Score = 34.7 bits (76), Expect = 0.10 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 709 PPXXXPPXPPPXPPXPPXXP 768 PP PP PPP PP PP P Sbjct: 74 PPLCAPPPPPPPPPPPPPPP 93 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 PPP PP P PP PP PPP P P Sbjct: 73 PPPLCAPPPPPPPP---PPPPPPPGAKKPDDP 101 Score = 34.3 bits (75), Expect = 0.13 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 709 PPXXXPPXPPPXPPXPPXXPP 771 PP P PPP PP PP PP Sbjct: 73 PPPLCAPPPPPPPPPPPPPPP 93 Score = 34.3 bits (75), Expect = 0.13 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 636 SPPXXPPPXPPPPPP 680 +PP PPP PPPPPP Sbjct: 78 APPPPPPPPPPPPPP 92 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXPP 738 P P PPP PP P PP P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 733 PPPXPPXPPXXPPLXG 780 PPP PP PP PP G Sbjct: 79 PPPPPPPPPPPPPPPG 94 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 39.9 bits (89), Expect = 0.003 Identities = 26/69 (37%), Positives = 26/69 (37%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG GG R GV G GG G GG GGG GG GG G G Sbjct: 206 GGKAFLNGGVGGRSVWNGVPGGFGG----GGGVWGNGGGGGGGGGYSGGGSGNPHYYACG 261 Query: 677 GGXGXXGXG 651 GG G G Sbjct: 262 GGGGSYNSG 270 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/39 (51%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -1 Query: 742 GXGGXGXGGG--GGXGXXGGXXXGGGGGGXGGGXXGGES 632 G GG G GG G GG GGGGG GGG GG S Sbjct: 214 GVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGGGS 252 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = -1 Query: 760 GGAXGXGXGGXGXGG--GGGXGXXGGXXXGGGGGGXGGGXXGGESSC 626 GG G G GG G GG GGG G GGGGG G C Sbjct: 232 GGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGGSYNSGSDQRAECC 278 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGG-GGGXGXXGGXXXGGGGGGXGGGXXG 641 GG G GG GGG G G GGGGGG GG G Sbjct: 213 GGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGGGSG 253 Score = 36.7 bits (81), Expect = 0.025 Identities = 25/73 (34%), Positives = 27/73 (36%) Frame = -3 Query: 854 GXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGG 675 G G GG+ + G G R G GG GGG G GG G GG GG Sbjct: 197 GGAYGPGGEGGKAFLNGGVGG------RSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGG 250 Query: 674 GXGXXGXGXXGXG 636 G G G G Sbjct: 251 GSGNPHYYACGGG 263 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 7/48 (14%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGG-------GGXGGGXXGG 638 G G G GG G GGG G GG GG G GG GG G Sbjct: 223 GVPGGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGGSYNSG 270 Score = 33.5 bits (73), Expect = 0.23 Identities = 25/52 (48%), Positives = 25/52 (48%), Gaps = 9/52 (17%) Frame = -1 Query: 760 GGAXGXGX-GGXGX--GGGGGX----GXXGGXXXGGG--GGGXGGGXXGGES 632 GGA G G GG GG GG G GG GGG G G GGG GG S Sbjct: 197 GGAYGPGGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYS 248 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 672 PPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PPP PP P PPPPP P P P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPP 737 PPP PPPP PP P PPPPP P Sbjct: 274 PPPLCAPPPP---PPPPPPPPPPPGAKKP 299 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXA 755 PP PP PPPPPP P PPPP P P A Sbjct: 275 PPLCAPPPPPPPPP-------PPPPPPGAKKPDDPVANA 306 Score = 34.7 bits (76), Expect = 0.10 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 709 PPXXXPPXPPPXPPXPPXXP 768 PP PP PPP PP PP P Sbjct: 275 PPLCAPPPPPPPPPPPPPPP 294 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 PPP PP P PP PP PPP P P Sbjct: 274 PPPLCAPPPPPPPP---PPPPPPPGAKKPDDP 302 Score = 34.3 bits (75), Expect = 0.13 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 709 PPXXXPPXPPPXPPXPPXXPP 771 PP P PPP PP PP PP Sbjct: 274 PPPLCAPPPPPPPPPPPPPPP 294 Score = 34.3 bits (75), Expect = 0.13 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 636 SPPXXPPPXPPPPPP 680 +PP PPP PPPPPP Sbjct: 279 APPPPPPPPPPPPPP 293 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXPP 738 P P PPP PP P PP P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 733 PPPXPPXPPXXPPLXG 780 PPP PP PP PP G Sbjct: 280 PPPPPPPPPPPPPPPG 295 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G G GG GG GG G G GG GGG GG+ Sbjct: 55 GGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGD 95 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXG-GXXXGGGXGXXGXGXXGXG 636 G G GG GGG GG G G G G GGG G G G G Sbjct: 56 GDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGG 101 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG GG G G GG GG G GGG GGG G + Sbjct: 55 GGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDD 96 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 + GGA G G GG GGG G G GGG GG GG Sbjct: 61 DDGGAGG-GAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = -1 Query: 748 GXGXGGXGXG--GGGGXGXXGGXXXGGG--GGGXGGGXXGG 638 G G GG G GG G G G GGG G G GGG GG Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGG 91 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPL 774 P P P PP P P P PPP PP PP P + Sbjct: 286 PMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAM 324 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = +3 Query: 639 PPXXPPPX----PPPPPPXXXPPXXPXPPPPPXPXPPXP 743 PP PPP PPP PP PPPPP P P P Sbjct: 285 PPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLP-PAMP 322 Score = 35.5 bits (78), Expect = 0.058 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PP PPP PP P P P PP P P P Sbjct: 285 PPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPP 319 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P P PP P P PP PP PP Sbjct: 297 PPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPP 341 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPP----PXPXPPXPXPXAPP 761 DS P P P PPP P PP P P P PP P P A P Sbjct: 277 DSVNKAPVP-PMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMP 322 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 636 SPPXXPPPXPPPPPP---XXXPPXXPXPPPPPXP 728 SP PPP PP P PP PPPPP P Sbjct: 308 SPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPP 341 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 7/45 (15%) Frame = +3 Query: 636 SPPXXPP----PXPPPPPPXXXPPXXPXPP---PPPXPXPPXPXP 749 +PP PP P PPPP PP P PP PP P P Sbjct: 296 APPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPP 340 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 676 PPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPL 774 PP PP P PP P P PP PPL Sbjct: 285 PPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPL 317 Score = 30.3 bits (65), Expect = 2.2 Identities = 22/76 (28%), Positives = 22/76 (28%) Frame = +1 Query: 580 YVPYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPP 759 YVP D K P P P PP PP PP PP P P Sbjct: 265 YVPPGSATYESMDSVNKAPVPPMTPPPAVVTAPPPA-PPLPNFTSPSPPPPPPLPPAMPA 323 Query: 760 XXPPLXGGVXGAPXTP 807 L V P P Sbjct: 324 MDDLLPPEVLSPPPPP 339 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 6/47 (12%) Frame = +3 Query: 639 PPXXPPPXPPPPPP---XXXPPXXPXPPPPP---XPXPPXPXPXAPP 761 PP P PPPPP P P P PP P P PP Sbjct: 329 PPEVLSPPPPPPPSEDFYSMPSSLPMPSPPEDLYDAPATLPSPIMPP 375 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXXP-XPPXXXPPXPPPXP 747 +P P P P P P P PP P PPP P Sbjct: 303 LPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPP 341 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 714 PPPXPXPPXPXPXAPPXS 767 PPP P PP P PP S Sbjct: 245 PPPPPVPPPTIPSVPPGS 262 >SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = -1 Query: 733 GXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G GGG G GG GG GG GGG GG+ Sbjct: 9 GDGEGGGDGGDSGGGSDGGGDGGDGGGGSDGGD 41 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G GG G GG GG GGGG GG G + Sbjct: 9 GDGEGGGDGGDSGGGSDGGGDGGDGGGGSDGGDGEGDD 46 Score = 35.1 bits (77), Expect = 0.076 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG G GG GGG G G GG GG G G G G+ Sbjct: 13 GGGDGGDSGGGSDGGGDG-GDGGGGSDGGDGEGDDDGDGEGD 53 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG+ G G GG G GGG G G G G G G G + Sbjct: 22 GGSDGGGDGGDG-GGGSDGGDGEGDDDGDGEGDDDGDGEGDD 62 >SB_53480| Best HMM Match : Sigma70_r1_1 (HMM E-Value=5.7) Length = 402 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -1 Query: 757 GAXGXGXG-GXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 G G G G G G G G G G G GGGGGG G G E S Sbjct: 62 GDDGDGDGDGDGDGDGDGDGDGDGDGDGGGGGGGDGDGDGDELS 105 >SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG--GESS 629 GG G G G G GGG G G GG GGG GG G GE+S Sbjct: 397 GGYRGRGGRGGYRGRGGGRGYYRGGRGGGRGGGGRGGRGGLRGEAS 442 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = -3 Query: 773 RGGXXGGXGGXGG--GXGGXXXGGXGXXGGXXXGGGXGXXG 657 RGG G GG GG G GG G GG GGG G G Sbjct: 396 RGGYRGR-GGRGGYRGRGGGRGYYRGGRGGGRGGGGRGGRG 435 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/67 (32%), Positives = 24/67 (35%) Frame = -3 Query: 836 GGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXG 657 GG + G G + G G GG GGG GG G GG GGG G Sbjct: 195 GGSIEKGWVGGRAGGMNSGYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHS 254 Query: 656 XGXXGXG 636 G G Sbjct: 255 GQAGGGG 261 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSC 626 GG G GGGGG G G GG GG GG SSC Sbjct: 227 GGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGGSYCGG-SSC 270 Score = 35.9 bits (79), Expect = 0.044 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 5/55 (9%) Frame = -3 Query: 806 GVXGAPXTPPXRGGXXGGXGGX-----GGGXGGXXXGGXGXXGGXXXGGGXGXXG 657 G G P P GG GG GG GG GG GG G G GGG G Sbjct: 213 GYNGGP-APGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGGSYCG 266 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/43 (41%), Positives = 20/43 (46%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 GG GG G GGGGG G GGG G G G G++ Sbjct: 216 GGPAPGAVGGFG-GGGGGSEDNGASGGGGGYSGGGSGTHSGQA 257 Score = 31.5 bits (68), Expect = 0.94 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXX-GGGGGGXGGGXXGGESS 629 GG GG G GG G GG G GG GG GG + Sbjct: 208 GGMNSGYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGT 252 Score = 31.5 bits (68), Expect = 0.94 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 767 GXXGGXGGXGGGXGGXXXGGXGXXGGXXXGG 675 G GG GG GG G G G GG GG Sbjct: 237 GASGGGGGYSGGGSGTHSGQAGGGGGSYCGG 267 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/46 (41%), Positives = 21/46 (45%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 E GG+ G G G GG G GG G GG GGG G E + Sbjct: 193 ERGGSIEKGWVG-GRAGGMNSGYNGGPAPGAVGG-FGGGGGGSEDN 236 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGG 653 E GA G GG G GGG G G GGGG GG Sbjct: 234 EDNGASG---GGGGYSGGGS-GTHSGQAGGGGGSYCGG 267 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +3 Query: 627 QXDSPPXXPPPXPPPPPPXXXPPXXPXPPP--PPXPXPPXPXPXAPP 761 Q P PP PP P PP P PPP P P P P PP Sbjct: 2601 QLPPPDMFPPQMMPPMVPMMLPPMLPLPPPGLPMQPEAPVQPPPLPP 2647 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 3/52 (5%) Frame = +1 Query: 613 PDKXXKXIPXPXXPX---PXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPP 759 PD + P P P P PPP P P P PP PPP P PP Sbjct: 2605 PDMFPPQMMPPMVPMMLPPMLPLPPPGL--PMQPEAPVQPPPLPPPGGPFPP 2654 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXG 780 P P P P PP P PP P P P PP PP G Sbjct: 2604 PPDMFPPQMMPPMVPMMLPPMLPLPPPGLP-MQPEAPVQPPPLPPPGG 2650 Score = 31.5 bits (68), Expect = 0.94 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 2/59 (3%) Frame = +1 Query: 598 NVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXP--PXXXPPXPPPXPPXPPXXP 768 N PD+ + P PPP PP P P PP P PP P P Sbjct: 2578 NAAMSPDRRWPIVAPMQPPFFGPQLPPPDMFPPQMMPPMVPMMLPPMLPLPPPGLPMQP 2636 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 P PPPPP PP PPPP PP P P Sbjct: 79 PFPPPPPIYMPPPPVYMPPPPVYMPPPMPMGDVP 112 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 PP PPP PPPP PP P PPP P P Sbjct: 81 PP--PPPIYMPPPPVYMPP-PPVYMPPPMPMGDVP 112 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P P P P PPPPP PP P PP Sbjct: 59 PSCAPSYQPSCCQQQQPMMMPFPPPPPIYMPPPPVYMPPP 98 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 694 PXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P PP PP P PP P PP Sbjct: 79 PFPPPPPIYMPPPPVYMPPPPVYMPP 104 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPP 759 P PPP PP PP PP P PP P Sbjct: 81 PPPPPIYMPP----PPVYMPPPPVYMPPPMP 107 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/42 (30%), Positives = 14/42 (33%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPP 759 +P P P PP P P P P PP PP Sbjct: 271 VPPPIEHRPHHRPFPPAVHAPYHPPPAYSNPTYQPPASTYPP 312 >SB_51557| Best HMM Match : Collagen (HMM E-Value=0.56) Length = 697 Score = 39.1 bits (87), Expect = 0.005 Identities = 26/83 (31%), Positives = 29/83 (34%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG + GGG G+ G G GG G GG G G GG G Sbjct: 443 GGRGMRGGGMPNMDGFGGMEGGMNGIVGMNGMGGGANGMAGGMNGMGGGMDDMAGG--MG 500 Query: 677 GGXGXXGXGXXGXGIXLXYLSGM 609 GG G G G L + GM Sbjct: 501 GGMNGMGAGMNAMGGGLNGIGGM 523 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PP PP P P PPP P P PP PP Sbjct: 218 PPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPPGAGGMRPP 258 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGG 783 P PPP PP PP PP P PP P PP G Sbjct: 212 PPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPPGAG 253 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXP 756 P P PPP PP P P P P PP P Sbjct: 213 PGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPP 250 Score = 29.9 bits (64), Expect = 2.9 Identities = 24/97 (24%), Positives = 26/97 (26%), Gaps = 1/97 (1%) Frame = +1 Query: 535 WFSXTAHILYSXHAVYVPYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPP 714 W A L N P+ +P P P PP P P PP Sbjct: 183 WMEEQAQTLIDQTTAAFQSKPNSQMPPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPP 242 Query: 715 XX-XPPXPPPXPPXPPXXPPLXGGVXGAPXTPXXXLR 822 PP P PP GG P LR Sbjct: 243 PGPIPPPPGAGGMRPPHGQMHMGGPRPQMGRPPMSLR 279 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/69 (33%), Positives = 26/69 (37%) Frame = -3 Query: 881 EXGKVVVXGGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXG 702 E GK + GG GG+ + G G P GG GG GG GG G G Sbjct: 447 EGGKSFLAGG----AGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCG 502 Query: 701 XXGGXXXGG 675 GG G Sbjct: 503 GGGGSYNAG 511 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 GGA G GG GG G G GGGGG GGG GG S Sbjct: 455 GGAGGRSNQNDVEGGFGGGGGPNG---AGGGGGGGGGYSGGAS 494 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GG G GG G GGGG G G GGG G G + S Sbjct: 472 GGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGGSYNAGSDKS 515 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 6/45 (13%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGG------XXXGGGGGGXGGG 650 E G G G G G GGGGG G GG GGGGG G Sbjct: 467 EGGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGGSYNAG 511 Score = 35.5 bits (78), Expect = 0.058 Identities = 24/73 (32%), Positives = 26/73 (35%), Gaps = 5/73 (6%) Frame = -3 Query: 854 GXXLGGGGKXXRRXXXG-VXGAPXTPPXRGGXXGGXG----GXGGGXGGXXXGGXGXXGG 690 G G GG+ + G G GG GG G G GGG GG GG Sbjct: 439 GGSRGTGGEGGKSFLAGGAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGGASGSRS 498 Query: 689 XXXGGGXGXXGXG 651 GGG G G Sbjct: 499 NSCGGGGGSYNAG 511 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 G GG G G GG G GG GG G GG S Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGGS 507 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 749 GGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 GG GGG G GG G GG GG G G G Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGG 505 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGG-GXGGGXXGG 638 GG G G GG G GGGG G GGG GG Sbjct: 445 GGEGGKSFLAGGAGGRSNQNDVEGGFGGGGGPNGAGGGGGGG 486 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = -1 Query: 760 GGAXGXGX-GGXGX--GGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG+ G G GG GG GG G GGGG G GG Sbjct: 439 GGSRGTGGEGGKSFLAGGAGGRSNQNDVEGGFGGGGGPNGAGGG 482 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 652 PXPXXPX---PPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P PPP PP PP PP PPP P PP Sbjct: 199 PYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPP 241 Score = 36.7 bits (81), Expect = 0.025 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 PPP PPP P P PPPPP P P Sbjct: 209 PPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPP 241 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPP---PPPXPXPPXPXPXAPP 761 S P P PPP PP PP PPP P P P PP Sbjct: 197 SGPYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPP 241 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = +3 Query: 633 DSPPXXPP----PXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 D PP PP P PPP P P P P P PP P PP Sbjct: 454 DEPPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPP 500 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/43 (44%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +3 Query: 642 PXXPPPXPPP-PPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 P P PPP PP PP P P PP P PP P +P S Sbjct: 449 PPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPP-ELPGSPGDS 490 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +3 Query: 639 PPXXPPPXPP---PPPPXXXPPXXPXPPPPPXPXPPXPXPXA 755 P PPP PP PPP P P P PP P P P A Sbjct: 452 PSDEPPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPA 493 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/58 (37%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = +1 Query: 628 KXIPXPXXPXPXXPXPP-PXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAP 798 K P P PP P PP P PP P PPP P PP PL + G+P Sbjct: 434 KIAPLPSLRASAATLPPLPSDEPP--PLPPDEEKPPPPPAPALPPL--PLPPELPGSP 487 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXP----PPXPPXPPXXPPL 774 P P P PP PP P P PP PP PP PPL Sbjct: 467 PPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPPKHSNGPPL 511 Score = 35.5 bits (78), Expect = 0.058 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPP-XPPXXPPL 774 P P P P PPP P P PP P P PP P PPL Sbjct: 456 PPPLPPDEEKPPPPPAPALPPLPLPP-ELPGSPGDSPPATSPKQPPL 501 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/62 (27%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = +1 Query: 589 YXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXP-PXPPPXPPXPPXX 765 + + +P P P P PP P P P P P PP P P Sbjct: 431 HNEKIAPLPSLRASAATLPPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDS 490 Query: 766 PP 771 PP Sbjct: 491 PP 492 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PPP P PP PP P P P P PP Sbjct: 467 PPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPP 503 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 1/44 (2%) Frame = +3 Query: 633 DSPPXXPPPXPP-PPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 DSPP P PP PP PP P P P P Sbjct: 489 DSPPATSPKQPPLPPKHSNGPPLRQTPMSSSLSATPVSTPDTTP 532 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 2/43 (4%) Frame = +3 Query: 639 PPXXP--PPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P PP P PP P P P P P PP Sbjct: 468 PPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPPKHSNGPP 510 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 38.7 bits (86), Expect = 0.006 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPP 722 PP PPP PP PP PPPPP Sbjct: 276 PPGMPPPMPPGGMPPNMEQPPPPP 299 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = +3 Query: 639 PPXXPPPXPPPPP--PXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PPP PPP P P PPP P PP P PP Sbjct: 249 PPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMP-PPMPPGGMPP 290 Score = 35.5 bits (78), Expect = 0.058 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPP--PPXPXP---PXPXPXAPP 761 PP PP P PP PP PPP PP P P P PP Sbjct: 236 PPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPP 281 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +3 Query: 639 PPXXPPPXPPP----PPPXXXPPXXPXPPPPPXPXPPXPXP 749 PP PP P PPP PP P PP PP P P Sbjct: 260 PPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPPP 300 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXP-PXPXPXAPP 761 PP PP PP PP PPP P P P P PP Sbjct: 224 PPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPP 265 Score = 33.1 bits (72), Expect = 0.31 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 8/57 (14%) Frame = +1 Query: 634 IPXPXXPXPXXPXPP---PXXXPPXXPXPPXXXPPXPPPX--PPX---PPXXPPLXG 780 +P P P P PP P P PP PP PP PP PP PP G Sbjct: 247 MPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPPPSSG 303 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 PP PP P PP P P PP P P PP S Sbjct: 259 PPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPPPS 301 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = +3 Query: 633 DSPPXXP----PPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 D+PP PP PP PP PPP P P P P P Sbjct: 213 DAPPIQTSTSLPPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMP 259 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/59 (30%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXP-PXPPPXPPXPPXXPPLXGGV 786 P + +P P PP PP PP P P P P PP P GG+ Sbjct: 216 PIQTSTSLPPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGM 274 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAP 798 P P P P PP PP P P P PPP P PP+ G P Sbjct: 2164 PSPLGAPPSVP--PPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPP 2215 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/49 (40%), Positives = 21/49 (42%), Gaps = 5/49 (10%) Frame = +3 Query: 636 SPPXXPPP---XPPPPPPXXXPPXXPXP--PPPPXPXPPXPXPXAPPXS 767 +PP PPP P PPP PP P P PP P P PP S Sbjct: 2169 APPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPPS 2217 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +1 Query: 637 PXPXXPXPXXPX-PPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXG 780 P P P P P P PP P PP PP PP PP PP G Sbjct: 2151 PPPMGPARHSPSGPSPLGAPPSVP-PPMGAPPSGPPPMGAPPSGPPPMG 2198 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/55 (38%), Positives = 22/55 (40%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAP 798 +P P P P PP PP P PP PP P PP PP G AP Sbjct: 2173 VPPPMGAPPSGP--PPMGAPPSGP-PPMGTPPSGHPPMGAPPMGPPPSGSHSPAP 2224 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 5/47 (10%) Frame = +3 Query: 636 SPPXXPPPXPPP--PPPXXXPPXXPXPP-PPPXPXPP--XPXPXAPP 761 SP PP PPP PP PP P PPP PP P APP Sbjct: 2165 SPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPP 2211 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = +1 Query: 637 PXPXXPXPXXPXPP--PXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAP 798 P P P PP P P P P P PPP P PP+ G P Sbjct: 2140 PPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPP 2195 Score = 33.5 bits (73), Expect = 0.23 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPP-XPPPXPPXPPXXPPLXGGVXGAP 798 P P P P PP PP PP PP P P PP GAP Sbjct: 2156 PARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAP 2210 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +3 Query: 636 SPPXXPPPXPPP--PPPXXXPPXXPXP--PPPPXPXPPXPXPXAPP 761 SP P PP PPP PP P P PP P P P P Sbjct: 2160 SPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHP 2205 Score = 28.7 bits (61), Expect = 6.6 Identities = 24/90 (26%), Positives = 25/90 (27%), Gaps = 12/90 (13%) Frame = +3 Query: 642 PXXPPPXPPP-------PPPXXXP----PXXPXP-PPPPXPXPPXPXPXAPPXSXXXXXX 785 P P PPP PPP P P P P PP PP P + P Sbjct: 2133 PARPAMGPPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPS 2192 Query: 786 XXXXXXXXXXXSXXFXPPPQXXPPXHHHFP 875 PP PP H P Sbjct: 2193 GPPPMGTPPSGHPPMGAPPMGPPPSGSHSP 2222 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXP-PPPPXPXPPXPXP 749 PP PP P PPP P P P PPP PP P Sbjct: 22 PPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQP 59 Score = 35.1 bits (77), Expect = 0.076 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 1/58 (1%) Frame = +1 Query: 637 PXPXXPXPXXP-XPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P P P PPP P P P P PP P PP+ P P Sbjct: 20 PKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPP 77 Score = 35.1 bits (77), Expect = 0.076 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPP--XPPPXPPXPP 759 P K P P P P PP P PP PP PP P PP Sbjct: 27 PPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPP 77 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PP P PP P PP P PP P P P P Sbjct: 22 PPQPTPPKPDTPPPGTNIPTPPS-PNTPPPVTQPP 55 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = +3 Query: 642 PXXPPPXPPPP---PPXXXPPXXPXP-PPPPXPXPPXPXPXAP 758 P P P PPP PP PP P PP PP P +P Sbjct: 40 PTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPPVTQSP 82 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P PP PP P PPP P P P PP Sbjct: 14 PVDQATPKPPQPTPPK-PDTPPPGTNIPTPPSPNTPP 49 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 6/42 (14%) Frame = +3 Query: 642 PXXPPPXPPPP---PPXXXPPXXPXP---PPPPXPXPPXPXP 749 P PPP PP PP PP P PPPP P P Sbjct: 45 PNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPPVTQSPEQEP 86 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 5/46 (10%) Frame = +3 Query: 639 PPXXPPPXPP---PPPPXXXPP--XXPXPPPPPXPXPPXPXPXAPP 761 P P PP PP P PP P PP P P P P P Sbjct: 14 PVDQATPKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQP 59 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPP 737 P PPP P PPP PP P P P P P Sbjct: 429 PSHPPPLPQPPPSIIPPPTTPLPQTVPTPPRP 460 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P PPP P P P PP P P P P PP Sbjct: 423 PPGGGVPSHPPPLPQPPPSIIP-PPTTPLP-QTVPTPPRPP 461 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPP 741 P P P PP PP P P P PP Sbjct: 429 PSHPPPLPQPPPSIIPPPTTPLPQTVPTPPRPP 461 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +3 Query: 636 SPPXXPPPXPP---PPPPXXXPPXXPXPPPPP 722 S P P PP PPP P P PP PP Sbjct: 430 SHPPPLPQPPPSIIPPPTTPLPQTVPTPPRPP 461 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 P P P PP PP PP PP P P PP P P Sbjct: 1355 PSTPRPRPPTPP---RPPTPRPRPPTPRPGPPTPRP 1387 Score = 35.1 bits (77), Expect = 0.076 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPP-PXPXPPXPXPXAPPXS 767 P P P PP P PP P P P P P P P S Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTPRPS 1388 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPP 741 P P P P P PP P P P PP P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXP 756 P P P P P P P P PP P P PP P Sbjct: 1353 PIPSTPRPRP--PTPPRPPTPRPRPPTPRPGPPTP 1385 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 673 PPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P PP PP P P PP P PP Sbjct: 1353 PIPSTPRPRPPTPPR--PPTPRPRPPTPRPGPP 1383 Score = 32.7 bits (71), Expect = 0.41 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXP 728 +P PP P PP P PP PP P P Sbjct: 1357 TPRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 31.5 bits (68), Expect = 0.94 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPPPPXPXP 734 P PP P P PP PP P P P Sbjct: 1578 PPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 P PPPP P P PP P P P Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +3 Query: 678 PXXXPPXXPXPP--PPPXPXPPXPXPXAP 758 P PP P PP PPP PP P P Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPP 716 +PP P P PPP PP P P Sbjct: 1577 TPPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = +1 Query: 679 PXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXT 804 P PP P PP PP P P P P G + + T Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPPRPETP-EPQYRGNIDTSTVT 1615 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 +PP PP PP P P P PP P Sbjct: 1651 TPPTTDPPRPPVTVTPKPSTDAPLPASTSRPQPPVP 1686 >SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) Length = 487 Score = 38.3 bits (85), Expect = 0.008 Identities = 25/74 (33%), Positives = 26/74 (35%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG GGG R G G P + G G GG GG GG G G G Sbjct: 198 GGPGFGGG--PMRGGPMGGRGGPRGRGMQRGRGGPRGGGRGGFGGDFGGDGGRFDASNMG 255 Query: 677 GGXGXXGXGXXGXG 636 G G G G G Sbjct: 256 GATGGTGNMFGGVG 269 Score = 28.3 bits (60), Expect = 8.7 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G GG G G G G GGG GG GG GG+ Sbjct: 205 GPMRGGPMGGRGGPRGRGMQRGRGGPRGGGRGG-FGGDFGGD 245 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -1 Query: 760 GGAXGXGXGGX-GXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG G G GGG G G G G GG G GG Sbjct: 13 GGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGG 54 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGG---GXGGGXXGG 638 G G G G GGG G G GG G GGG G GGG G Sbjct: 4 GPGGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRG 43 Score = 37.1 bits (82), Expect = 0.019 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -1 Query: 757 GAXGXGXGGX-GXGGGGGXGXXGGXXXGGG-GGGXGGGXXGG 638 G G G GG G G GGG G G G G GGG G G GG Sbjct: 6 GGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGG 47 Score = 37.1 bits (82), Expect = 0.019 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -1 Query: 760 GGAXGXGXG-GXGXGGGGGXGXXGGXXXGGGGG-GXGGGXXGG 638 G G G G G G GGG G G GG G GGG G G G G Sbjct: 7 GWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWG 49 Score = 37.1 bits (82), Expect = 0.019 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -1 Query: 760 GGAXGXGXGGX-GXGGGGGXGXXGGXXXGG-GGGGXGGGXXGG 638 GG G G GG G G GGG G G G GGG G G GG Sbjct: 21 GGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGG 63 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -1 Query: 760 GGAXGXGXGGX-GXGGGGGXGXXGGXXXG-GGGGGXGGGXXGG 638 GG G G GG G G GGG G G G G GGG G GG Sbjct: 29 GGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGG 71 Score = 34.7 bits (76), Expect = 0.10 Identities = 25/74 (33%), Positives = 26/74 (35%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG G GG R G+ P R G G GGG G GG G G Sbjct: 38 GGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQEGGMG 97 Query: 677 GGXGXXGXGXXGXG 636 G G G G G G Sbjct: 98 RGPG-QGWGCRGMG 110 >SB_14698| Best HMM Match : E1_DerP2_DerF2 (HMM E-Value=4.1e-31) Length = 167 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/68 (30%), Positives = 29/68 (42%), Gaps = 2/68 (2%) Frame = +2 Query: 230 CHLKKGKNAKVSFDFTPQFSTTKLKTGLFGLKNGAEIPFDALYNADACTL--TSCPTEAG 403 C KG N F P + +FG+ G ++PF L N + C CP AG Sbjct: 48 CTFHKGSNETCKATFVPNELVSSATIEVFGIIGGVQVPF-PLKNPNVCENHGVKCPINAG 106 Query: 404 KTQTLDFS 427 + TLD + Sbjct: 107 DSATLDLN 114 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXP---PXXPXPP---PPPXPXPPXPXPXAPPXS 767 D+P PP P PP P P P PP PPP P P P PP S Sbjct: 1322 DNPANYVPPWELPLPPSGLPLPLPRLPLPPLRLPPPHSRLPLPPPKLPPPS 1372 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +1 Query: 616 DKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 D +P P P P P P P PP PP P PP PP Sbjct: 1322 DNPANYVPPWELPLPPSGLPLPL---PRLPLPPLRLPPPHSRLPLPPPKLPP 1370 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +3 Query: 639 PPXXPPPXP--PPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 P P P P P PP PP P PPP PP P Sbjct: 1337 PSGLPLPLPRLPLPPLRLPPPHSRLPLPPPKLPPPSRIP 1375 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXP 747 +P P P P PPP P P P PP P P Sbjct: 1342 LPLPRLPLPPLRLPPPHSRLPLPP--PKLPPPSRIPLP 1377 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXP 734 PP P PPPP P P PPPPP P Sbjct: 415 PPWQTTPGYIPPPPPGFPQFQPPPPPPPSDAP 446 Score = 36.3 bits (80), Expect = 0.033 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 PPP PPPP P P PP P P P Sbjct: 322 PPPSQAPPPPKTIPSTLPPPPVPSATSAPPP 352 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXP---XPPXXXPPXPPPXPPXPPXXPP 771 P P P P PP P P P PP PP P P PP Sbjct: 393 PGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPP 440 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 5/50 (10%) Frame = +1 Query: 634 IPXPXXPXPXX----PXPPPXXXPPXX-PXPPXXXPPXPPPXPPXPPXXP 768 +P P P P P PP P P PP P PP PP P P Sbjct: 397 LPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPPSDAP 446 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PPPP P PPP P PP P P Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLP 339 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P PPP PP P PP PP P PP Sbjct: 310 PAASEPAAFAPAPPPSQAPPPPKTIPSTLPP--PPVPSATSAPPP 352 Score = 31.5 bits (68), Expect = 0.94 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 9/53 (16%) Frame = +3 Query: 636 SPPXXPPPXPPPPPP------XXXPPXXPXP---PPPPXPXPPXPXPXAPPXS 767 S P P PPPP P PP P PPPP P P PP S Sbjct: 391 SKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPPS 443 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PPPP P PPPP P P PP Sbjct: 376 PPGAGNGPGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPP 416 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 S P PP PP P P P P P P P PP Sbjct: 365 STPVQRPPGMRPPGAGNGPGGPPPPWSKPGGILPGPPPPGPP 406 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 5/40 (12%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPX--PPPP---PXPXPPXPXPXA 755 PPP P P P PPPP P PP P P A Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSA 346 Score = 29.1 bits (62), Expect = 5.0 Identities = 18/70 (25%), Positives = 19/70 (27%), Gaps = 1/70 (1%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXP-PXPXPXAPPXSXXXXXXXXXXXXXXXXXSXX 827 PPP P P PPPP P P P P + S Sbjct: 308 PPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMSTP 367 Query: 828 FXPPPQXXPP 857 PP PP Sbjct: 368 VQRPPGMRPP 377 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXP 710 PP P PPPPPP P P Sbjct: 428 PPGFPQFQPPPPPPPSDAPWIERP 451 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/46 (41%), Positives = 22/46 (47%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 + GG G G GG G GGGGG G G G G G+ + Sbjct: 318 DDGGGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGN 363 Score = 35.1 bits (77), Expect = 0.076 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG G G GG G GGG G G G G G G+ Sbjct: 324 GGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGNGD 365 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 11/53 (20%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGX-----------GXXGGXXXGGGGGGXGGGXXGGE 635 GG G G GG G GGGGG G G G G G G G+ Sbjct: 322 GGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGNGDDDDGDGDGD 374 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGG 672 GG GG GG GGG GG G G G Sbjct: 324 GGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNG 356 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXG 666 GG GG GG GGG GG G G G Sbjct: 322 GGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNG 356 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +3 Query: 636 SPPXXPPPXPPPPPP---XXXPPXXPXPPPPPXP 728 SPP PP PPPP P PP P PPP P Sbjct: 510 SPPPPPPASPPPPLPAEEDNSPPPLPAGPPPDEP 543 Score = 35.1 bits (77), Expect = 0.076 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 PPP PP PP P PPP PP P Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLPAGPPPDEP 543 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPL 774 P PPP PP P P PPP P PP P+ Sbjct: 511 PPPPPPASPP--PPLPAEEDNSPPPLPAGPPPDEPM 544 Score = 32.7 bits (71), Expect = 0.41 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PPPPP PP P P P P P P Sbjct: 512 PPPPPASPPPPLPAEEDNSPPPLPAGPPPDEP 543 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPP 750 P P P PP P P P PPP P Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLPAGPPPDEP 543 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXX---PXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P PP P P PP PP PP PP PP Sbjct: 261 PPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPP 308 Score = 36.7 bits (81), Expect = 0.025 Identities = 24/83 (28%), Positives = 27/83 (32%), Gaps = 3/83 (3%) Frame = +3 Query: 636 SPPXXPP-PXPPPPPPXXXPPXXPXPP--PPPXPXPPXPXPXAPPXSXXXXXXXXXXXXX 806 SPP PP P PP P PP P PP P P P +PP Sbjct: 260 SPPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPSLHRYPQSPLR 319 Query: 807 XXXXSXXFXPPPQXXPPXHHHFP 875 + P P PP +P Sbjct: 320 YPPSPIRYPPLPSRYPPSPPRYP 342 Score = 35.5 bits (78), Expect = 0.058 Identities = 19/61 (31%), Positives = 20/61 (32%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTPXXX 816 P P P P P PP P P P PP P PP P P +P Sbjct: 317 PLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPPSPLRY 376 Query: 817 L 819 L Sbjct: 377 L 377 Score = 35.1 bits (77), Expect = 0.076 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXP-XPP--XXXPPXPPPXPPXPPXXPP 771 P P P P PP P PP P PP PP PP PP Sbjct: 259 PSPPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPP 301 Score = 34.7 bits (76), Expect = 0.10 Identities = 22/82 (26%), Positives = 24/82 (29%), Gaps = 3/82 (3%) Frame = +3 Query: 639 PPXXPPPXPP-PPPPXXXPPXXPXPPPPPXPXPPXP--XPXAPPXSXXXXXXXXXXXXXX 809 PP PP P PP P PP P P PP P P P Sbjct: 289 PPRYPPSPPRYPPSPPRYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRY 348 Query: 810 XXXSXXFXPPPQXXPPXHHHFP 875 + P P P H +P Sbjct: 349 PPSPPRYPPSPPRYPSSHPRYP 370 Score = 32.7 bits (71), Expect = 0.41 Identities = 21/77 (27%), Positives = 24/77 (31%), Gaps = 4/77 (5%) Frame = +3 Query: 657 PXPP--PPPPXXXPPXXPXPPPPPXPXPPXP--XPXAPPXSXXXXXXXXXXXXXXXXXSX 824 P PP PP P PP P PP P P P +PP Sbjct: 259 PSPPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPSLHRYPQSPL 318 Query: 825 XFXPPPQXXPPXHHHFP 875 + P P PP +P Sbjct: 319 RYPPSPIRYPPLPSRYP 335 Score = 32.3 bits (70), Expect = 0.54 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 8/52 (15%) Frame = +3 Query: 636 SPPXXP------PPXPP--PPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 SPP P PP PP PP P P P PP P P P P S Sbjct: 337 SPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPPSPLRYLPSPIRYPPSHS 388 Score = 29.5 bits (63), Expect = 3.8 Identities = 23/81 (28%), Positives = 25/81 (30%), Gaps = 1/81 (1%) Frame = +3 Query: 636 SPPXXPP-PXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXSXXXXXXXXXXXXXXX 812 SP PP P PP P PP P P PP P PP Sbjct: 316 SPLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRYPPS-PPRYPP----SPPRYPSSHPRYP 370 Query: 813 XXSXXFXPPPQXXPPXHHHFP 875 + P P PP H +P Sbjct: 371 PSPLRYLPSPIRYPPSHSRYP 391 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXP--XPPPPPXPXPPXPXPXAPP 761 SP PP P PP PP P PPPP P P P APP Sbjct: 173 SPGILAPP-PAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 31.9 bits (69), Expect = 0.71 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPP----XPPXXPP 771 P PP PP P PP P PPP PP PP PP Sbjct: 181 PAPPGVLAPP--PAPPGVLP--PPPAPPGALIPPPPAPP 215 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +1 Query: 676 PPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P PP P PP PP P PP P G + P P Sbjct: 174 PGILAPPPAPPGVLAPPPAPPGVLPPPPAPP---GALIPPPPAP 214 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGG--GGGGXGGGXXGG 638 GG G G G G GG GG GG GGG GGG GG Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGG 367 Score = 37.5 bits (83), Expect = 0.014 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 5/45 (11%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGG--GXGXXGGXXXGGG---GGGXGGGXXGG 638 G G G G G GGG G G GG GGG GG GGG GG Sbjct: 328 GDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGG 372 Score = 37.5 bits (83), Expect = 0.014 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 4/46 (8%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGG--GXGXXGGXXXGGG--GGGXGGGXXGGE 635 GG G G G G GGG G G GG GGG GGG GG G+ Sbjct: 357 GGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHGGGDYGD 402 Score = 37.1 bits (82), Expect = 0.019 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 5/46 (10%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGG--GXGXXGGXXXGGG---GGGXGGGXXGG 638 GG G G G G GGG G G GG GGG GG G G GG Sbjct: 337 GGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGG 382 Score = 37.1 bits (82), Expect = 0.019 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 5/46 (10%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGG--GXGXXGGXXXGGG---GGGXGGGXXGG 638 GG G G G G GGG G G GG G G GG GGG GG Sbjct: 347 GGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGG 392 Score = 37.1 bits (82), Expect = 0.019 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 5/46 (10%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGG--GXGXXGGXXXGGG---GGGXGGGXXGG 638 GG G G G G GGG G G G GGG GG GGG GG Sbjct: 352 GGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHGG 397 Score = 35.5 bits (78), Expect = 0.058 Identities = 21/45 (46%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGG--GXGXXGGXXXGGG--GGGXGGGXXGGE 635 G G G G G GGG G G GG GGG GGG GG G+ Sbjct: 333 GDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGD 377 Score = 35.5 bits (78), Expect = 0.058 Identities = 27/71 (38%), Positives = 27/71 (38%), Gaps = 3/71 (4%) Frame = -3 Query: 839 GGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGG---GX 669 GGG G G P GG GG G GGG G G G GG GG G Sbjct: 336 GGGDPGGGDPGG--GDPGGGDPGGGDPGG-GDHGGGDHGGGDHGDGDHGGGDHGGGDHGG 392 Query: 668 GXXGXGXXGXG 636 G G G G G Sbjct: 393 GDHGGGDYGDG 403 Score = 34.3 bits (75), Expect = 0.13 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 5/46 (10%) Frame = -1 Query: 760 GGAXGXGX-GGXGXGGGG-GXGXXGGXXXGG---GGGGXGGGXXGG 638 GG G G GG GGG G G GG GG G G GGG GG Sbjct: 342 GGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGG 387 Score = 33.5 bits (73), Expect = 0.23 Identities = 27/76 (35%), Positives = 27/76 (35%), Gaps = 2/76 (2%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGA--PXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXX 684 GG GGG G G P GG GG G GG GG G GG Sbjct: 336 GGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGG-GDHGGGD 394 Query: 683 XGGGXGXXGXGXXGXG 636 GG G G G G G Sbjct: 395 HGG--GDYGDGDHGDG 408 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGG--GGGGXGGGXXG 641 GG G G G G GGG G GG GG GGG G G G Sbjct: 367 GGDHGGGDHGDGDHGGGDHG--GGDHGGGDHGGGDYGDGDHG 406 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -1 Query: 748 GXGXGGXGXGGGG--GXGXXGGXXXGGGGGGXGGGXXGGE 635 G G G G GGG G G GG GGG G GG GG+ Sbjct: 326 GDGDHGDGDHGGGDPGGGDPGGGDPGGGDPG-GGDPGGGD 364 Score = 32.3 bits (70), Expect = 0.54 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGG---GXGXXGXGXXGXG 636 G G G GGG G G G GG GG G G G G G G Sbjct: 326 GDGDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGG 373 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -1 Query: 757 GAXGXGXGGXGX-GGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G GG G GGGGG G GG GGG G G G Sbjct: 203 GGRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYG 243 Score = 31.9 bits (69), Expect = 0.71 Identities = 19/53 (35%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG---GESSCXIYQE 611 GG G GG GGG G G GGGG G G G S +Y + Sbjct: 217 GGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGGGYGSSYGSYDGYGSMGMYNQ 269 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = -1 Query: 712 GGXGXXGGXXXGGGG-GGXGGGXXGG 638 GG G GG GGGG GG GGG G Sbjct: 197 GGRGGYGGRGRGGGGRGGYGGGGGYG 222 Score = 30.7 bits (66), Expect = 1.6 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXGIXLXY 621 GG GG GG GGG GG GG G GG G G G Y Sbjct: 209 GGGRGGYGG-GGGYGG--YGGYDQYSGGGYGGYGDSYGSYGGGGGYGSSY 255 >SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 37.5 bits (83), Expect = 0.014 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 PP P PPPP P P PPP P P P Sbjct: 139 PPAKEAPLPPPPAQQEAVPDIPTSPPPVPPLPTEP 173 Score = 31.5 bits (68), Expect = 0.94 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +1 Query: 610 IPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPP-PXPP 750 +P K P P P PPP P P PP PP P P Sbjct: 126 LPKKEAAASSTPPPPAKEAPLPPPPAQQEAVPDIPTSPPPVPPLPTEP 173 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 736 GGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 GG G G GGG G G G GGGG G G S Sbjct: 369 GGRGGGRGGGRGGFRGGRGGRGGGGRGAGSDASAS 403 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -1 Query: 727 GXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSCXIYQEXV 605 G G GGG G G GG GG GGG G + Y V Sbjct: 368 GGGRGGGRGGGRGGFRGGRGGRGGGGRGAGSDASASYNTIV 408 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGG 671 GG G G GG G GG G GG G G Sbjct: 368 GGGRGGGRGGGRGGFRGGRGGRGGGGRGAG 397 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 37.1 bits (82), Expect = 0.019 Identities = 22/67 (32%), Positives = 24/67 (35%) Frame = -3 Query: 836 GGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXG 657 GG + G G + G G GG GGG GG G GG GGG G Sbjct: 325 GGARAQGWVGGRAGNMNSGYNGGPSPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGITW 384 Query: 656 XGXXGXG 636 G G Sbjct: 385 NQAGGGG 391 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSC 626 GG G GGGGG G GG GG G SSC Sbjct: 357 GGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGGGGSYCAG-SSC 400 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXG---GGGGGXGGGXXGGES 632 E GGA G G G G G GG G G GGG GG G S Sbjct: 323 EAGGARAQGWVG-GRAGNMNSGYNGGPSPGAVGGFGGGGGGSEDNGAS 369 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = -1 Query: 760 GGAXGXGX-GGXGXGGGGGXGXXGGXXXGGGGGGXGG----GXXGGES 632 GG+ G GG G GGG G GGGG G G GG S Sbjct: 361 GGSEDNGASGGGGGYSGGGSGITWNQAGGGGGSYCAGSSCKGVTGGNS 408 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 37.1 bits (82), Expect = 0.019 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPPP 719 P PPPPPP P P PPPP Sbjct: 663 PPPPPPPPGGGVPGPPKPPPP 683 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +3 Query: 627 QXDSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 + D+ P P PPPP P PPPPP P P PP Sbjct: 639 EQDARPPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 31.5 bits (68), Expect = 0.94 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = +1 Query: 703 PXPPXXXPPXPPPX----PPXPPXXPPLXGGVXGAPXTP 807 P P P PPP PP PP PP GGV G P P Sbjct: 645 PNPFFGGIPPPPPGGGMFPPPPP--PPPGGGVPGPPKPP 681 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 6/39 (15%) Frame = +1 Query: 673 PPPXXXPPXXPXPPXXX--PPXPPPXP----PXPPXXPP 771 PP P PP PP PPP P P PP PP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPP 682 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 P PPP PPPPP P P P P P AP Sbjct: 454 PQGPPPPPPPPPQMYQQPLMMPQAPMMMPQAPMMMPQAP 492 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 S P PP PP PPP PP P PP P P P Sbjct: 520 SYPAPQPPSPPAPPPKPAPP--PRSPPAAAPCNPAMAP 555 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXP-PXPXPXAPP 761 P P P P P PP PP P P P P P +PP Sbjct: 504 PCAPSCAPTYSPSCCGSYPAPQPPSPPAPPPKPAPPPRSPP 544 Score = 33.5 bits (73), Expect = 0.23 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 678 PXXXPPXXPXPPPPPXPXPPXPXPXAP 758 P PP P PPP P P P P AP Sbjct: 522 PAPQPPSPPAPPPKPAPPPRSPPAAAP 548 Score = 33.5 bits (73), Expect = 0.23 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 703 PXPPXXXPPXPPPXPPXPPXXPP 771 P P PP PPP P PP PP Sbjct: 522 PAPQPPSPPAPPPKPAPPPRSPP 544 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 P P PP PP P P PP PP P P Sbjct: 522 PAPQPPS--PPAPPPKPAPPPRSPPAAAPCNP 551 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPP 750 P PP PP P PP PP P P Sbjct: 524 PQPPSPPAPPPKPAPPPRSPPAAAPCNP 551 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P P P PP PP PP P PP AP P Sbjct: 504 PCAPSCAPTYSPSCCGSYPAPQPPSPPAPPPKP--APPPRSPPAAAPCNP 551 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +3 Query: 627 QXDSPPXXPPPXPPPPPPXXXPPXXPXPP-PPPXPXPPXPXPXA 755 Q P P P P P PP PPP P PP P A Sbjct: 502 QQPCAPSCAPTYSPSCCGSYPAPQPPSPPAPPPKPAPPPRSPPA 545 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +3 Query: 654 PPXPPPPPPXXXPP-XXPXPPPPPXP 728 PP PP PPP PP P PP PP P Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPPQP 1284 Score = 31.5 bits (68), Expect = 0.94 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPP 719 P PP PP P PP P PP P Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPPQP 1284 Score = 31.5 bits (68), Expect = 0.94 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +1 Query: 691 PPXXPX-PPXXXPPXPPPXPPXPP 759 PP P PP PP PP PP PP Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPP 1282 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +3 Query: 666 PPPPPXXXPPXXPXPP--PPPXPXPPXP 743 PP PP PP PP PP P PP P Sbjct: 1259 PPLPPL--PPPDAQPPSLPPQPPQPPQP 1284 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPP---PXPXPPXPXPXAPP 761 P PP P PP PP P PPP P P P P PP Sbjct: 401 PGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGPGMPP 443 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXP--XPPXXXPPXPP--PXPPXPPXXP 768 P P PP PP P PP PP P P P PP P Sbjct: 401 PGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGPGMPPMRP 446 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 709 PPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 PP P P PP P PP GG P P Sbjct: 405 PPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGP 437 >SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 37.1 bits (82), Expect = 0.019 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 3/60 (5%) Frame = -3 Query: 806 GVXGAPXTPPXRGGXXGGXGGXGGG---XGGXXXGGXGXXGGXXXGGGXGXXGXGXXGXG 636 GV GG GG G GGG GG GG GG GG G G G G Sbjct: 146 GVVDVVVEDDGHGGGDGGDDGDGGGDDDDGGDGDGGGDDGGGADGGGADGGDDDGGDGDG 205 Score = 37.1 bits (82), Expect = 0.019 Identities = 22/50 (44%), Positives = 23/50 (46%), Gaps = 6/50 (12%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGG----GGXGXXGGXXXGG--GGGGXGGGXXGGE 635 E G G G G GGG GG G GG GG GGG GG GG+ Sbjct: 153 EDDGHGGGDGGDDGDGGGDDDDGGDGDGGGDDGGGADGGGADGGDDDGGD 202 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGG-GGXGXXGGXXXGGGGGGXGGGXXGG 638 + GG G GGG GG GG GG G GGG GG Sbjct: 143 DNGGVVDVVVEDDGHGGGDGGDDGDGGGDDDDGGDGDGGGDDGG 186 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P P PPP PP P PP P P P PP Sbjct: 761 PPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPP 801 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +3 Query: 636 SPPXXP-PPXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 SPP P PP P PP PP PPP P PP P Sbjct: 747 SPPAPPLPPKVTPKPPA--PPQFAPVPPPCAPIPPMP 781 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = +3 Query: 636 SPPXXPPPXPPPPPP----XXXPPXXPXPPPP-PXPXPPXPXP 749 +PP P P PP P PP P PP P P PP P P Sbjct: 750 APPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAP 792 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +1 Query: 691 PPXXPXPPXXXP--PXPPPXPPXPPXXPPLXGGVXGAPXTP 807 PP P PP P P PP P PP P+ AP P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPP 788 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +1 Query: 667 PXPP-PXXXPPXXPXPPXXXPPXPP--PXPPXP--PXXPPLXGGVXGAPXTP 807 P PP P P P PP P PP P PP P PP AP P Sbjct: 749 PAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLP 800 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXP-PXPPPXPPXPPXXPP 771 P P P P P P P PP P P P P PP P Sbjct: 749 PAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAP 792 Score = 31.9 bits (69), Expect = 0.71 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 11/65 (16%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPP-XXXPP---XXPXPPXXXP----PXPPPXP---PXPP 759 P K P P P P PPP PP P PP P P PP P PP Sbjct: 751 PPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPP 810 Query: 760 XXPPL 774 PP+ Sbjct: 811 PPPPV 815 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 669 PPPPXXXPPXXPXPPPPPX--PXPPXPXPXAP 758 PP P P P PP PP P PP P P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPP 779 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXA 755 P P PP P P P P P P PP P P A Sbjct: 779 PMPCSAPLPPAPAPFSAAPHLP-PAPNISAEPPPPPPVA 816 Score = 28.3 bits (60), Expect = 8.7 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP-PLXGGVXGAP 798 IP P P PP PP P P P PP P P P + AP Sbjct: 737 IPSPSEVTTKSPPAPPL--PPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAP 790 Score = 28.3 bits (60), Expect(2) = 0.065 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 666 PPPPPXXXPPXXPXPPPPP 722 PPPPP PPPPP Sbjct: 928 PPPPPELLGSDADLPPPPP 946 Score = 25.8 bits (54), Expect(2) = 0.065 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 Query: 636 SPPXXPPPXPPPPPP 680 SPP PPPPPP Sbjct: 877 SPPTGADDFPPPPPP 891 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXP----PXXPP 771 +P P P P P PP PP PP P P P P P PP Sbjct: 129 VPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPP 178 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PP P P P P PPP P P P PP Sbjct: 154 PPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGYPP 194 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PP PP P P PP P P P PP Sbjct: 149 PPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPP 189 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXPPPXP---PXPPXXPP 771 P P PP PP P P PP P P P P PP Sbjct: 115 PTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPP 155 Score = 32.3 bits (70), Expect = 0.54 Identities = 22/71 (30%), Positives = 23/71 (32%), Gaps = 1/71 (1%) Frame = +1 Query: 562 YSXHAVYVPYXRNVXX-IPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPP 738 YS VPY +P P P P P P P P P PP PP Sbjct: 122 YSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPY---PAQPYPQQGYPPQPP 178 Query: 739 PXPPXPPXXPP 771 P P PP Sbjct: 179 PQAYPQPGYPP 189 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 8/48 (16%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXP----PXXPXPP----PPPXPXPPXPXPXAP 758 P PPP P PP P P P P PPP PP P P Sbjct: 115 PTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQP 162 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXA-PPXS 767 P PPP P PP P PP P P P PP S Sbjct: 115 PTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTS 157 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGA 795 P P P P PP PP P P PP P P P G A Sbjct: 162 PYPAQPYPQQGYPPQP--PPQAYPQPGYPPQGYPPTGPYPQTQPGYAGATPQA 212 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 7/49 (14%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXP-PXXPXPPPPPX------PXPPXPXPXAPP 761 +PP PPP P PPP P P P P P PP P P P Sbjct: 943 TPPPSPPPKEPTPPPSSKPSPVKEIKPKKPIEKFISRPKPPTPPPVVSP 991 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 6/48 (12%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPP------XPXPXAPP 761 SP PPP PPP P P P P P P P P PP Sbjct: 939 SPTPTPPPSPPPKEPTPPPSSKPSPVKEIKPKKPIEKFISRPKPPTPP 986 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P P P P P PPP P P P P P + P Sbjct: 926 PSPEPLPEVDIMRSPT-PTPPPSPPPKEPTPPPSSKP 961 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 666 PPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 P P P P P P P PP P PP S Sbjct: 926 PSPEPLPEVDIMRSPTPTPPPSPPPKEPTPPPSS 959 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 36.7 bits (81), Expect = 0.025 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXP 728 PPPPPP P PPPPP P Sbjct: 755 PPPPPPPAVPGEGARPPPPPPP 776 Score = 35.9 bits (79), Expect = 0.044 Identities = 24/83 (28%), Positives = 24/83 (28%), Gaps = 9/83 (10%) Frame = +3 Query: 636 SPPXXPPPXPPPPPP---------XXXPPXXPXPPPPPXPXPPXPXPXAPPXSXXXXXXX 788 SP PPP PPPPP P PP PP P P PP Sbjct: 679 SPSSAPPPPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPPLGRDSAAVF 738 Query: 789 XXXXXXXXXXSXXFXPPPQXXPP 857 S PP PP Sbjct: 739 MLTWTPLTNTSSAANVPPPPPPP 761 Score = 33.5 bits (73), Expect = 0.23 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPPPP 722 P PPPPP P PPPPP Sbjct: 755 PPPPPPPAVPGEGARPPPPPPP 776 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXP 728 PPPPPP PPPPP P Sbjct: 756 PPPPPPAVPGEGARPPPPPPPP 777 Score = 32.7 bits (71), Expect = 0.41 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 9/59 (15%) Frame = +1 Query: 610 IPDKXXKXIPXPXXPXPXXPXPPPXXXPP---XXPXPPXXXPP------XPPPXPPXPP 759 + D K P P P P PP P PP PP PPP PP PP Sbjct: 671 LQDNARKSSPSSAPPPPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPP 729 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPP 719 PPP PPP P P PPPP Sbjct: 755 PPPPPPPAVPGEGARPPPPPPPP 777 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPP 722 PP PPPP P PPPPP Sbjct: 755 PPPPPPPAVPGEGARPPPPPPPP 777 Score = 32.3 bits (70), Expect = 0.54 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 666 PPPPPXXXPPXXPXPPPPPXPXP 734 PPPPP P PPPP P P Sbjct: 755 PPPPPPPAVPGEGARPPPPPPPP 777 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 36.3 bits (80), Expect = 0.033 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPP 713 +P PPP PPPP PP P PP Sbjct: 300 TPQTPPPPQTPPPPQTPAPPQTPAPP 325 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPPPPXP 728 P PPPP PP P PP P P Sbjct: 301 PQTPPPPQTPPPPQTPAPPQTPAP 324 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPP 737 P PPP PP P PP P PP Sbjct: 301 PQTPPPPQTPPPPQTPAPPQTPAPP 325 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 694 PXXPXPPXXXPPXPPPXPPXPPXXP 768 P P PP PP P PP P P Sbjct: 301 PQTPPPPQTPPPPQTPAPPQTPAPP 325 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGX-GXXGGXXXGGGGGGXGGG 650 GG G G GG G GGG G GG GGG G GG Sbjct: 428 GGYEGRGRGGRGGPRGGGPRGYDGGYGQGGGYEGYSGG 465 Score = 29.9 bits (64), Expect = 2.9 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 9/48 (18%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGG----GXGXXGGXXXGG-----GGGGXGGGXXG 641 G+ GG G GGG G G GG GG GG G GGG G Sbjct: 414 GSLNSRRGGRGGPGGGYEGRGRGGRGGPRGGGPRGYDGGYGQGGGYEG 461 >SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) Length = 699 Score = 36.3 bits (80), Expect = 0.033 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 P P PPP P PPPPP P P P Sbjct: 383 PLPTPPPMSTHPEFTSKPPPPPVASKPPPKP 413 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = +3 Query: 666 PPPPPXXXPPXXPXPPPPP---XPXPPXPXPXA 755 P PPP P PPPP PP P P A Sbjct: 385 PTPPPMSTHPEFTSKPPPPPVASKPPPKPVPYA 417 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPX-PPPPPXPXP 734 D P PPP P PP P PPP P P Sbjct: 381 DDPLPTPPPMSTHPEFTSKPPPPPVASKPPPKPVP 415 >SB_504| Best HMM Match : GRP (HMM E-Value=2.8) Length = 107 Score = 36.3 bits (80), Expect = 0.033 Identities = 20/42 (47%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = -1 Query: 766 EXGGAXGXGXGGXGX----GGGGGXGXXGGXXXGGGGGGXGG 653 + GG+ G G G GGGGG G GG GGGG G GG Sbjct: 20 DGGGSDGVGGDDDGDDDDSGGGGGDGV-GGDDDGGGGDGCGG 60 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/46 (34%), Positives = 19/46 (41%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 + GG G G GG GGGG G G GG G+S+ Sbjct: 37 DSGGGGGDGVGGDD-DGGGGDGCGGDDDSDDDDGGGDDNDDNGDST 81 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 36.3 bits (80), Expect = 0.033 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 P P PP PP P P PPP P P P Sbjct: 136 PTPPPPTPPQSTPKPRRVLPTPPPKPPTPRP 166 Score = 35.5 bits (78), Expect = 0.058 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPP 737 P PPP PP P PP PP P PP Sbjct: 136 PTPPPPTPPQSTPKPRRVLPTPPPKPPTPRPP 167 Score = 35.1 bits (77), Expect = 0.076 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 P PPPP P P P P P PP P P Sbjct: 136 PTPPPPTPPQSTPKPRRVLPTPPPKPPTPRP 166 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXP 756 P PPP P P P P PPP PP P Sbjct: 136 PTPPPPTPPQSTPKPRRVLPT-PPPKPPTP 164 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXP----PXPPXXPP 771 +P P P P P P PP PP P P P PP PP Sbjct: 114 LPTPPFSTPR-PRPKAKRIRRLLPTPPPPTPPQSTPKPRRVLPTPPPKPP 162 >SB_29605| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -1 Query: 742 GXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G GG G GG G G G G G G GG GG+ Sbjct: 35 GQGGNGQGGDGQAGQGGNGQGGDGQAGQGGNGQGGD 70 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG G G G GG G G G G GG G GG+ Sbjct: 37 GGNGQGGDGQAGQGGNGQGGDGQAGQGGNGQGGDGPAGQGGD 78 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 742 GXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G GG G G G G GG G GG Sbjct: 30 GDGQAGQGGNGQGGDGQAGQGGNGQGGDGQAGQGG 64 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 36.3 bits (80), Expect = 0.033 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = -1 Query: 760 GGAXGXGXGGX-GXGGGGGXGXXGGXXXGGGGGG--XGGGXXGGESSC 626 GGA G GG G GG G G GG G G GG GG +C Sbjct: 419 GGAFGGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGGGSRTC 466 >SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 36.3 bits (80), Expect = 0.033 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPP 719 PPP PPPP P P PPPP Sbjct: 583 PPPHPPPPAHHVNKPGVPPPPPP 605 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPP 722 P P P PPPP PPPPP Sbjct: 578 PVATSPPPHPPPPAHHVNKPGVPPPPP 604 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 36.3 bits (80), Expect = 0.033 Identities = 25/81 (30%), Positives = 26/81 (32%), Gaps = 7/81 (8%) Frame = +1 Query: 577 VYVPYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPP-- 750 V VP + P IP P P P PP P PP PP PP Sbjct: 350 VIVPPPNLLFSFPPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPPT 409 Query: 751 -----XPPXXPPLXGGVXGAP 798 PP PP GV P Sbjct: 410 MIQTLPPPSVPPPPIGVPNRP 430 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P PPPP PP PPP P P PP Sbjct: 383 PPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPPP 423 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXP-PPPPXPXPPXPXPXAP 758 PP PPP PPP P PPPP P P P Sbjct: 395 PPLIPPPQASIPPPTMIQTLPPPSVPPPPIGVPNRPSVLYP 435 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 6/58 (10%) Frame = +1 Query: 652 PXPXXPXPPPXXXP---PXXPXP---PXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P PPP P P P P PP P PP PP P P Sbjct: 363 PPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVP 420 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 742 GXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 G G GG G G GGGGG GGG Sbjct: 2315 GESRAGPVGGFGGGGSSRIRPGGGGGYSGGG 2345 >SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 733 GXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 G GGGGG G GG GGGG G G S Sbjct: 189 GASAGGGGGVGTTGGSTGAAGGGGGGTSTSTGSS 222 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 35.9 bits (79), Expect = 0.044 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PP PPPP P P P PPP P P +P Sbjct: 681 PPLTPPPPLPTPIASSEPLPLPPPPPPTGIDIPHSP 716 Score = 32.7 bits (71), Expect = 0.41 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPP 719 PP PPP P P P P PPPP Sbjct: 681 PPLTPPPPLPTPIASSEPLPLPPPPPP 707 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = +3 Query: 651 PPPXPPPPPPXXX-----PPXXPXPPPPPXPXPPXPXPXAPPXS 767 P P PPPPPP P P PPP P P P S Sbjct: 698 PLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPPS 741 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +3 Query: 633 DSPPXXPPPXPPP-PPPXXXPPXXPXPPP-PPXPXPPXPXPXAPP 761 D P PPP PPP PP PP P P P PP Sbjct: 719 DDLPLPPPPEEVSLPPPDESPPSSKHPPTVSPSSSSAPPRPSTPP 763 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP---XAPP 761 SP P PPPP PP P PP PP P APP Sbjct: 715 SPSKDDLPLPPPPEEVSLPP--PDESPPSSKHPPTVSPSSSSAPP 757 Score = 30.7 bits (66), Expect = 1.6 Identities = 22/74 (29%), Positives = 22/74 (29%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXSXXXXXXXXXXXXXXXXXSXXFX 833 PP PPPP P P P P PP P P S Sbjct: 681 PPLTPPPP---LPTPIASSEPLPLPPPPPPTGIDIPHS-----PSKDDLPLPPPPEEVSL 732 Query: 834 PPPQXXPPXHHHFP 875 PPP PP H P Sbjct: 733 PPPDESPPSSKHPP 746 Score = 30.7 bits (66), Expect = 1.6 Identities = 22/71 (30%), Positives = 23/71 (32%), Gaps = 6/71 (8%) Frame = +1 Query: 610 IPDKXXKX-IPXPXXPXPXXPXPPPXXXPPXXPXPPXXXP-----PXPPPXPPXPPXXPP 771 IP K +P P P PPP PP PP P P P PP PP Sbjct: 712 IPHSPSKDDLPLPPPPEEVS-LPPPDESPPSSKHPPTVSPSSSSAPPRPSTPPSVSSAPP 770 Query: 772 LXGGVXGAPXT 804 P T Sbjct: 771 QTTNFCDTPGT 781 Score = 29.5 bits (63), Expect = 3.8 Identities = 20/71 (28%), Positives = 22/71 (30%), Gaps = 6/71 (8%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXX---PXPPPXXXPPXXPXPPXXXPPXPPPXPP---XPPXXPPL 774 P + +P P P P P P P P P P P PP PP P Sbjct: 692 PIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPPSSKHPPTVSPS 751 Query: 775 XGGVXGAPXTP 807 P TP Sbjct: 752 SSSAPPRPSTP 762 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 4/45 (8%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP----XPXAPP 761 P PPP P P P P PPP P P P PP Sbjct: 682 PLTPPPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPP 726 >SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1041 Score = 35.9 bits (79), Expect = 0.044 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPP-PXPXPPXPXP 749 PP P P PP P PPP P P PP P Sbjct: 424 PPQPSPTGAPPQRPHPPPQQPSPRPPMGVP 453 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 627 QXDSPPXXPPPXPPPPPPXXXPPXXPXPPPP 719 Q SPP P PP P PP P P PP Sbjct: 420 QRQSPPQPSPTGAPPQRP-HPPPQQPSPRPP 449 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 PP P PP P P P P P P P P Sbjct: 412 PPQQQPQQQRQSPPQPSPTGAPPQRPHPPPQQPSPRP 448 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPP 750 P P P PP P PP P P P PP Sbjct: 425 PQPSPTGAPPQRPHPP---PQQPSPRPP 449 >SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) Length = 1230 Score = 35.9 bits (79), Expect = 0.044 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXP 728 D+PP P PPPPP PP P P P Sbjct: 443 DAPPVSPTTATPPPPPPSQPPPQQFIPSPQFP 474 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 PPP P PP P PP P P P P Sbjct: 432 PPPRPYASQFADAPPVSPTTATPPPPPPSQPPP 464 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 733 GXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 G GGGGG G GG GGGG G G S Sbjct: 235 GASAGGGGGVGTTGGSTGAAGGGGGGTSTSTGSS 268 >SB_44810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXG-GGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 E G G GG G G G G GG G GGG GG G+S Sbjct: 25 EDDGCSDDGVGGGYNGVDGDGDGSDGGVVNGDNGGGDNGGGDNGDS 70 >SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) Length = 627 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P PPP PP P PPPP P PP PP Sbjct: 150 PSITQPPPRHSPPQTPVPPPP--PLPPFAQVSLPP 182 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPP 719 PP PP P PPP PP PP Sbjct: 156 PPRHSPPQTPVPPPPPLPPFAQVSLPP 182 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 35.9 bits (79), Expect = 0.044 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXP 728 P PP PP P PP PPPPP P Sbjct: 863 PVGAPPSLPPRPRTRPLPPKSDTPPPPPRP 892 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +3 Query: 642 PXXPPPXPPPP---PPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 P PPP PP P PP P P PP PP P A S Sbjct: 853 PSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRPAADES 897 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 D P P P PP P PP P P P P PP PP Sbjct: 848 DRPLSPSAPPPLPPRPVGAPPSLP-PRPRTRPLPPKSDTPPPP 889 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +1 Query: 643 PXXPXPXXPXPP-PXXXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 P P P PP P PP P P P P P PP P Sbjct: 850 PLSPSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRP 892 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXP 747 P P P P P P P PP P PPP P Sbjct: 856 PPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRP 892 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXP-PXPPPXPPXPPXXPP 771 PD P P P PP P PP P P P PP PP Sbjct: 835 PDSLTMEAPTTKTDRPLSPSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPP 888 >SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 35.5 bits (78), Expect = 0.058 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG 641 GG G G G G GG GG G GG G G G GGG G Sbjct: 236 GGVGGLGGVG-GLGGIGGLG--GGGVIAGAGAGIGGGVIG 272 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXG-GGXXGG 638 GG G G G G GG GG G G G GGG G GG GG Sbjct: 239 GGLGGVG-GLGGIGGLGGGGVIAGAGAGIGGGVIGTGGIPGG 279 Score = 33.9 bits (74), Expect = 0.18 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGG--GXGGGXXGG 638 GG G G G G GG GG G GG GGGG G G G GG Sbjct: 230 GGLGGLGGVG-GLGGVGGLGGIGGL--GGGGVIAGAGAGIGGG 269 >SB_35308| Best HMM Match : VWA (HMM E-Value=1.1e-20) Length = 381 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -1 Query: 721 GGGGGXGXXGGXXXGGGGGGXGGGXXGGESSCXI 620 G GG GG GG GG GGG GG SC + Sbjct: 288 GSAGGISASGGAGGSGGAGGVGGG-GGGTGSCDL 320 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG 641 G G GG GG G GG GGGGGG G G Sbjct: 288 GSAGGISASGGAGGSGGAGG--VGGGGGGTGSCDLG 321 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXG 701 GGA G G G GGGGG G Sbjct: 297 GGAGGSGGAGGVGGGGGGTG 316 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 SP P PPPP P P PPPP P P P Sbjct: 184 SPTEDTPWTSVPPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 35.5 bits (78), Expect = 0.058 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 691 PPXXPXPPXXXPPXPPPXPPXPPXXPPLXGG 783 PP P P PP PPP P PP+ GG Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPPPPPMGGG 225 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXP----XPPPPP 722 D+P PP PPP P PP P PPPPP Sbjct: 188 DTPWTSVPPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +1 Query: 694 PXXPXPPXXXPPXPPPXPPX-PPXXPPLXGGVXGAP 798 P P PP PPP P PP PP+ GGV P Sbjct: 185 PTEDTPWTSVPPPPPPGPGGIPPPPPPIRGGVPPPP 220 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PPP PPP P P P P P PP Sbjct: 746 PPPYKQVPPPYKQVPHPYKQVPAPYKQVPAPYKQVPP 782 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P P PPP PP P PPP P P PP Sbjct: 185 PTEDTPWTSVPPP---PPPGPGGIPPPPPPIRGGVPPPPP 221 >SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) Length = 129 Score = 35.5 bits (78), Expect = 0.058 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGG--GGGGXGGGXXGG 638 GG G G G GGGG G GG G GGGG G GG Sbjct: 78 GGCEGGGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGG 120 Score = 31.5 bits (68), Expect = 0.94 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 742 GXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G GG GGG G GG G GGG G GG Sbjct: 76 GCGGCEGGGGSGGCEGGGGCVGCEGGGGCVGCEGG 110 Score = 31.5 bits (68), Expect = 0.94 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSC 626 E GG G GG G G G G G GGG G GG GG C Sbjct: 81 EGGGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGG--GGCVGC 125 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXA--PPXS 767 PP P P PPP P PPPP P P A PP S Sbjct: 246 PPSVKPSVPIPPPTKPPPRVASRRPPPPLPPPDSSEAQAQQPPLS 290 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 2/59 (3%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPX--PPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P P PPP PP PP PP PPP P G P P Sbjct: 244 PHPPSVKPSVPIPPPTKPPPRVASRRPP---PPLPPPDSSEAQAQQPPLSPPVGKPVVP 299 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PPP PPP P P PPP P +PP Sbjct: 256 PPPTKPPPRVASRRPPPPLPPPDSSEAQAQQPPLSPP 292 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +1 Query: 616 DKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPL 774 DK P P P PPP P PP P PP PP+ Sbjct: 242 DKPHPPSVKPSVPIPPPTKPPP-RVASRRPPPPLPPPDSSEAQAQQPPLSPPV 293 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 35.5 bits (78), Expect = 0.058 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G+ G G GG GGGGG G GGGG GG GG Sbjct: 279 GSTG-GPGGINAGGGGGDSTTDSDD-GAGGGGGGGHFSGG 316 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGX-GGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GGA GG G GGG G G GGG GGG G Sbjct: 274 GGAGEGSTGGPGGINAGGGGGDSTTDSDDGAGGGGGGGHFSG 315 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 6/50 (12%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXX------GGGGGGXGGGXXGGE 635 + GG G G GGGGG G GGGGGG GG G E Sbjct: 362 QRGGQSGGAAGTASMGGGGGGLQFGNQDYTSRLSYGGGGGGGGGSAFGIE 411 Score = 33.5 bits (73), Expect = 0.23 Identities = 22/76 (28%), Positives = 22/76 (28%) Frame = -1 Query: 856 GGXXWGGGXXXXEGXXXXXXXXXXXXXXXGEXGGAXGXGXGGXGXGGGGGXGXXGGXXXG 677 GG GGG E G G G G GG G GG Sbjct: 239 GGTSSGGGGYGGETYACLSSTYGKGGDRNQPGNAGGGAGEGSTGGPGGINAGGGGGDSTT 298 Query: 676 GGGGGXGGGXXGGESS 629 G GGG GG S Sbjct: 299 DSDDGAGGGGGGGHFS 314 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG 641 GA G G GG GG GG G GG GG G Sbjct: 303 GAGGGGGGGHFSGGAGGAAATGCTNQYGGSGGIASSTIG 341 Score = 32.7 bits (71), Expect = 0.41 Identities = 24/74 (32%), Positives = 25/74 (33%), Gaps = 3/74 (4%) Frame = -3 Query: 854 GXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGX---GGGXGGXXXGGXGXXGGXX 684 G GGGG + G RGG GG G GGG GG G Sbjct: 341 GACAGGGGSSNCQAGNGGNSCQ-----RGGQSGGAAGTASMGGGGGGLQFGNQDYTSRLS 395 Query: 683 XGGGXGXXGXGXXG 642 GGG G G G Sbjct: 396 YGGGGGGGGGSAFG 409 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GG G GG GGG GGGGGG G GG ++ Sbjct: 282 GGPGGINAGG---GGGDSTTDSDDGAGGGGGGGHFSGGAGGAAA 322 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 721 GGGGGXGXXGGXXXGGGGGGXGGG 650 GGGGG G GG GG GGG Sbjct: 397 GGGGGGGGGSAFGIEGGRGGHGGG 420 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 736 GGXGXGGGGGXGXXGGXXXGGGGGG 662 GG G GGG G GG GG GGG Sbjct: 398 GGGGGGGGSAFGIEGG--RGGHGGG 420 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -3 Query: 773 RGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXG 666 +GG G GGG G G G GG GGG G Sbjct: 262 KGGDRNQPGNAGGGAGE---GSTGGPGGINAGGGGG 294 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 GG G G GGG G GG GG GG G Sbjct: 290 GGGGGDSTTDSDDGAGGGGG--GGHFSGGAGGAAATG 324 Score = 28.3 bits (60), Expect = 8.7 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGG--GXXGGESSCXI 620 GG G GGGGG G G G G G GG +S I Sbjct: 292 GGGDSTTDSDDGAGGGGGGGHFSGGAGGAAATGCTNQYGGSGGIASSTI 340 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 35.1 bits (77), Expect = 0.076 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +1 Query: 637 PXPXXPXPXXPX-PPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXP 768 P P P P PPP PP P P PP P PP P Sbjct: 518 PTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPPTAP 562 Score = 35.1 bits (77), Expect = 0.076 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 +P P P PPP PP P PP P PP P PP Sbjct: 519 TPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPP-TQPSYPP 559 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXX--PPXPPPXPPXPPXXPP 771 P P P PP P PP PP P PP P PP Sbjct: 518 PTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPP 559 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P PP P P P PP P PP P PP Sbjct: 170 PSYP-PTQPFYPPTQ--PFYPPTPSSYPPTQPSYPPTAPSYPP 209 Score = 31.5 bits (68), Expect = 0.94 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P PP P PP P P PP P P P PP Sbjct: 170 PSYPPTQPFYPPTQPFYPPTPSSYPPTQPSYPPTAPSYPP 209 Score = 31.5 bits (68), Expect = 0.94 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +3 Query: 639 PPXXP--PPXPP--PPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 PP P PP P PP PP P PP P PP P Sbjct: 180 PPTQPFYPPTPSSYPPTQPSYPPTAPSYPPTPSSYPPIAASYPP 223 Score = 31.5 bits (68), Expect = 0.94 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +3 Query: 642 PXXPPPXPP-PPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P PP P PP P P P PPP P PP P PP Sbjct: 507 PSYPPTQPSYPPTPSSYLPTQPYY-PPPQPYPP-TQPSYPP 545 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/72 (27%), Positives = 26/72 (36%) Frame = +1 Query: 559 LYSXHAVYVPYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPP 738 L+S + +P N+ + P P P P PP P P PP P Sbjct: 150 LFSDSTLLIP-RHNLFILRQHPSYPPTQPFYP-PTQPFYPPT--PSSYPPTQPSYPPTAP 205 Query: 739 PXPPXPPXXPPL 774 PP P PP+ Sbjct: 206 SYPPTPSSYPPI 217 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +1 Query: 613 PDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPP 759 P +P P P PP P P P PP P PP P Sbjct: 517 PPTPSSYLPTQPYYPPPQPYPP---TQPSYPPTPSSYPPTQPSYPPTAP 562 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 35.1 bits (77), Expect = 0.076 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +3 Query: 621 IXQXDSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 I +P P P PP P PP PP P P P AP Sbjct: 142 IPSPPNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAP 187 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P P P P PP P PP P P Sbjct: 143 PSPPNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEP 180 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +3 Query: 639 PPXXPP-PXPPPPPPXXXPPXXPXPPPPP---XPXPPXPXPXAP 758 P PP P PP P PP P P P PP P AP Sbjct: 154 PETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAP 197 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +3 Query: 642 PXXPPPXP---PPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 P PP P PP P P P PP P P P P Sbjct: 161 PETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAPEPPKP 202 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 679 PXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAP 798 P P P PP P PP P PP G P Sbjct: 143 PSPPNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEP 182 >SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) Length = 287 Score = 35.1 bits (77), Expect = 0.076 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 GG G GGGGG G GGGGG GGG Sbjct: 249 GGRQFSSNSYGGFGGGGGACGCNGGGAGGGGGYSGGG 285 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G GG GG G G GG GG GGG GG Sbjct: 246 GGVGGRQFSSNSYGGFGGGGGACGCNGGGAGG--GGGYSGG 284 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG+ G G GG GG G GGGG G GG Sbjct: 233 GGSGGEGGKAFLHGGVGGRQFSSNSYGGFGGGGGACGCNGG 273 Score = 28.7 bits (61), Expect = 6.6 Identities = 22/69 (31%), Positives = 23/69 (33%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG G G + G G GG GG GG G G GG G Sbjct: 220 GGFYTDGQGSRNKGGSGGEGGKAFLHGGVGGRQFSSNSYGGFGGGG--GACGCNGGGAGG 277 Query: 677 GGXGXXGXG 651 GG G G G Sbjct: 278 GG-GYSGGG 285 Score = 28.3 bits (60), Expect = 8.7 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = -3 Query: 881 EXGKVVVXGGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGG 732 E GK + GG GG + G G GG GG GG GG Sbjct: 238 EGGKAFLHGGV---GGRQFSSNSYGGFGGGGGACGCNGGGAGGGGGYSGG 284 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 35.1 bits (77), Expect = 0.076 Identities = 22/62 (35%), Positives = 24/62 (38%), Gaps = 11/62 (17%) Frame = +3 Query: 597 KCXTHS**IXQXDSPPXXPPPX----PPPPPPXXXPPXXPX-------PPPPPXPXPPXP 743 +C THS + Q PPP P PP P PPPPP P PP P Sbjct: 1407 ECHTHSVQVKQTHHMAPAPPPPMAFPPMPPAPGQVITHLQHIVHHKILPPPPPPPAPPCP 1466 Query: 744 XP 749 P Sbjct: 1467 PP 1468 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 10/43 (23%) Frame = +1 Query: 673 PPPXXXPPXXPXPPXXXPPX----------PPPXPPXPPXXPP 771 PPP PP P P PPP PP PP PP Sbjct: 1426 PPPMAFPPMPPAPGQVITHLQHIVHHKILPPPPPPPAPPCPPP 1468 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 35.1 bits (77), Expect = 0.076 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGG--GGXGXXG-GXXXGG-GGGGXGGGXXGGE 635 GG G G G G GG GG G G G GG G G GGG GE Sbjct: 26 GGMAGEGMGRGGIAGGRMGGGGMAGEGMGRGGMAGEGMGGGGMAGE 71 Score = 35.1 bits (77), Expect = 0.076 Identities = 25/71 (35%), Positives = 26/71 (36%) Frame = -3 Query: 854 GXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGG 675 G +G GG R G G RGG G G GGG G G G G GG Sbjct: 30 GEGMGRGGIAGGRMGGG--GMAGEGMGRGGM-AGEGMGGGGMAGEGMGRGGMAGEGMGGG 86 Query: 674 GXGXXGXGXXG 642 G G G G Sbjct: 87 GMAGEGMGRGG 97 Score = 34.7 bits (76), Expect = 0.10 Identities = 24/73 (32%), Positives = 24/73 (32%) Frame = -1 Query: 853 GXXWGGGXXXXEGXXXXXXXXXXXXXXXGEXGGAXGXGXGGXGXGGGGGXGXXGGXXXGG 674 G GGG EG G G G G GGGG G G G Sbjct: 40 GGRMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGMAGEGMGGGGMAG-EGMGRGGI 98 Query: 673 GGGGXGGGXXGGE 635 G G GGG GE Sbjct: 99 AGEGMGGGGMAGE 111 Score = 32.7 bits (71), Expect = 0.41 Identities = 28/83 (33%), Positives = 29/83 (34%), Gaps = 9/83 (10%) Frame = -3 Query: 854 GXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXG---------GXGGXGGGXGGXXXGGXG 702 G +GGGG G G RGG G G G GGG G GG G Sbjct: 100 GEGMGGGGMAGEGMSRG--GIAGEGMGRGGMAGEGMGRGGMAGEGMGGGGMAGEGMGGGG 157 Query: 701 XXGGXXXGGGXGXXGXGXXGXGI 633 G GGG G G G I Sbjct: 158 MAGEGMGGGGIA--GEGISGGAI 178 Score = 31.5 bits (68), Expect = 0.94 Identities = 28/86 (32%), Positives = 31/86 (36%), Gaps = 5/86 (5%) Frame = -3 Query: 875 GKVVVXGGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGG---GXGGXXXGGX 705 G+ + GG GGG G+ G G G GG G G GG G Sbjct: 34 GRGGIAGGRMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGM 93 Query: 704 GXXG--GXXXGGGXGXXGXGXXGXGI 633 G G G GGG G G G GI Sbjct: 94 GRGGIAGEGMGGG-GMAGEGMSRGGI 118 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 G G G G G GGGG G G G G GG G S Sbjct: 142 GMGGGGMAGEGMGGGGMAGEGMGGGGIAGEGISGGAIFGAFES 184 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = -1 Query: 760 GGAXGXGXGGXGXGG----GGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G GG G G GGG G GGGG G G GG Sbjct: 136 GGMAGEGMGGGGMAGEGMGGGGMAGEG----MGGGGIAGEGISGG 176 >SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/38 (47%), Positives = 20/38 (52%) Frame = -1 Query: 742 GXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 G GG GG GG G GGGGG GGG G E++ Sbjct: 213 GKGGWENGGFGGGGSAMAHP-GGGGGYSGGGIEGSETT 249 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGG---XGXXGGXXXGGGGGG 662 E GG G G GGGGG G G G GGG Sbjct: 218 ENGGFGGGGSAMAHPGGGGGYSGGGIEGSETTGSAGGG 255 >SB_27284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGG----GGGGXGGGXXGG 638 + GG G G G GG G GG GG GG G GG GG Sbjct: 86 DSGGVGDDGGDGGGDDDSGGVGDDGGDDGGGDDDSGGVGDDGGDDGG 132 Score = 32.3 bits (70), Expect = 0.54 Identities = 23/55 (41%), Positives = 25/55 (45%), Gaps = 11/55 (20%) Frame = -1 Query: 766 EXGG---AXGXGXGGXGXGGG----GGXGXXGGXXXGG----GGGGXGGGXXGGE 635 E GG + G G G GGG GG G GG GG GG G GG GG+ Sbjct: 46 ERGGDDDSGGVGDDGGDDGGGDNDSGGFGDDGGDDSGGDDDSGGVGDDGGDGGGD 100 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 + GG G G G G G GG GG G GG GG+ Sbjct: 108 DDGGDDGGGDDDSGGVGDDGGDDGGGDDDSGGVGDDGGDDGGGD 151 Score = 31.9 bits (69), Expect = 0.71 Identities = 19/48 (39%), Positives = 22/48 (45%), Gaps = 4/48 (8%) Frame = -1 Query: 748 GXGXGGXGXGGG----GGXGXXGGXXXGGGGGGXGGGXXGGESSCXIY 617 G G G GGG GG G GG GGG G G GG+ + I+ Sbjct: 122 GVGDDGGDDGGGDDDSGGVGDDGGDD-GGGDDDSGSGVGGGDGNDNIF 168 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGX--GXXGGXXXGGGGGGXGGGXXGGE 635 G G GG GG G G GG GG G GG GG+ Sbjct: 74 GDDGGDDSGGDDDSGGVGDDGGDGGGDDDSGGVGDDGGDDGGGD 117 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 G G G G GG G GG GG G G GG+ S Sbjct: 40 GGDGVDERG-GDDDSGGVGDDGGDDGGGDNDSGGFGDDGGDDS 81 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -1 Query: 736 GGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 G GG G GG GG G GG GG++ Sbjct: 34 GDVDDDGGDGVDERGGDDDSGGVGDDGGDDGGGDN 68 Score = 28.3 bits (60), Expect = 8.7 Identities = 19/43 (44%), Positives = 20/43 (46%), Gaps = 5/43 (11%) Frame = -1 Query: 748 GXGXGGXGXGGG----GGXGXXGGXXXGGGGGGXGG-GXXGGE 635 G G G GGG GG G GG GGG GG G GG+ Sbjct: 105 GVGDDGGDDGGGDDDSGGVGDDGGDD-GGGDDDSGGVGDDGGD 146 >SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 G G G GG GG G GGGGG GGG Sbjct: 329 GSGGSGTSEGGFGGGGATVASRPGGGGGYSGGG 361 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 G GG G GGG GG GG GGG Sbjct: 344 GATVASRPGGGGGYSGGGLASSGGSTLSSEGGVAGGG 380 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXG 656 GG G GG GG GG GGG G Sbjct: 352 GGGGGYSGGGLASSGGSTLSSEGGVAGGGGSYNNG 386 >SB_13751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 853 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/46 (41%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = -1 Query: 766 EXGGAXGXGXG-GXGXGGGGGXGXXGGXXXG-GGGGGXGGGXXGGE 635 + G G G G G G G G G G G G G G G GGG G+ Sbjct: 767 DDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGAGAGDGGGDGDGD 812 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = -1 Query: 760 GGAXGXGXG-GXGXGGGGGXGXXGGXXXGGGGG---GXGGG 650 G G G G G G G G G G GG G G G G G G Sbjct: 783 GDGDGDGDGDGDGDGDGAGAGDGGGDGDGDGDGDGDGDGAG 823 >SB_55443| Best HMM Match : Homeobox (HMM E-Value=2.3e-26) Length = 245 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 P P PPPP PP P PPP P P P Sbjct: 182 PFQYPGTPPPPMYPAFPPIFPSSPPPEYPGLPVSSP 217 >SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) Length = 154 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 P P PPPP PP P PPP P P P Sbjct: 92 PFQYPGTPPPPMYPAFPPSFPSSPPPEYPGLPVSSP 127 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXP--PXPPPXPPXPPXXP 768 P P P PPP P P P P PP P PP P Sbjct: 67 PQPTQGFRPYPGPPPALSPQVYRGYPFQYPGTPPPPMYPAFPPSFP 112 >SB_14695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 P P PPPP PP P PPP P P P Sbjct: 145 PFQYPGTPPPPMYPAFPPSFPSSPPPEYPGLPVSSP 180 >SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 P P PPPP PP P PPP P P P Sbjct: 182 PFQYPGTPPPPMYPAFPPIFPSSPPPEYPGLPVSSP 217 >SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) Length = 245 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 P P PPPP PP P PPP P P P Sbjct: 182 PFQYPGTPPPPMYPAFPPSFPSSPPPEYPGLPVSSP 217 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXP--PXPPPXPPXPPXXP 768 P P P PPP P P P P PP P PP P Sbjct: 157 PQPTQGFRPFPGPPPVLSPQVYRGYPFQYPGTPPPPMYPAFPPSFP 202 >SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) Length = 245 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXP 749 P P PPPP PP P PPP P P P Sbjct: 182 PFQYPGTPPPPMYPAFPPSFPFSPPPEYPGLPVSSP 217 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXP--PXPPPXPPXPPXXP 768 P P P PPP P P P P PP P PP P Sbjct: 157 PQPTQGFRPYPGPPPVLSPQVYRCYPFQYPGTPPPPMYPAFPPSFP 202 >SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) Length = 491 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/70 (30%), Positives = 28/70 (40%), Gaps = 2/70 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXG--GGXXGGESSCXIYQEXVXHFLXR 587 GGA GG G G G G GGGGGG G G G + C + + H Sbjct: 387 GGAGMQSFGGGGMAGMQFGGMQGFPSLGGGGGGAGMMAGQMGYKKVCPNNLDNITHLKNV 446 Query: 586 VHTQRVYYTI 557 + Q ++ + Sbjct: 447 LELQTLHLEV 456 Score = 28.7 bits (61), Expect = 6.6 Identities = 20/72 (27%), Positives = 22/72 (30%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG + G G+ G GG GGG G GG G G Sbjct: 327 GGGSMQSLGGDAGGSMQGLAGGGGIQSFGGGGGADLQTLGGGGGVQTLGGQTMQGVQSYG 386 Query: 677 GGXGXXGXGXXG 642 GG G G G Sbjct: 387 GGAGMQSFGGGG 398 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGG--GGXGGGXXGGE 635 G GG GGGGG G GG GG GG G GG+ Sbjct: 1265 GGSSGGGMHGGGGGYGNYGGYGGYGGNPQGGYGFAGYGGQ 1304 Score = 31.5 bits (68), Expect = 0.94 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGG 662 GG G G G GGGG GG GG G Sbjct: 806 GGGYNRGYGSGGGYGGGGYNKRGGRYSGGSNWG 838 Score = 31.5 bits (68), Expect = 0.94 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -1 Query: 760 GGAXGXGX-GGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG 641 GG G G GG G GG G G GG GG GG G Sbjct: 1274 GGGGGYGNYGGYGGYGGNPQGGYGFAGYGGQYGGPRGGGSG 1314 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 G G GGG G G GGG GG G GG S Sbjct: 793 GWGGNRDNYSRGGGGGYNRGYGSGGGYGGGGYNKRGGRYS 832 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -3 Query: 773 RGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXG 651 RGG GG GGG G GG G GG GG G G G Sbjct: 1264 RGGSSGGGMHGGGGGYG-NYGGYGGYGGNPQ-GGYGFAGYG 1302 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 727 GXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 G GGG G G GGGG GG G S+ Sbjct: 804 GGGGGYNRGYGSGGGYGGGGYNKRGGRYSGGSN 836 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 773 RGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGG 675 RGG G G G G GG GG GG GG Sbjct: 803 RGGGGGYNRGYGSG-GGYGGGGYNKRGGRYSGG 834 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 742 GXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG 641 G GG G G G G GG GG GG G Sbjct: 805 GGGGYNRGYGSGGGYGGGGYNKRGGRYSGGSNWG 838 >SB_27771| Best HMM Match : SH2 (HMM E-Value=8.6e-16) Length = 896 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXA 755 P P P PP PP P P P P PP P A Sbjct: 130 PQHPTPQHSPPIRKQTPPSKPHPSPTPAQAPPHSRPVA 167 >SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 406 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +1 Query: 610 IPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 IP+ P P P P P P P P P PP P P PP P Sbjct: 238 IPNTSIPPTPTPHTSIP--PTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTP 289 Score = 32.7 bits (71), Expect = 0.41 Identities = 23/77 (29%), Positives = 25/77 (32%), Gaps = 3/77 (3%) Frame = +1 Query: 550 AHILYSXHAVYVPYXRNVXXIPDKXXKXIPXPXXPXPXXPXPP---PXXXPPXXPXPPXX 720 A +L A +P N IP P P P PP P P P P Sbjct: 224 ASLLPHIQASLLPLIPNTS-IPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTS 282 Query: 721 XPPXPPPXPPXPPXXPP 771 PP P P PP P Sbjct: 283 IPPTPTPHTSIPPTPHP 299 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 3/36 (8%) Frame = +3 Query: 663 PPPPPPXXXPPXXPX---PPPPPXPXPPXPXPXAPP 761 PP P P P P PP P PP P PP Sbjct: 163 PPTPHPTYKHPSYPTYNIPPTPHTSIPPTPHTSIPP 198 >SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) Length = 1258 Score = 34.3 bits (75), Expect = 0.13 Identities = 22/62 (35%), Positives = 24/62 (38%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG +GGGG+ G G GG GG G GGG G G GG G Sbjct: 1082 GGAAMGGGGQQPMMMGGG-QGMMMGNAMGGGMGGGMGMQGGGMGMQGGGMGMQDGGMGMG 1140 Query: 677 GG 672 G Sbjct: 1141 DG 1142 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GGA G G GGG G G GGG GG G GG Sbjct: 1082 GGAAMGGGGQQPMMMGGGQGMMMGNAMGGGMGGGMGMQGGG 1122 Score = 28.3 bits (60), Expect = 8.7 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = -1 Query: 760 GGAXGXGXG---GXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG G G G G GGG G G GGG G GG G+ Sbjct: 1097 GGGQGMMMGNAMGGGMGGGMGMQGGGMGMQGGGMGMQDGGMGMGD 1141 >SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -3 Query: 881 EXGKVVVXGGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXG 726 E V GG GGGG GV G P TP G G GGG G Sbjct: 411 EGSPSVFLGGGGRGGGGGDGGGGGEGVQGTPYTPEEEEGRALQACGRGGGGG 462 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGG 653 G+ GG G GGGGG G GGGG G G Sbjct: 412 GSPSVFLGGGGRGGGGGDG-------GGGGEGVQG 439 >SB_55729| Best HMM Match : YajC (HMM E-Value=0.56) Length = 654 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -1 Query: 727 GXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSC 626 G GGG G GG G GGG G G +S C Sbjct: 2 GDGGGDGDDGDGGGDDGVDGGGVGDDGDGDDSDC 35 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXG-GGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 + GG G GG G GGG G G G GG GG+ Sbjct: 3 DGGGDGDDGDGGGDDGVDGGGVGDDGDGDDSDCGDDGGGDDDGGD 47 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXP 728 PP PP PP PP P P PP P Sbjct: 26 PPTDPPTDPPTDPPTDPPTDPPTDPPTDPP 55 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPP 737 PP PP PP P P PP P P Sbjct: 26 PPTDPPTDPPTDPPTDPPTDPPTDPPTDP 54 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 PP PP P PP P PP P P Sbjct: 26 PPTDPPTDPPTDPPTDPPTDPPTDPPTDPP 55 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 676 PPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 PP P P P PP P P PP PP Sbjct: 26 PPTDPPTDPPTDPPTDPPTDP--PTDPPTDPP 55 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 666 PPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P PP P P P PP P PP Sbjct: 26 PPTDPPTDPPTDP--PTDPPTDPPTDPPTDPP 55 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPP 750 P PP P P P PP PP P Sbjct: 27 PTDPPTDPPTDPPTDPPTDPPTDPPTDP 54 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPPPPXPXPP 737 P PP PP PP PPPP P PP Sbjct: 230 PKPPTAPPNTPPPPVT-PPPPNTPGPP 255 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPP 713 P PP PPPP PP P PP Sbjct: 232 PPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 31.9 bits (69), Expect = 0.71 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 673 PPPXXXPPXXPXPPXXXPPXPPPXPP 750 P P PP P PP PP P PP Sbjct: 230 PKPPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 675 PPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 P PP P PPP PP P PP Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPP-PPPXPXPPXP 743 P P P PP P PP PP P P P Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTPGP 254 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +3 Query: 639 PPXXPPPXPPP--PPPXXXPPXXPXPPPP 719 P PP PP PPP PP P PP Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPP 714 P P P P PP PP P PP Sbjct: 230 PKPPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 1/26 (3%) Frame = +1 Query: 694 PXXPXPPXXXP-PXPPPXPPXPPXXP 768 P P PP P PPP P PP P Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTP 252 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPP 695 +PP PPP PPPP P Sbjct: 235 APPNTPPPPVTPPPPNTPGP 254 >SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 386 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 727 GXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G GGG G GGG GG GGG GG Sbjct: 74 GAGGGAGFEDILSHIFGGGSGGFGGGLFGG 103 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 733 GXGXGGGGGXGXXGGXXXGGGGGG 662 G G GG GG G GG GGG GG Sbjct: 90 GGGSGGFGG-GLFGGMPFGGGMGG 112 >SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) Length = 676 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 + GG G GG G GG GG GG G G GG++ Sbjct: 591 DGGGGDGDYNGGDGDYNGGDGDYNGGDDDYNGGDGDSNGGDGGDN 635 Score = 29.1 bits (62), Expect = 5.0 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXG---GXXXGGGGGGXGGGXXGGE 635 GG G G GGGGG G G GGGG G GG+ Sbjct: 560 GGDYNGGDGDDDDGGGGGDDDDGDGDGDDDDDGGGGDG-DYNGGD 603 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 + G G GG G GG GG GG G G G+ Sbjct: 598 DYNGGDGDYNGGDGDYNGGDDDYNGGDGDSNGGDGGDNGTGDGD 641 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -1 Query: 727 GXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G GGG G G GGGGG G G+ Sbjct: 557 GGGGGDYNGGDGDDDDGGGGGDDDDGDGDGD 587 >SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) Length = 556 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 G G GG GG G G GGGG GGG Sbjct: 519 GGGAIGDGGDNGGGDDGGDDGAGNSDGGGGNDNGGG 554 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GA G G G GG G G GG G G GG GG Sbjct: 516 GAIGGG--AIGDGGDNGGGDDGGDDGAGNSDGGGGNDNGG 553 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG 641 + G G G G GGG G G GGGG G G Sbjct: 514 DDGAIGGGAIGDGGDNGGGDDGGDDGAGNSDGGGGNDNGGGG 555 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G G GG G G GG G G GGG G Sbjct: 513 GDDGAIGGGAIGDGGDNGGGDDGGDD-GAGNSDGGGGNDNG 552 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXG-GGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 G G G G G G G G GGGG GG GG + Sbjct: 448 GAIGGGGDGAIGSAIGDGVNSDDGAIGCDGGGGANVGGDIGGNN 491 Score = 28.3 bits (60), Expect = 8.7 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 8/49 (16%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGG--------GGGGXGGGXXGGE 635 G G GG G GGGG G G G G G GG GG+ Sbjct: 438 GDGAIGGGGDGAIGGGGDGAIGSAIGDGVNSDDGAIGCDGGGGANVGGD 486 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 5/37 (13%) Frame = +3 Query: 633 DSPPXXPPPX-----PPPPPPXXXPPXXPXPPPPPXP 728 + PP PPP PPPPP PPPPP P Sbjct: 48 ERPPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXP-XPPXPXPXAPP 761 PPPPPP P PPPP P P PP Sbjct: 51 PPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 12/45 (26%) Frame = +3 Query: 651 PPPXPPPPP------PXXXPPXXPXPPPPPXP------XPPXPXP 749 PPP PP P P P PPPPP P PP P P Sbjct: 25 PPPPPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPPP 69 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/52 (26%), Positives = 18/52 (34%) Frame = +1 Query: 586 PYXRNVXXIPDKXXKXIPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPP 741 P+ RN+ + + P P P P PP PP PPP Sbjct: 33 PFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 >SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +1 Query: 673 PPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXT 804 PP P P P P PPP PP P PP G P T Sbjct: 115 PPAPTSVPSGPRAPPGGPGAPPP-PPPPAVVPPSAVTTDGKPAT 157 Score = 31.9 bits (69), Expect = 0.71 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPP 695 +PP P PPPPPP PP Sbjct: 127 APPGGPGAPPPPPPPAVVPP 146 Score = 31.5 bits (68), Expect = 0.94 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPP 737 P P P P P P PPPPP PP Sbjct: 115 PPAPTSVPSGPRAPPGGPGAPPPPPPPAVVPP 146 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 669 PPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 PP P P PP P PP P P P S Sbjct: 115 PPAPTSVPSGPRAPPGGPGAPPPPPPPAVVPPS 147 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 PP P PP P PPPP P P Sbjct: 115 PPAPTSVPSGPRAPPGGPGAPPPPPPPAVVP 145 >SB_52712| Best HMM Match : Dynein_light (HMM E-Value=3) Length = 404 Score = 33.9 bits (74), Expect = 0.18 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -1 Query: 679 GGGGGGXGGGXXGGESSC 626 GGGGGG GGG GG++ C Sbjct: 62 GGGGGGCGGGRGGGDARC 79 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -1 Query: 736 GGXGXGGGGGXGXXGGXXXGGGGGGXG 656 GG G GGGGG G GG GG GG G Sbjct: 1003 GGGGGGGGGGGG--GGGRRGGRGGARG 1027 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/54 (33%), Positives = 22/54 (40%) Frame = -1 Query: 715 GGGXGXXGGXXXGGGGGGXGGGXXGGESSCXIYQEXVXHFLXRVHTQRVYYTIC 554 GGG G GG GGG G GG G ++ + V H R V + C Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGGARGRRATTTTTRRCVTHKTQRADGTHVTRSNC 1056 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 773 RGGXXGGXGGXGGGXGGXXXGGXGXXG 693 RGG GG GG GGG GG G G G Sbjct: 1002 RGGGGGGGGGGGGG-GGRRGGRGGARG 1027 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 33.9 bits (74), Expect = 0.18 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +3 Query: 639 PPXXPPPXPPPPPP 680 PP PPP PPPPPP Sbjct: 211 PPPPPPPPPPPPPP 224 Score = 33.5 bits (73), Expect = 0.23 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPP 680 D+ P PPP PPPPPP Sbjct: 208 DAKPPPPPPPPPPPPP 223 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 651 PPPXPPPPPPXXXP 692 PPP PPPPPP P Sbjct: 211 PPPPPPPPPPPPPP 224 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 654 PPXPPPPPPXXXPP 695 PP PPPPPP PP Sbjct: 211 PPPPPPPPPPPPPP 224 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 702 PXPPPPPXPXPPXP 743 P PPPPP P PP P Sbjct: 211 PPPPPPPPPPPPPP 224 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 708 PPPPPXPXPPXPXP 749 PPPPP P PP P P Sbjct: 211 PPPPPPPPPPPPPP 224 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +1 Query: 724 PPXPPPXPPXPPXXPPL 774 PP PPP PP PP PP+ Sbjct: 211 PPPPPPPPPPPP--PPM 225 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPP 719 PPPPPP PP P PPPP Sbjct: 211 PPPPPP---PP--PPPPPP 224 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 727 PXPPPXPPXPPXXPPL 774 P PPP PP PP P L Sbjct: 211 PPPPPPPPPPPPPPML 226 >SB_8478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1033 Score = 33.9 bits (74), Expect = 0.18 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -1 Query: 679 GGGGGGXGGGXXGGESSC 626 GGGGGG GGG GG++ C Sbjct: 806 GGGGGGCGGGRGGGDARC 823 >SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) Length = 619 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 D+P PP PP P P P PP P P P APP Sbjct: 43 DTPHYHQPPPPPTRPSHSCGPH----PVPPTPLVQHPEPEAPP 81 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPP 737 P PP PPPPP P PP P P Sbjct: 77 PEAPPQLPPPPPFIVDDTESPQEQPPTTPVSP 108 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXP---PPXPPXPPXXPP 771 P PPP P P PP P P P PP PP Sbjct: 45 PHYHQPPPPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPP 85 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/46 (32%), Positives = 15/46 (32%), Gaps = 2/46 (4%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPP--XXXPPXPPPXPPXPPXXP 768 P P P P P P P P PP P PP P P Sbjct: 63 PHPVPPTPLVQHPEPEAPPQLPPPPPFIVDDTESPQEQPPTTPVSP 108 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 4/40 (10%) Frame = +3 Query: 627 QXDSPPXXPP----PXPPPPPPXXXPPXXPXPPPPPXPXP 734 Q PP P P P PP P P PP P P P Sbjct: 49 QPPPPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPPP 88 >SB_34601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1391 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/37 (48%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -1 Query: 742 GXGGXGXG-GGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G GG G G GG G G GG G G GG G G G+ Sbjct: 1130 GDGGNGDGDGGNGDG-DGGNGDGDGDGGNGDGDGDGD 1165 Score = 31.9 bits (69), Expect = 0.71 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 G G G G GG G G G GG G G G Sbjct: 1130 GDGGNGDGDGGNGDGDGGNGDGDGDGGNGDGDG 1162 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXP-----PXPXPXAP 758 P PPP P P P P PPP P P P P AP Sbjct: 529 PTGPPPPPVPKPQFDDTPTRAPPPPDMQTNPDTERRPPPLPPAP 572 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXP--XPPPPPXPXPPXPXPXAPP 761 S P P PPPP P P PPPP P PP Sbjct: 524 SRPVRPTGPPPPPVPKPQFDDTPTRAPPPPDMQTNPDTERRPPP 567 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 718 GGGGXGXXGGXXXGGGGGGXGGG 650 GGGG G GG GGG GG G G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRG 536 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 773 RGGXXGGXGGXGGGXGGXXXGGXG 702 RGG GG GG GGG GG G G Sbjct: 513 RGGGGGGGGGGGGGGGGRGGRGRG 536 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 694 GGXXXGGGGGGXGGGXXGG 638 GG GGGGGG GGG GG Sbjct: 514 GGGGGGGGGGGGGGGGRGG 532 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -1 Query: 721 GGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GGGGG G GG GGGGGG GG G Sbjct: 514 GGGGGGG--GG---GGGGGGGRGGRGRG 536 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/21 (61%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGG-GGXG 701 GG G G GG G GGG GG G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRG 534 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 33.5 bits (73), Expect = 0.23 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPP 722 P P P PPPP P PPPPP Sbjct: 190 PDESPEPTRPPPPLDDLDDLPPPPPPPP 217 Score = 32.3 bits (70), Expect = 0.54 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPP 722 PPP PPPP PPPPP Sbjct: 210 PPPPPPPPEDDSIHNHEDLPPPPP 233 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXP 728 P P PPPP P PPPPP P Sbjct: 190 PDESPEPTRPPPPLDDLDDLP-PPPPPPP 217 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPP 719 D PP PPP PP P PPPP Sbjct: 208 DLPP--PPPPPPEDDSIHNHEDLPPPPPP 234 >SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 PPP P P P P P P P P P PP S Sbjct: 57 PPPGPGQPEMPGQPQVTPQTPSPASPGLPFMPPPPPPPS 95 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 643 PXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P P P PPP P P P P P P P P PP Sbjct: 48 PGWPQMGMP-PPPGPGQPEMPGQPQVTPQTPSPASPGLPFMPP 89 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/73 (26%), Positives = 25/73 (34%), Gaps = 1/73 (1%) Frame = +1 Query: 535 WFSXTAHILYSXHAVYVPYXRNVXXIPDKXXKXIPXPXXPX-PXXPXPPPXXXPPXXPXP 711 W + +LY+ + +P P +P P P P P P P Sbjct: 22 WDNKAVFLLYTELIMGMPMMGQFGMFPGWPQMGMPPPPGPGQPEMPGQPQVTPQTPSPAS 81 Query: 712 PXXXPPXPPPXPP 750 P P PPP PP Sbjct: 82 PGL-PFMPPPPPP 93 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 627 QXDSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 Q PP P P P P P P P P P P P PP Sbjct: 52 QMGMPPPPGPGQPEMPGQPQVTPQTPSPASPGLPFMPPPPP--PP 94 >SB_40892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 + GG G G GGGG G GGGG G GG Sbjct: 152 DAGGGGGSDHDGDDAAGGGGSDDDGYDAAGGGGSDDDGDDGGG 194 Score = 31.9 bits (69), Expect = 0.71 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 + GG G G GGGGG G GGGG G G Sbjct: 22 DAGGGGGSDDDGYDAGGGGGSYDDGYDAAGGGGSDDDGYDAAG 64 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 + G G G GGGGG G GGGG G G Sbjct: 139 DAAGGGGSDDDGDDAGGGGGSDHDGDDAAGGGGSDDDGYDAAG 181 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 + GG G G GGGG G GGGG G G Sbjct: 35 DAGGGGGSYDDGYDAAGGGGSDDDGYDAAGGGGSDHDGDDAAG 77 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 + G G G GGGG G GGGG G GG Sbjct: 61 DAAGGGGSDHDGDDAAGGGGSDDDGYDAAGGGGSDHDGYDAGG 103 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGG 653 + G G G GGGGG G GGGG G Sbjct: 87 DAAGGGGSDHDGYDAGGGGGSDDDGYDAAGGGGSDHDG 124 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 + G G G GGGG G GGGG G G Sbjct: 48 DAAGGGGSDDDGYDAAGGGGSDHDGDDAAGGGGSDDDGYDAAG 90 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 + GG G GGGGG G GGGGG G Sbjct: 9 DDGGGGDSYDDGDDAGGGGG-SDDDGYDAGGGGGSYDDG 46 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -1 Query: 718 GGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GGGG G GGGGG G G Sbjct: 11 GGGGDSYDDGDDAGGGGGSDDDGYDAG 37 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G GGGG G GGGG G G Sbjct: 129 GDGGSDDDGYDAAGGGGSDDDGDDAGGGGGSDHDGDDAAG 168 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGG 671 GG G G G GGGGG GG GG Sbjct: 470 GGGSGYGGGSSSRGGGGGRSSSGGNSRSGG 499 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = -1 Query: 721 GGGGGXGXXGGXXXGGGGGG---XGGGXXGGESS 629 G GGG G GG GGGGG GG G SS Sbjct: 468 GYGGGSGYGGGSSSRGGGGGRSSSGGNSRSGGSS 501 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -1 Query: 736 GGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 GG G GGG GG GG GG Sbjct: 471 GGSGYGGGSSSRGGGGGRSSSGGNSRSGG 499 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXP 704 +PP PPP PP PPP PP P Sbjct: 141 NPP--PPPPPPSPPPPCHPPALP 161 Score = 31.5 bits (68), Expect = 0.94 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 702 PXPPPPPXPXPPXPXPXAP 758 P PPPPP P PP P P Sbjct: 143 PPPPPPPSPPPPCHPPALP 161 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPP 716 P PPPPPP PP P P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPP 722 PPPPPP PP PP P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 724 PPXPPPXPPXPPXXPP 771 PP PPP P PP PP Sbjct: 143 PPPPPPPSPPPPCHPP 158 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 711 PPPPXPXPPXPXPXAPP 761 PPPP P P P P PP Sbjct: 142 PPPPPPPPSPPPPCHPP 158 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 702 PXPPPPPXPXPPXPXPXAPP 761 P PPPPP PP P A P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 >SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG 641 E G G G G G G G GGG GG GGG G Sbjct: 215 ETKGLVKLDGAGHGRTAGVGAGSDSGVGSGGGYGGVGGGSGG 256 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 767 GXXGGXGGXGGGXGGXXXGGXGXXGGXXXGGGXGXXGXG 651 G GG GG GGG GG G GGG G G Sbjct: 242 GSGGGYGGVGGGSGGIAYGSVFKPVDLGSGGGGSWGGAG 280 Score = 31.9 bits (69), Expect = 0.71 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGG----XXXGGGGGGXGGGXXGG 638 G G G G GGG G G G GGGG GG GG Sbjct: 242 GSGGGYGGVGGGSGGIAYGSVFKPVDLGSGGGGSWGGAGGG 282 Score = 31.5 bits (68), Expect = 0.94 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGG-GXGXXGGXXXGGGGGGXGGGXXGGESSCXIYQEXVXH 599 + G G G GG G G GG G G GGG G GG I + + H Sbjct: 238 DSGVGSGGGYGGVGGGSGGIAYGSVFKPVDLGSGGGGSWGGAGGGCLRWIISKIIHH 294 >SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPP 722 PP PP PP PP P PPPPP Sbjct: 29 PPEAPPLPPFAPLPP--PVPPPPP 50 Score = 31.5 bits (68), Expect = 0.94 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXP 734 PP PP PP P PPP P P P Sbjct: 29 PPEAPPL--PPFAPLPPPVPPPPP 50 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 691 PPXXPXPPXXXPPXPPPXPPXPP 759 P P PP P PPP PP PP Sbjct: 30 PEAPPLPPFA--PLPPPVPPPPP 50 >SB_19205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 E GG G G G G G G G GGG G G GG+S Sbjct: 74 ESGGDDGNSSGESG--GDGDDGNRSGESGGGGDDGNSSGETGGDS 116 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 E GG G GGGG G G G G G GG+ Sbjct: 85 ESGGDGDDGNRSGESGGGGDDGNSSGETGGDSDDGNRSGESGGD 128 >SB_51094| Best HMM Match : VWA (HMM E-Value=0) Length = 3544 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXG 656 GGA G G G G GG G GGGGG G Sbjct: 3284 GGAAGSS-GSIGAGAAGGAGAVAAVAVSGGGGGGG 3317 Score = 32.3 bits (70), Expect = 0.54 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 8/49 (16%) Frame = -1 Query: 733 GXGXGGGGG--------XGXXGGXXXGGGGGGXGGGXXGGESSCXIYQE 611 G G GGGGG G G GGGGG GG E + Y E Sbjct: 3197 GAGEGGGGGGESLAMTVTGLEAGGYSAGGGGGGAGGAAYAEMTTTTYTE 3245 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GA G G G GG GG GGG G G G Sbjct: 3257 GASGSGAAVGGAGGAGGASAYMMSASGGGAAGSSGSIGAG 3296 >SB_28064| Best HMM Match : DUF1174 (HMM E-Value=4.5) Length = 404 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSCXIY 617 GG G G G G GG G G G G G G G GG Y Sbjct: 203 GGNKGIGEHGTGLGGNKGIGEYGTGLGGNKGIGEHGTGLGGNKGIGEY 250 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXG-GXXXGGGGGGXGGGXXGGESSC 626 GG G G G G GG G G G G G G G G G + C Sbjct: 255 GGNKGIGEYGTGLGGNKGIGEHGTGLGGNKGKGEYGTGLGGNKGKC 300 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSCXIY 617 GG G G G G GG G G G G G G G GG Y Sbjct: 333 GGNKGKGEYGTGLGGNKGIGEHGTGLAGNKGKGEYGTGLGGNKGIDEY 380 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSCXIY 617 GG G G G G GG G G G G G G G GG Y Sbjct: 216 GGNKGIGEYGTGLGGNKGIGEHGTGLGGNKGIGEYGTGLGGNKGIGEY 263 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G G G GG G G G G G G G GG Sbjct: 229 GGNKGIGEHGTGLGGNKGIGEYGTGLGGNKGIGEYGTGLGG 269 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G G G GG G G G G G G G GG Sbjct: 242 GGNKGIGEYGTGLGGNKGIGEYGTGLGGNKGIGEHGTGLGG 282 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSCXIY 617 G G G G G GG G G G G G G G GG Y Sbjct: 68 GNKGIGEYGTGLGGNKGIGEYGTGLAGNKGIGEYGTGLGGNKGIGEY 114 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSCXIY 617 GG G G G GG G G G G G G G GG Y Sbjct: 41 GGNKGKGEYDTGLGGNKGIGEYGTGLAGNKGIGEYGTGLGGNKGIGEY 88 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/64 (31%), Positives = 21/64 (32%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG G G+ G PP G GG G G GG G G G G Sbjct: 534 GGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPG 593 Query: 677 GGXG 666 G G Sbjct: 594 AGQG 597 Score = 33.1 bits (72), Expect = 0.31 Identities = 23/77 (29%), Positives = 26/77 (33%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXG 678 GG G G+ + G G PP G GG G G G G G GG Sbjct: 545 GGPPPPGAGQGWGQPPPGA-GQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPP 603 Query: 677 GGXGXXGXGXXGXGIXL 627 G G G G+ L Sbjct: 604 GAGQGWGLPPPGSGLHL 620 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P PPP P PP PPP PP G G P P Sbjct: 547 PPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPP 603 Score = 31.9 bits (69), Expect = 0.71 Identities = 21/69 (30%), Positives = 23/69 (33%), Gaps = 1/69 (1%) Frame = -3 Query: 839 GGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXG-GXXXGGXGXXGGXXXGGGXGX 663 GGG+ + G PP G GG G G G G G G GG G Sbjct: 485 GGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQG 544 Query: 662 XGXGXXGXG 636 G G G Sbjct: 545 GGPPPPGAG 553 Score = 30.7 bits (66), Expect = 1.6 Identities = 23/75 (30%), Positives = 25/75 (33%), Gaps = 1/75 (1%) Frame = -3 Query: 857 GGXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXG-GXXXGGXGXXGGXXX 681 GG G G+ + G PP G GG G G G G G G GG Sbjct: 512 GGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPP 571 Query: 680 GGGXGXXGXGXXGXG 636 G G G G G Sbjct: 572 PGA-GQGGPPPPGAG 585 >SB_31182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1280 Score = 27.5 bits (58), Expect(2) = 0.31 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 636 SPPXXPPPXPPPPPP 680 +P PP PPPPPP Sbjct: 1056 NPVVKPPSYPPPPPP 1070 Score = 24.2 bits (50), Expect(2) = 0.31 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 702 PXPPPPPXPXPP 737 P PPPP P PP Sbjct: 1062 PSYPPPPPPKPP 1073 >SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) Length = 246 Score = 32.7 bits (71), Expect = 0.41 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 673 PPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPP 771 P PP PP PP PPP P PP Sbjct: 152 PSSSLLPPPSSSPPLSSPPPPPPSTPSSSLLPP 184 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXP 728 P PP PPPPP P PPP P Sbjct: 160 PSSSPPLSSPPPPPPSTPSSSLLPPPSSSP 189 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 P P PPP PP PPPP P P PP S Sbjct: 148 PSSTPSSSLLPPPSSSPPLSSPPPPP--PSTPSSSLLPPPSS 187 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPP-XPXPXAPP 761 +P P PPP P P PPPP P P P + P Sbjct: 147 APSSTPSSSLLPPPSSSPPLSSPPPPPPSTPSSSLLPPPSSSP 189 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPP----PPXPXPPXPXPXAPP 761 PP PP PPP PP PPP P P P PP Sbjct: 285 PPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQGRPPPFVRPPP 329 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +3 Query: 636 SPPXXPPPXPPPP--PPXXXPPXXPXPPPPPXPXPP 737 +PP PP PPP PP P PPP PP Sbjct: 274 APPGFPPRWGPPPHMPPDYRGFPPPNFPPPDFSRPP 309 >SB_48544| Best HMM Match : TSP_1 (HMM E-Value=3.1e-32) Length = 326 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 754 AXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 A G G G G G G G GG G G G G GGE S Sbjct: 266 ASGSGSGFVSSGSGSGSGSRGGSGSGEGSGASDEG-SGGEGS 306 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 G G G GG G G G GG G G G Sbjct: 277 GSGSGSGSRGGSGSGEGSGASDEGSGGEGSGDG 309 >SB_10487| Best HMM Match : FGF (HMM E-Value=1.4e-06) Length = 617 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -1 Query: 715 GGGXGXXGGXXXGGGGGGXGGGXXGGESSCXIYQE 611 GGG G GG GGG G GG+ C + E Sbjct: 523 GGGDDGDGIDCDGGDGGGGSNGDGGGDGDCDVNGE 557 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 754 AXGXGXGGXGXGGGGGXGXXGGXXXGGGGG 665 A G GG G GG G GG GG GG Sbjct: 296 AGGTAEGGNAGGNGGNAGGNGGMTGGGAGG 325 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXG 702 GG GG GG GG GG GG G Sbjct: 302 GGNAGGNGGNAGGNGGMTGGGAG 324 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = -1 Query: 736 GGXGXGG---GGGXGXXGGXXXGGGGGGXGGGXXGGE 635 GG GG GG G GG GG GG GG GGE Sbjct: 292 GGITAGGTAEGGNAGGNGG--NAGGNGGMTGGGAGGE 326 >SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) Length = 178 Score = 32.7 bits (71), Expect = 0.41 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = -1 Query: 760 GGAXGXG-XGGXGXGGGGGXGXXGGXXXGGGGG--GXGGGXXGG 638 GG G G GG G G G G G G G GG G G G GG Sbjct: 39 GGGHGGGHGGGRGRGRGHGHGGDVGGDDGDGGNCDGDGYGDVGG 82 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 GG G G G G GG GG G G G GGG Sbjct: 47 GGGRGRGRGHGHGGDVGGDDGDGGNCDGDGYGDVGGG 83 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -1 Query: 733 GXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESSC 626 G G GGG G G G G G GG GG G +C Sbjct: 39 GGGHGGGHGGGR--GRGRGHGHGGDVGGDDGDGGNC 72 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXG--GGGGGXGGGXXGGESSCXIY 617 G G G GG G G G G G GGGG G +SC Y Sbjct: 51 GRGRGHGHGGDVGGDDGDGGNCDGDGYGDVGGGGDDDDGAAIAIASCSNY 100 >SB_51163| Best HMM Match : Adeno_PIX (HMM E-Value=0.96) Length = 772 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 718 GGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GGG GG G GG G GGG GG Sbjct: 512 GGGSHEMGGGMEEGAGGMGGGGGAGGG 538 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 742 GXGGXGXGGGGGXGXXGGXXXGGGGGGXGG 653 G GG GGG G GGGG G GG Sbjct: 510 GQGGGSHEMGGGMEEGAGGMGGGGGAGGGG 539 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 721 GGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G GGG GG G GG GGG GG Sbjct: 510 GQGGGSHEMGGGMEEGAGGMGGGGGAGG 537 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 G G G GGG G G GGGGG GGG Sbjct: 510 GQGGGSHEMGGGMEEGAGG---MGGGGGAGGGG 539 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXG 701 E GG G GG G GGG G G Sbjct: 517 EMGGGMEEGAGGMGGGGGAGGG 538 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 715 GGGXGXXGGXXXGGGGGGXGGGXXG 641 GGG G GG GGGGGG G G G Sbjct: 3698 GGGYGGGGGGY-GGGGGGYGDGTGG 3721 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 736 GGXGXGGGGGXGXXGGXXXGGGGGGXG 656 GG G GGGG G GG G GG G Sbjct: 3699 GGYGGGGGGYGGGGGGYGDGTGGAAFG 3725 Score = 31.9 bits (69), Expect = 0.71 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXG 677 GG G G GG G GGGG GG G Sbjct: 3698 GGGYGGGGGGYGGGGGGYGDGTGGAAFG 3725 Score = 31.5 bits (68), Expect = 0.94 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 770 GGXXGGXGGXGGGXGGXXXGGXGXXGG 690 GG GG GG GGG GG G G G Sbjct: 3699 GGYGGGGGGYGGGGGGYGDGTGGAAFG 3725 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 736 GGXGXGGGGGXGXXGGXXXGGGGGGXGG 653 GG GGGGG G GG G GG G Sbjct: 3698 GGGYGGGGGGYGGGGGGYGDGTGGAAFG 3725 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 718 GGGGXGXXGGXXXGGGGGGXGGG 650 GGG G GG GGGG G G G Sbjct: 3698 GGGYGGGGGGYGGGGGGYGDGTG 3720 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/32 (56%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -1 Query: 733 GXGXGGGGGXGXXGGXXXGGGGG-GXGGGXXG 641 G G GGGGG G GG GGG G G GG G Sbjct: 3698 GGGYGGGGG-GYGGG---GGGYGDGTGGAAFG 3725 >SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) Length = 439 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXP 734 D+P PPP P PP P PP P P Sbjct: 109 DAPTTVPPPVVTDAPTTVPPPVQPTEPPSTRPPP 142 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 32.3 bits (70), Expect = 0.54 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 2/59 (3%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPPXXXPP--XPPPXPPXPPXXPPLXGGVXGAPXTP 807 P P P P P PP P P P P P PP PP A TP Sbjct: 519 PPPSVFAPSSGVPTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPPPSVFAPSSAVPTP 577 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 9/64 (14%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXX--PXPPXXXPPXPPP-------XPPXPPXXPPLXGGV 786 +P P P P PPP P P P PP PPP P P PP Sbjct: 530 VPTPVTEPP--PAPPPSVFAPSSGVPTPVTAPPPAPPPSVFAPSSAVPTPATAPPPVAAT 587 Query: 787 XGAP 798 AP Sbjct: 588 LSAP 591 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP PPP P P P P P APP Sbjct: 560 PPAPPPSVFAPSSAVPTPATAPPPVAATLSAPP 592 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +3 Query: 636 SPPXXPPPXPPP---PPPXXXPPXXPXPPPPP-XPXPPXPXPXAPP 761 +P PPP PPP P P PPP P P P A P Sbjct: 394 TPVAAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAP 439 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 9/53 (16%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPP---------XPXPPXPXPXAPPXS 767 +PP PPP P P PP PP P P P APP S Sbjct: 514 APPAAPPPSVFAPSSGVPTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPPPS 566 Score = 29.1 bits (62), Expect = 5.0 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 9/51 (17%) Frame = +3 Query: 636 SPPXXPPPXPPPP---PPXXXPPXX--PXPPPPP---XPXPPXPXP-XAPP 761 +P PPP PPP P P P P PPP P P P APP Sbjct: 532 TPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPPPSVFAPSSAVPTPATAPP 582 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 +PP PPP P P PP P P P A P Sbjct: 456 APPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAP 497 >SB_53084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 936 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G G GGG GG G GGG G GG+ Sbjct: 490 GDGGGDDDGDGGGDDDGDGGVDDDGDGGGDDDGDGGGD 527 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGX---GXXGGXXXGGGGGGXGGGXXGGESS 629 GG G GG G GG G GG G GGG G ESS Sbjct: 492 GGGDDDGDGGGDDDGDGGVDDDGDGGGDDDGDGGGDDDVGCGCDESS 538 >SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) Length = 732 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 742 GXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG 641 G GG G G G G G GGGG GGG G Sbjct: 620 GFGGQGGMFGTPGGQQSGFHGGIGGGGMGGGFSG 653 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 G G G G G G GG GGG G GGG Sbjct: 622 GGQGGMFGTPGGQQSGFHGGIGGGGMGGGFSGQGGG 657 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAP 798 P P PPP PP P P PP PP GG GAP Sbjct: 199 PPPGGYAPPPYVPQEGGGIPPQNHPLTNYPAPPPQGYAPP-PGGYPGAP 246 Score = 31.5 bits (68), Expect = 0.94 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PP P PP P PPP PP P APP Sbjct: 207 PPYVPQEGGGIPPQNHPLTNYPAPPPQGYAPPPGGYPGAPP 247 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PPP PP P PPP P P P PP Sbjct: 156 PPPPGTQPPGQGGYPGYNQPPPGHYPAPGQPGGYYPP 192 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PPP PPP P P P P PP P PP Sbjct: 230 PPPQGYAPPPGGYPGAPPAGGYPGAP-PPGGYPGGPP 265 Score = 29.5 bits (63), Expect = 3.8 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPLXGGVXGAP 798 IP P P PPP P PP P PP P PP GG G P Sbjct: 217 IPPQNHPLTNYPAPPPQGYAP----PPGGYPGAPPAG--GYPGAPP-PGGYPGGP 264 >SB_23882| Best HMM Match : Cyt-b5 (HMM E-Value=9.2e-19) Length = 167 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXG 641 GG G GG GGG G GGGG GG G Sbjct: 111 GGGGGDDSGGDDDGGGVGDDDDDDDDDDDGGGGDHGGGDG 150 >SB_23371| Best HMM Match : SRCR (HMM E-Value=0) Length = 345 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 721 GGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G GGG GG GGG G GG GG Sbjct: 142 GDGGGDDGNGGDNNGGGDDGNGGDNNGG 169 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 G A G G G G GG GG G GG GGG Sbjct: 135 GYAPGDDGDGGGDDGNGGDN-NGGGDDGNGGDNNGGG 170 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 G G G G G GG G G GGG GG+ + Sbjct: 139 GDDGDGGGDDGNGGDNNGGGDDGNGGDNNGGGCDDHDNGGDDN 181 >SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) Length = 243 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 GG G G G G G G GGGG G GG Sbjct: 102 GGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGG 142 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = -1 Query: 742 GXGGXGXGGGGGXGXXGGXXXGGG---GGGXGGGXXGGES 632 G GG G GG G G GGG G GGG G + Sbjct: 101 GGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSN 140 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGG--XGXXGGXXXGGGGGGXGGGXXG 641 G+ G G G GGGG G GG G G GG G Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDG 138 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = -1 Query: 757 GAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 G+ G G G GGGG G G GGG Sbjct: 108 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGG 143 >SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 PP P PP P PP P PP P P P S Sbjct: 586 PPQQRPGAPPTSQPGGFPPQRPGMPPMSQPSSMHMQPSGQPQS 628 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 627 QXDSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPPXS 767 Q P PP P P P P PP P APP S Sbjct: 551 QHQQRPGAPPTSQPGFPSPQMQEPMQLPTSQPGGFPPQQRPGAPPTS 597 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXP 734 SP PP P P PP PPPP P Sbjct: 793 SPTDVLPPTLPQAPYPGGPPSMSGMPPPPGHSP 825 >SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) Length = 924 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 667 PXPPPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPL 774 P P P P P PP PP P P P P+ Sbjct: 282 PSPQPTEAKPHTPPPPTSTPPTTAPRQPSPMAPAPV 317 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXP 734 P P PPPP P P P P P P Sbjct: 286 PTEAKPHTPPPPTSTPPTTAPRQPSPMAPAP 316 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 2/43 (4%) Frame = +1 Query: 652 PXPXXPXPPPXXXPPXXPXPPXXXPPXPPPXPPXP--PXXPPL 774 P P P PP PP P P P P P PPL Sbjct: 282 PSPQPTEAKPHTPPPPTSTPPTTAPRQPSPMAPAPVQKESPPL 324 >SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) Length = 506 Score = 31.9 bits (69), Expect = 0.71 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPPPPXPXPP 737 P P PPP P P PP P PP Sbjct: 221 PDAPTPPPPVKTTAAPTPSPPQTPPPP 247 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPP 722 P P P PP P P PPPP Sbjct: 221 PDAPTPPPPVKTTAAPTPSPPQTPPPP 247 >SB_37033| Best HMM Match : Annexin (HMM E-Value=0) Length = 287 Score = 31.9 bits (69), Expect = 0.71 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXP-PXPXP 749 P PPP P PPP P P P P P P P P Sbjct: 21 PGAPPPMPQQPPPLGFDAMGP-PQPGGMPMPMPGPYP 56 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = +1 Query: 634 IPXPXXPXPXXPXPPPXXXPPXXPXPPXXXP-PXPPPXPPXP-PXXPPLXGGVXGAPXTP 807 +P P P P PPP P P P P P P P P P G P P Sbjct: 18 MPRPGAPPPMPQQPPPLGFDAMGPPQPGGMPMPMPGPYPSSGYPTSVPGAAPPYGGPPPP 77 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXP-XPPXPXPXAPPXS 767 P P PPP P PP PP P P P P P S Sbjct: 19 PRPGAPPPMPQQPPPLGFDAMGPPQPGGMPMPMPGPYPSS 58 >SB_25716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 31.9 bits (69), Expect = 0.71 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 G G G GG G G G G G G GGG G G G GG+ Sbjct: 59 GDGKGEG-GGKGEGEGKGEGKSEGKGEGGGKGD-GKGEEGGK 98 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = -1 Query: 748 GXGXG-GXGXGGGGGXGXXGGXXXGGGGG-GXGGGXXGGE 635 G G G G G G GGG G G G G G GGG G+ Sbjct: 53 GEGEGKGDGKGEGGGKGEGEGKGEGKSEGKGEGGGKGDGK 92 Score = 29.5 bits (63), Expect = 3.8 Identities = 22/71 (30%), Positives = 25/71 (35%) Frame = -3 Query: 854 GXXLGGGGKXXRRXXXGVXGAPXTPPXRGGXXGGXGGXGGGXGGXXXGGXGXXGGXXXGG 675 G + G G+ + G G G G G GGG G G G G GG Sbjct: 28 GEGIKGEGEGQKGEGKG-EGIKDEGKGEGEGKGDGKGEGGGKGEGEGKGEGKSEGKGEGG 86 Query: 674 GXGXXGXGXXG 642 G G G G G Sbjct: 87 GKG-DGKGEEG 96 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 31.9 bits (69), Expect = 0.71 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 675 PPXXXPPXXPXPPPPPXPXPPXPXP 749 P PP PPPPP PP P P Sbjct: 192 PSWNRPPPSGAPPPPPIGAPPPPPP 216 Score = 31.5 bits (68), Expect = 0.94 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPP 719 PP PPPPP PP PPPP Sbjct: 198 PPSGAPPPPPIGAPP----PPPP 216 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXPXPPXXXPPXPPP 741 P PPP P P PP PP PPP Sbjct: 192 PSWNRPPPSGAP---PPPPIGAPPPPPP 216 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 621 IXQXDSPPXXPPPXPPPPPPXXXPPXXPXPPPPP 722 I + S P PPP PP PPPPP Sbjct: 182 IRRVSSASTLPSWNRPPPSGAPPPPPIGAPPPPP 215 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 672 PPPXXXPPXXPXPPPPPXP 728 PPP PP P PPP P Sbjct: 197 PPPSGAPPPPPIGAPPPPP 215 >SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 775 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 642 PXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPP 737 P PP PPPPP P PP P P Sbjct: 736 PEAPPQLPPPPPFIVDDTESPQEQPPTTPVSP 767 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/46 (32%), Positives = 15/46 (32%), Gaps = 2/46 (4%) Frame = +1 Query: 637 PXPXXPXPXXPXPPPXXXPPXXPXPP--XXXPPXPPPXPPXPPXXP 768 P P P P P P P P PP P PP P P Sbjct: 722 PHPVPPTPLVQHPEPEAPPQLPPPPPFIVDDTESPQEQPPTTPVSP 767 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 4/34 (11%) Frame = +3 Query: 627 QXDSPPXXPPPXPPPP----PPXXXPPXXPXPPP 716 Q D P P PP P P PP P PPP Sbjct: 714 QHDKHSCGPHPVPPTPLVQHPEPEAPPQLPPPPP 747 >SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 532 Score = 31.9 bits (69), Expect = 0.71 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = -3 Query: 773 RGGXXGGXGG-XGGGXGGXXXGGXGXXGGXXXGGG-XGXXGXG 651 RGG G GG GG G GG G G GGG G G G Sbjct: 433 RGGFRGNRGGFRGGNERGQRRGGRGGHGPPRGGGGFSGPRGGG 475 >SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) Length = 361 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -1 Query: 703 GXXGGXXXGGGGGGXGGGXXGGESSC 626 G GG GGGG GGG GG+ +C Sbjct: 151 GRGGGGRRGGGGCCGGGGGGGGDCTC 176 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 727 GXGGGGGXGXXGGXXXGGGGGGXG 656 G GGGG G GG GGGGGG G Sbjct: 151 GRGGGGRRG--GGGCCGGGGGGGG 172 >SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) Length = 278 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -1 Query: 703 GXXGGXXXGGGGGGXGGGXXGGESSC 626 G GG GGGG GGG GG+ +C Sbjct: 68 GRGGGGRRGGGGCCGGGGGGGGDCTC 93 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 727 GXGGGGGXGXXGGXXXGGGGGGXG 656 G GGGG G GG GGGGGG G Sbjct: 68 GRGGGGRRG--GGGCCGGGGGGGG 89 >SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) Length = 866 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -1 Query: 766 EXGGAXGXGXGGX-GXGGGGGXGXXGGXXXGGGGGGXGGGXXGGE 635 + G G G GG G G GGG G G G G G GG+ Sbjct: 750 DDGDGDGDGDGGSNGGGDGGGDGDGDGDGDGDGDGDGEYNDDGGD 794 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -1 Query: 742 GXGGXGXGGGGGXGXXGGXXXGGG-GGGXGGGXXGGE 635 G G GG G G GG GGG GGG G+ Sbjct: 739 GDGEYNYHGGDDDGDGDGDGDGGSNGGGDGGGDGDGD 775 >SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) Length = 224 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -1 Query: 703 GXXGGXXXGGGGGGXGGGXXGGESSC 626 G GG GGGG GGG GG+ +C Sbjct: 151 GRGGGGRRGGGGCCGGGGGGGGDCTC 176 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 727 GXGGGGGXGXXGGXXXGGGGGGXG 656 G GGGG G GG GGGGGG G Sbjct: 151 GRGGGGRRG--GGGCCGGGGGGGG 172 >SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2149 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = +3 Query: 654 PPXPPPPPPXXXPPXXPXPPPPP-XPXPPXP 743 PP P P P P PP P P PP P Sbjct: 1513 PPKPVKPSTKPVVPVKPVKPPSPIKPKPPIP 1543 Score = 25.8 bits (54), Expect(2) = 0.85 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 PPP PP PPPP P PP Sbjct: 2112 PPPLPPGDGYEFQGVPPPPMEFVEERMKPLVPP 2144 Score = 24.2 bits (50), Expect(2) = 0.85 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 636 SPPXXPPPXPPPPPP 680 +P PPP P PPP Sbjct: 2058 NPSPVPPPPPSVPPP 2072 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 31.5 bits (68), Expect = 0.94 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 621 IXQXDSPPXXPPPXPPPPPPXXXPP 695 + + D P PPP PPPP PP Sbjct: 454 VARQDDTPIPPPPPMSPPPPTPPPP 478 Score = 31.5 bits (68), Expect = 0.94 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 690 PPXXPXPPPPPXPXPPXPXP 749 PP P PPPP P PP P Sbjct: 463 PPPPPMSPPPPTPPPPATSP 482 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 627 QXDSPPXXPPPXPPPPPPXXXPPXXP 704 Q D+P PPP PPPP P P Sbjct: 457 QDDTPIPPPPPMSPPPPTPPPPATSP 482 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 663 PPPPPPXXXPPXXPXPPPPPXPXP 734 P PPPP PP P PPPP P Sbjct: 461 PIPPPPPMSPP--PPTPPPPATSP 482 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPPPP 722 P PPPPP PP P P P Sbjct: 461 PIPPPPPMSPPPPTPPPPATSP 482 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 1/19 (5%) Frame = +3 Query: 702 PXPPPPPX-PXPPXPXPXA 755 P PPPPP P PP P P A Sbjct: 461 PIPPPPPMSPPPPTPPPPA 479 >SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 31.5 bits (68), Expect = 0.94 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXA--PP 761 P P PPPP P P P PPP P P A PP Sbjct: 144 PIPQIPPPPTYLHPSQYP-PSPPPWELPRVPSANATLPP 181 >SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) Length = 801 Score = 31.5 bits (68), Expect = 0.94 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGGES 632 E G+ G G G G GGGG GGGG GGG ES Sbjct: 330 ENNGSAGDGSGDRGFLGGGG---------GGGGSSGGGGGRDDES 365 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGGXXGG 638 G G G G G GGGGGG G GG Sbjct: 320 GSFKSTGENPENNGSAGDGSGDRGFLGGGGGGGGSSGGGGG 360 >SB_35820| Best HMM Match : TRAP_240kDa (HMM E-Value=0.006) Length = 1382 Score = 31.5 bits (68), Expect = 0.94 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -1 Query: 766 EXGGAXGXGXGGXGXGGGGG 707 + GG G G GG G GGGGG Sbjct: 771 DGGGGMGLGMGGSGGGGGGG 790 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -1 Query: 718 GGGGXGXXGGXXXGGGGGGXGGGXXGGESS 629 GGGG G GG GGG GGG +SS Sbjct: 772 GGGGMGLG----MGGSGGGGGGGVTSSQSS 797 >SB_35620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 271 Score = 31.5 bits (68), Expect = 0.94 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 691 GXXXGGGGGGXGGGXXGGESSC 626 G GGGGGG GGG G S+C Sbjct: 63 GCVHGGGGGGGGGGGGRGCSTC 84 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 31.5 bits (68), Expect = 0.94 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPP 680 DSPP PPP PPP P Sbjct: 816 DSPPPPPPPPPPPEEP 831 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 651 PPPXPPPPPPXXXP 692 PPP PPPPPP P Sbjct: 818 PPPPPPPPPPPEEP 831 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXP 704 +P PP PPPPPP PP P Sbjct: 812 TPHEDSPPPPPPPPP---PPEEP 831 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 693 PXXPXPPPPPXPXPPXPXP 749 P PPPPP P PP P Sbjct: 813 PHEDSPPPPPPPPPPPEEP 831 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 712 PXXXPPXPPPXPPXPPXXP 768 P P PPP PP PP P Sbjct: 813 PHEDSPPPPPPPPPPPEEP 831 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 P P PP P P PPP PP P Sbjct: 888 PGLPGTPPITSPSSLPPPPPLQGYNPPPP 916 >SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 31.5 bits (68), Expect = 0.94 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 748 GXGXGGXGXGGGGGXGXXGGXXXGGGGGGXGGG 650 G G G GG G G GGGGG GGG Sbjct: 266 GPPPGAVGGFGGWGGGSEDNGASGGGGGYSGGG 298 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXX-GGGGGGXGGGXXGGESS 629 GG GG G GG G GG G GG GG GG + Sbjct: 257 GGMNSGYNGGPPPGAVGGFGGWGGGSEDNGASGGGGGYSGGGSGT 301 >SB_20156| Best HMM Match : GED (HMM E-Value=6.8e-16) Length = 172 Score = 31.5 bits (68), Expect = 0.94 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +3 Query: 666 PPPPPXXXPPXXPX-PPPPPXPXPPXPXPXAPP 761 P PPP P PP PP P P P PP Sbjct: 134 PTPPPVDNSDFDPRRPPAPPKPGGAPPIPGRPP 166 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 657 PXPPPPPPXXXPPXXPXPPPPPXPXPPXP 743 P PPP P P PP P PP P Sbjct: 134 PTPPPVDNSDFDPRRPPAPPKPGGAPPIP 162 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 633 DSPPXXPPPXPPPPPPXXXPPXXPXPPPPPXP 728 D+ P P PP P PP PP P P Sbjct: 140 DNSDFDPRRPPAPPKPGGAPPIPGRPPIPSRP 171 >SB_51035| Best HMM Match : Extensin_2 (HMM E-Value=0.33) Length = 321 Score = 31.5 bits (68), Expect = 0.94 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 666 PPPPPXXXPPXXPXPPPPPXPXPPXP 743 P P PP P P PPP P P P Sbjct: 207 PAPQYVHVPPATPTPKPPPTPKTPKP 232 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 31.5 bits (68), Expect = 0.94 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 636 SPPXXPPPXPPPPPP 680 SPP PPP P PPPP Sbjct: 161 SPPPQPPPPPLPPPP 175 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 690 PPXXPXPPPPPXPXPPXP 743 PP P PPPPP P PP P Sbjct: 162 PP--PQPPPPPLPPPPPP 177 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 724 PPXPPPXPPXPPXXPPL 774 PP PP PP PP PP+ Sbjct: 162 PPPQPPPPPLPPPPPPI 178 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 639 PPXXPPPXPPPPPP 680 P PPP PPPPPP Sbjct: 164 PQPPPPPLPPPPPP 177 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 651 PPPXPPPPPPXXXPPXXPXPPPP 719 PPP PPPPP P PPPP Sbjct: 162 PPPQPPPPP-------LPPPPPP 177 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 702 PXPPPPPXPXPPXPXP 749 P P PPP P PP P P Sbjct: 162 PPPQPPPPPLPPPPPP 177 >SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) Length = 260 Score = 31.5 bits (68), Expect = 0.94 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 742 GXGGXGXGGGGGXGXXGGXXXGGGG 668 G GG G GGG G G GG GGGG Sbjct: 152 GRGGGGRGGGRGHGRGGG--SGGGG 174 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 718 GGGGXGXXGGXXXGGGGGGXGGG 650 G GG G GG G GGG GGG Sbjct: 152 GRGGGGRGGGRGHGRGGGSGGGG 174 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 727 GXGGGGGXGXXGGXXXGGGGGG 662 G GGGG G G GG GGG Sbjct: 152 GRGGGGRGGGRGHGRGGGSGGG 173 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,646,421 Number of Sequences: 59808 Number of extensions: 648765 Number of successful extensions: 22259 Number of sequences better than 10.0: 376 Number of HSP's better than 10.0 without gapping: 2218 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9592 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2526446612 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -