BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_C20 (893 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 31 1.3 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/68 (30%), Positives = 22/68 (32%) Frame = +3 Query: 687 PPPPXKAXXXXXXXXXXXXXX*XPXASGPSGLXANPVXXXPQXAGXSXXXPPTSXDHPPG 866 PPPP P G +GL P P AG PP PPG Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPP----PPG 749 Query: 867 XXPLXPPP 890 L PPP Sbjct: 750 CAGLPPPP 757 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +3 Query: 765 SGPSGLXANPVXXXP----QXAGXSXXXPPTSXDHPPGXXPLXPPP 890 SGP L + PV P AG PP P G P PPP Sbjct: 358 SGPKPLMSTPVQRPPGMRPPGAGNGPGGPPPPWSKPGGILPGPPPP 403 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,764,500 Number of Sequences: 59808 Number of extensions: 252191 Number of successful extensions: 449 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 415 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2562198215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -