BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_C21 (886 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 31 0.014 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 29 0.075 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 27 0.30 X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 26 0.53 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 1.6 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 2.7 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 8.6 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 8.6 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 8.6 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 8.6 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 8.6 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 8.6 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 8.6 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 8.6 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 8.6 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 8.6 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 8.6 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 8.6 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 8.6 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 8.6 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 8.6 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 8.6 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 22 8.6 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 31.1 bits (67), Expect = 0.014 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +3 Query: 621 IXQXDSPPXXPPPXPPPPP-PXXXPPXXPXPPPPPXPXPPXPXPXAPP 761 I Q P P P P P P PP P PP P APP Sbjct: 9 ITQQSQQPSSGAPGPQPSPHQSPQAPQRGSPPNPSQGPPPGGPPGAPP 56 Score = 28.3 bits (60), Expect = 0.100 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +3 Query: 636 SPPXXPPPXPPPPPPXXXPPXXPXPPPPPXPXPPXPXPXAP 758 +P P P P P P P PPP P P P Sbjct: 20 APGPQPSPHQSPQAPQRGSPPNPSQGPPPGGPPGAPPSQNP 60 Score = 26.2 bits (55), Expect = 0.40 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = +1 Query: 658 PXXPXPPPXXXPPXXP-XPPXXXPPXPPPXPP--XPPXXPP 771 P P P P P P PP P PP PP PP Sbjct: 16 PSSGAPGPQPSPHQSPQAPQRGSPPNPSQGPPPGGPPGAPP 56 Score = 22.6 bits (46), Expect = 4.9 Identities = 10/26 (38%), Positives = 10/26 (38%) Frame = +3 Query: 627 QXDSPPXXPPPXPPPPPPXXXPPXXP 704 Q SPP PP PP P P Sbjct: 35 QRGSPPNPSQGPPPGGPPGAPPSQNP 60 Score = 22.2 bits (45), Expect = 6.5 Identities = 10/33 (30%), Positives = 11/33 (33%) Frame = +1 Query: 676 PPXXXPPXXPXPPXXXPPXPPPXPPXPPXXPPL 774 PP P P P PP P P P + Sbjct: 410 PPSAGAPMPPIPNMSNMSGMPPLPNMPGSMPTM 442 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 28.7 bits (61), Expect = 0.075 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 760 GGAXGXGXGGXGXGGGGGXGXXGGXXXGGGGGGXG 656 GG GG G GG G GGGGGG G Sbjct: 20 GGPGSSSAGGVVTGASGG-SIVVGANNGGGGGGLG 53 Score = 27.1 bits (57), Expect = 0.23 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = -1 Query: 736 GGXGXGGGGGX--GXXGGXXXGGGGGGXGGGXXG 641 GG G GG G GG G G GGG G Sbjct: 20 GGPGSSSAGGVVTGASGGSIVVGANNGGGGGGLG 53 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 26.6 bits (56), Expect = 0.30 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 Query: 651 PPPXPPPPPPXXXPP 695 P P PPPPPP P Sbjct: 339 PKPAPPPPPPSSSGP 353 Score = 25.0 bits (52), Expect = 0.93 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 633 DSPPXXPPPXPPP 671 D+PP PP PPP Sbjct: 336 DTPPKPAPPPPPP 348 Score = 23.8 bits (49), Expect = 2.1 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +3 Query: 711 PPPPXPXPPXPXPXAP 758 PP P P PP P P Sbjct: 338 PPKPAPPPPPPSSSGP 353 Score = 23.0 bits (47), Expect = 3.7 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +3 Query: 690 PPXXPXPPPPPXPXPP 737 PP PPPPP P Sbjct: 338 PPKPAPPPPPPSSSGP 353 Score = 23.0 bits (47), Expect = 3.7 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 724 PPXPPPXPPXPPXXPP 771 PP P P PP P P Sbjct: 338 PPKPAPPPPPPSSSGP 353 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 25.8 bits (54), Expect = 0.53 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 3/38 (7%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPP---PXPXPPXP 743 P P P PP P P P P P P PP P Sbjct: 103 PVYIPQPRPPHPRLRREPEAEPGNNRPVYIPQPRPPHP 140 Score = 25.8 bits (54), Expect = 0.53 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 3/38 (7%) Frame = +3 Query: 639 PPXXPPPXPPPPPPXXXPPXXPXPPPP---PXPXPPXP 743 P P P PP P P P P P P PP P Sbjct: 129 PVYIPQPRPPHPRLRREPEAEPGNNRPVYIPQPRPPHP 166 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 Query: 642 PXXPPPXPPPPPP 680 P P PPPPPP Sbjct: 1852 PVSGSPEPPPPPP 1864 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.4 bits (48), Expect = 2.8 Identities = 11/38 (28%), Positives = 14/38 (36%) Frame = +1 Query: 478 SFGMKTMRARCAATERXSGWFSXTAHILYSXHAVYVPY 591 S G RC + S W S AH + V+ Y Sbjct: 920 SLGSNPWSCRCKFLQELSSWVSDNAHKVVDASDVWCYY 957 Score = 23.4 bits (48), Expect = 2.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 651 PPPXPPPP 674 PPP PPPP Sbjct: 1355 PPPPPPPP 1362 Score = 23.4 bits (48), Expect = 2.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 654 PPXPPPPP 677 PP PPPPP Sbjct: 1355 PPPPPPPP 1362 Score = 23.4 bits (48), Expect = 2.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 657 PXPPPPPP 680 P PPPPPP Sbjct: 1355 PPPPPPPP 1362 Score = 20.6 bits (41), Expect(2) = 2.7 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +3 Query: 702 PXPPPPP 722 P PPPPP Sbjct: 1355 PPPPPPP 1361 Score = 20.6 bits (41), Expect(2) = 2.7 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +3 Query: 708 PPPPPXP 728 PPPPP P Sbjct: 1356 PPPPPPP 1362 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +3 Query: 669 PPPPXXXPPXXPXPPPPPXP 728 P PP PP PPP P Sbjct: 127 PFPPRFIPPDMYRLRPPPNP 146 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +3 Query: 669 PPPPXXXPPXXPXPPPPPXP 728 P PP PP PPP P Sbjct: 127 PFPPRFIPPDMYRLRPPPNP 146 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +3 Query: 669 PPPPXXXPPXXPXPPPPPXP 728 P PP PP PPP P Sbjct: 127 PFPPRFIPPDMYRLRPPPNP 146 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +3 Query: 669 PPPPXXXPPXXPXPPPPPXP 728 P PP PP PPP P Sbjct: 127 PFPPRFIPPDMYRLRPPPNP 146 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +3 Query: 669 PPPPXXXPPXXPXPPPPPXP 728 P PP PP PPP P Sbjct: 127 PFPPRFIPPDMYRLRPPPNP 146 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +3 Query: 669 PPPPXXXPPXXPXPPPPPXP 728 P PP PP PPP P Sbjct: 127 PFPPRFIPPDMYRLRPPPNP 146 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +3 Query: 669 PPPPXXXPPXXPXPPPPPXP 728 P PP PP PPP P Sbjct: 127 PFPPRFIPPDMYRLRPPPNP 146 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +3 Query: 669 PPPPXXXPPXXPXPPPPPXP 728 P PP PP PPP P Sbjct: 376 PFPPRFIPPDMYRLRPPPNP 395 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +3 Query: 669 PPPPXXXPPXXPXPPPPPXP 728 P PP PP PPP P Sbjct: 376 PFPPRFIPPDMYRLRPPPNP 395 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +3 Query: 669 PPPPXXXPPXXPXPPPPPXP 728 P PP PP PPP P Sbjct: 376 PFPPRFIPPDMYRLRPPPNP 395 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +3 Query: 669 PPPPXXXPPXXPXPPPPPXP 728 P PP PP PPP P Sbjct: 376 PFPPRFIPPDMYRLRPPPNP 395 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +3 Query: 669 PPPPXXXPPXXPXPPPPPXP 728 P PP PP PPP P Sbjct: 376 PFPPRFIPPDMYRLRPPPNP 395 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +3 Query: 669 PPPPXXXPPXXPXPPPPPXP 728 P PP PP PPP P Sbjct: 376 PFPPRFIPPDMYRLRPPPNP 395 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +3 Query: 669 PPPPXXXPPXXPXPPPPPXP 728 P PP PP PPP P Sbjct: 375 PFPPRFIPPDMYRLRPPPNP 394 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +3 Query: 669 PPPPXXXPPXXPXPPPPPXP 728 P PP PP PPP P Sbjct: 360 PFPPRFIPPDMYRLRPPPNP 379 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +3 Query: 669 PPPPXXXPPXXPXPPPPPXP 728 P PP PP PPP P Sbjct: 376 PFPPRFIPPDMYRLRPPPNP 395 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.8 bits (44), Expect = 8.6 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +2 Query: 263 SFDFTPQFSTTKLKTGLFGLKNG 331 +FD+ P+++ + F LKNG Sbjct: 228 TFDYDPRYAKMTIDGESFTLKNG 250 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 247,794 Number of Sequences: 438 Number of extensions: 9667 Number of successful extensions: 90 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28766349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -