BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_C19 (816 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46389| Best HMM Match : No HMM Matches (HMM E-Value=.) 215 4e-56 SB_47280| Best HMM Match : DUF655 (HMM E-Value=2.2) 31 1.5 SB_3451| Best HMM Match : HOK_GEF (HMM E-Value=9.4) 29 4.5 >SB_46389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 215 bits (525), Expect = 4e-56 Identities = 101/168 (60%), Positives = 119/168 (70%) Frame = +1 Query: 109 MGAYRYIQELYRKKLSDVMRFLLRVRVWQYRQLTRMHRAPRPTRPDKARRLGYRAKQXXX 288 MGAY+Y++ELY+KK SD++RFLLRVR WQYRQLT +HRA RPTRPDKARRLGY+AKQ Sbjct: 1 MGAYKYLEELYKKKQSDLLRFLLRVRCWQYRQLTAIHRATRPTRPDKARRLGYKAKQGFV 60 Query: 289 XXXXXXXXXXXXXXXXXXATYGKPKSHGVNQLKPTRNLQSIAEEXXXXXXXXXXXXSSYW 468 ATYGKP + GVN+LK R+L+S+AEE +SYW Sbjct: 61 IYRVRVRRGGRKRPVPKGATYGKPVNQGVNELKFQRSLRSVAEERAGRYCGGLRVLNSYW 120 Query: 469 VAQDSSYKYFEVILVDPSHKAIRRDPKINWIVNAVHKHREMRGLTSAG 612 V QDS YKYFEVI+VDP HKAIRRD +INWI HKHRE+RGLT+AG Sbjct: 121 VGQDSIYKYFEVIMVDPFHKAIRRDARINWICKPTHKHRELRGLTAAG 168 >SB_47280| Best HMM Match : DUF655 (HMM E-Value=2.2) Length = 508 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = -1 Query: 168 THNIAQFFPIQLLNISVGTHLSSLWQTSRVSHSKP*KKTKLKILRD 31 T +A FF Q L +S+ ++ LWQ + S+ +P K+ L +RD Sbjct: 5 TSELASFFQRQKLVLSLDFYMDQLWQ--QFSNGEPLNKSMLAFVRD 48 >SB_3451| Best HMM Match : HOK_GEF (HMM E-Value=9.4) Length = 173 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 166 RFLLRVRVWQYRQLTRMHRAPRPTRPDKARRLGYRAKQ 279 +F ++ YR+ T+MH +RP + R G+R KQ Sbjct: 16 KFFVKRLTTPYRRRTQMHLLVSTSRPASSWRRGFRGKQ 53 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,690,268 Number of Sequences: 59808 Number of extensions: 559127 Number of successful extensions: 1145 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1027 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1143 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2275631710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -