BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_C19 (816 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 28 0.10 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 3.8 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 3.8 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 22 6.7 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 8.9 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 27.9 bits (59), Expect = 0.10 Identities = 14/50 (28%), Positives = 27/50 (54%) Frame = -1 Query: 414 SNGLKVARGLQLVDTMALGLAISGTLSNWTLAATTSHTDSEYNITLFSTV 265 +NG+ + R + V T+++ S + N+T A+ S + + Y +LF V Sbjct: 648 TNGIVINRASKRVSTLSIDNVQSTHVGNYTCLASNSASVTTYTTSLFINV 697 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.6 bits (46), Expect = 3.8 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +3 Query: 588 DAWSDFXWSQLP 623 D WS F W+ LP Sbjct: 915 DQWSSFYWNLLP 926 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.6 bits (46), Expect = 3.8 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +3 Query: 588 DAWSDFXWSQLP 623 D WS F W+ LP Sbjct: 915 DQWSSFYWNLLP 926 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 171 KTHNIAQFFPIQLLNISVGTHLS 103 + H + FPI L ISV T L+ Sbjct: 386 RQHAVTAKFPIYLYRISVETKLN 408 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +1 Query: 82 ARRLPQAAKMGAY 120 ++R+PQ AK GAY Sbjct: 286 SQRVPQLAKNGAY 298 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,163 Number of Sequences: 336 Number of extensions: 4133 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22310335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -