BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_C18 (973 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 38 0.012 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 36 0.050 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 35 0.087 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 34 0.20 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 33 0.35 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 33 0.35 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 33 0.46 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 33 0.46 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 32 0.61 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 32 0.61 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 32 0.61 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 31 1.4 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 31 1.4 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 31 1.9 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 30 2.5 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 30 2.5 SB_36850| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 30 2.5 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 30 2.5 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 30 2.5 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 30 2.5 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 30 2.5 SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) 30 3.3 SB_43997| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 30 3.3 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 30 3.3 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 29 5.7 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 29 5.7 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 29 5.7 SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 29 7.5 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 7.5 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 29 7.5 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 29 7.5 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.5 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 29 7.5 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 29 7.5 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 29 7.5 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 29 7.5 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 29 7.5 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 29 7.5 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 29 7.5 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 29 7.5 SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) 28 9.9 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 28 9.9 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 28 9.9 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 28 9.9 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 28 9.9 SB_29033| Best HMM Match : Ion_trans_2 (HMM E-Value=8.1e-29) 28 9.9 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 28 9.9 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 37.9 bits (84), Expect = 0.012 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PPPP PPP PP + P G P Sbjct: 364 PPPPPPPVGGPPPPPPPIEGRPPSSLGNP 392 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 387 ILTKXXPPXPPPPXXXPPPXPPXTXXQVP 473 I T PP PPPP PPP PP P Sbjct: 678 IQTMVPPPPPPPPPPPPPPPPPPPQPSTP 706 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PPPP PPP PP P P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PP P PPP P Q G G P Sbjct: 697 PPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PPPP PPP PP P P Sbjct: 683 PPPPPPP--PPPPPPPPPPPPQPSTPPPP 709 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PPPP PPP PP PG G P Sbjct: 304 PPPPPPPGGAPPPPPPPPPPP-PGDGGAP 331 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 2/20 (10%) Frame = +3 Query: 405 PPXPPPPXXX--PPPXPPXT 458 PP PPPP PPP PP T Sbjct: 319 PPPPPPPGDGGAPPPPPPPT 338 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 35.5 bits (78), Expect = 0.066 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP T P Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPP 396 Score = 35.5 bits (78), Expect = 0.066 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP T P Sbjct: 384 PPPPPPPTNGPPPPPPPTNGPPP 406 Score = 34.7 bits (76), Expect = 0.11 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXT 458 PP PPPP PPP PP T Sbjct: 394 PPPPPPPTNGPPPPPPPT 411 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP PP T P Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPP 386 Score = 32.3 bits (70), Expect = 0.61 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PP PP T P Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPP 376 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 393 TKXXPPXPPPPXXXPPPXPPXTXXQVPGXXG 485 T PP PPP PPP PP G G Sbjct: 391 TNGPPPPPPPTNGPPPPPPPTNGPPSEGKCG 421 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 393 TKXXPPXPPPPXXXPPPXPPXTXXQVP 473 T PP PPP PPP PP P Sbjct: 361 TNNTPPPPPPTNKPPPPPPPTNGPPPP 387 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 393 TKXXPPXPPPPXXXPPPXPPXTXXQVP 473 T PP PPP PPP PP P Sbjct: 371 TNKPPPPPPPTNGPPPPPPPTNGPPPP 397 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 393 TKXXPPXPPPPXXXPPPXPPXTXXQVP 473 T PP PPP PPP PP P Sbjct: 381 TNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PP PP Sbjct: 77 PPPPPPPPSSGPPLPP 92 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 35.1 bits (77), Expect = 0.087 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PPPP PPP P + PG P Sbjct: 871 PPPPPPPPPPPPPPPASSTGSTPGGDKVP 899 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 867 PPPPPPPPPPPPPPPP 882 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 868 PPPPPPPPPPPPPPPP 883 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 869 PPPPPPPPPPPPPPPP 884 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXPSTRGXGIXP 493 P PPP PPP PP ST G P Sbjct: 871 PPPPPPPPPPPPPPPASSTGSTPGGDKVP 899 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 P PPPP PPP PP Sbjct: 864 PRRPPPPPPPPPPPPP 879 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 419 PPPXXPPPXPPXXXXPSTRGXGIXP 493 PPP PPP PP P G P Sbjct: 869 PPPPPPPPPPPPPPPPPASSTGSTP 893 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXPSTRG 478 P PPP PPP PP S+ G Sbjct: 867 PPPPPPPPPPPPPPPPPPPASSTG 890 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXP 466 P PPP PPP PP P Sbjct: 864 PRRPPPPPPPPPPPPPPPPP 883 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 35.1 bits (77), Expect = 0.087 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXPL*XXVXWAXXXDTXLLLXXGAXP 560 PP PPPP PPP PP P PL LL GA P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPPPPTPLHLAAITKQASLVQALLEAGADP 519 Score = 33.5 bits (73), Expect = 0.26 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFP 489 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 464 PPPPPPPPPPPPPPPP 479 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 465 PPPPPPPPPPPPPPPP 480 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 466 PPPPPPPPPPPPPPPP 481 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 395 QTXXPXTSPPPXXPPPXPPXXXXP 466 Q P PPP PPP PP P Sbjct: 462 QAPPPPPPPPPPPPPPPPPPPPPP 485 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 34.7 bits (76), Expect = 0.11 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXT 458 PP PPPP PPP PP T Sbjct: 105 PPPPPPPPPPPPPPPPIT 122 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 102 PPPPPPPPPPPPPPPP 117 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 103 PPPPPPPPPPPPPPPP 118 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 104 PPPPPPPPPPPPPPPP 119 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP + P Sbjct: 56 PPPPPPPPPPPPPPPPSSSPSRP 78 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 54 PPPPPPPPPPPPPPPP 69 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 55 PPPPPPPPPPPPPPPP 70 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PPPP PPP PP P P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 33.5 bits (73), Expect = 0.26 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPP 390 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 381 PPPPPPPSPPPPPQPP 396 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 386 PPSPPPPPQPPPPPPP 401 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 392 PPQPPPPPPPPPPPPP 407 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 395 PPPPPPPPPPPPPPPP 410 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 410 PPPPPPPPPAPPPPPP 425 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 411 PPPPPPPPAPPPPPPP 426 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 412 PPPPPPPAPPPPPPPP 427 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 417 PPAPPPPPPPPPPPPP 432 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PPPP PP PP P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPP 393 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 P PPPP PPP PP P P Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP P Sbjct: 380 PPPPPPPPSPPPPPQP 395 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPP PPP PP Sbjct: 385 PPPSPPPPPQPPPPPP 400 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 P PPPP PPP PP Sbjct: 387 PSPPPPPQPPPPPPPP 402 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PP P PPP PP Sbjct: 389 PPPPPQPPPPPPPPPP 404 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP P PP PPP PP Sbjct: 390 PPPPQPPPPPPPPPPP 405 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPP PPP PP Sbjct: 391 PPPQPPPPPPPPPPPP 406 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPP PPP PP Sbjct: 413 PPPPPPAPPPPPPPPP 428 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PP P PPP PP Sbjct: 414 PPPPPAPPPPPPPPPP 429 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP P PP PPP PP Sbjct: 415 PPPPAPPPPPPPPPPP 430 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPP PPP PP Sbjct: 416 PPPAPPPPPPPPPPPP 431 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPP PPP P Q P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPP 396 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXP 466 P + PPP PPP PP P Sbjct: 386 PPSPPPPPQPPPPPPPPPPP 405 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 395 QTXXPXTSPPPXXPPPXPPXXXXP 466 Q P PPP PPP PP P Sbjct: 394 QPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXP 466 P PPP PPP PP P Sbjct: 391 PPPQPPPPPPPPPPPPPPPP 410 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 416 SPPPXXPPPXPPXXXXP 466 SPPP PPP PP P Sbjct: 364 SPPPPPPPPPPPPSPPP 380 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXP 466 P PPP PPP PP P Sbjct: 387 PSPPPPPQPPPPPPPPPPPP 406 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXP 466 P PPP PPP PP P Sbjct: 392 PPQPPPPPPPPPPPPPPPPP 411 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXP 466 P PPP PPP PP P Sbjct: 407 PPPPPPPPPPPPAPPPPPPP 426 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXP 466 P PPP PPP PP P Sbjct: 411 PPPPPPPPAPPPPPPPPPPP 430 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXP 466 P PPP PPP PP P Sbjct: 412 PPPPPPPAPPPPPPPPPPPP 431 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 424 PPPPPPPAPLPPPPPP 439 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +3 Query: 390 LTKXXPPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 L + PP PP P PPP PP +P P Sbjct: 421 LVQPPPPPPPAPLPPPPPPPPQPTTALPDPLQGP 454 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 1313 PPPPPPPPPPPPPLPP 1328 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 395 QTXXPXTSPPPXXPPPXPPXXXXPST 472 Q P + PPP PPP PP P T Sbjct: 1304 QIQPPESPPPPPPPPPPPPPPPLPPT 1329 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP PP P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXPSTRGXGIXPL 496 P PPP PPP PP P+ G L Sbjct: 1311 PPPPPPPPPPPPPPPLPPTPNVEDSGTHEL 1340 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 100 PPYPPPPPYPPPPNPP 115 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP P PP PPP PP P P Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPPNAP 123 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQ 467 PP PPPP PP PP Q Sbjct: 220 PPYPPPPNAPNPPYPPPPNPQ 240 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PP PP Sbjct: 209 PPYPPPPNAPNPPYPP 224 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PP PP Sbjct: 92 PPYPPPPYPPYPPPPP 107 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +3 Query: 405 PPXPPPPXXX--PPPXPPXTXXQVPGXXGXP 491 PP PPPP PPP PP P P Sbjct: 164 PPNPPPPNAPYPPPPYPPPPNPPYPPPPNPP 194 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 2/25 (8%) Frame = +3 Query: 405 PPXPP--PPXXXPPPXPPXTXXQVP 473 PP PP PP PPP PP P Sbjct: 151 PPNPPYPPPLYPPPPNPPPPNAPYP 175 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PP PP + QVP Sbjct: 308 PAPPPPLNATPPPPPPSRDQVP 329 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP P + P Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPP 24 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PP PP + QVP Sbjct: 220 PAPPPPLNATPPPPPPSRDQVP 241 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 32.3 bits (70), Expect = 0.61 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPP PPP PP ++P Sbjct: 301 PPPPPPTDFAPPPPPPEPTSELP 323 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 32.3 bits (70), Expect = 0.61 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 384 SILTKXXPPXPPPPXXXPPPXPP 452 S +T+ PP P PP PPP PP Sbjct: 199 SQITQPPPPPPRPPPSPPPPPPP 221 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXPL 494 PP PPPP P P PP P PL Sbjct: 212 PPSPPPPPPPPSPSPPRPPPPPPPSPPRPL 241 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PP P PPP PP P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPP 227 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 395 QTXXPXTSPPPXXPPPXPPXXXXP 466 Q P PPP PPP PP P Sbjct: 203 QPPPPPPRPPPSPPPPPPPPSPSP 226 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPP PPP P + + P Sbjct: 208 PPRPPPSPPPPPPPPSPSPPRPP 230 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVPGXXGXPL 494 P PPPP PPP PP P G L Sbjct: 195 PPPPPPPPPPPPPPPILELAAPPPPGSVL 223 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/26 (50%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +3 Query: 381 TSILTKXXPPXPP--PPXXXPPPXPP 452 TS T+ PP PP P PPP PP Sbjct: 131 TSPATRAPPPPPPIAPATGGPPPPPP 156 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 5/41 (12%) Frame = +3 Query: 384 SILTKXXPPXPPPPXXX-----PPPXPPXTXXQVPGXXGXP 491 SI T P PPPP PPP PP +PG P Sbjct: 779 SIPTTPPPEYPPPPPGLARPNPPPPNPPLQVTSIPGEPAPP 819 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXG 485 PP PPPP PP P PG G Sbjct: 107 PPTPPPPQTPAPPGPDTPAPPAPGGCG 133 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPG 476 PP PPP PP PP PG Sbjct: 97 PPATPPPPTMPPTPPPPQTPAPPG 120 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PP PPP PP VPG P Sbjct: 653 PPPPPGGGMFPPPPPPPPGGGVPGPPKPP 681 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 466 WXXVXGGXGGGXXXGGGGXGG 404 W V GG GGG GGG GG Sbjct: 482 WNVVPGGFGGGGGASGGGGGG 502 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 393 TKXXPPXPPPPXXXPPPXPP 452 T PP PP P PPP PP Sbjct: 192 TSVPPPPPPGPGGIPPPPPP 211 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP PP + P Sbjct: 231 PAPPPPPAAAPPPPPPPPPVKKP 253 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVR 389 GG GGG GGGG GG +++ Sbjct: 859 GGGGGGGGGGGGGGGGGGVIK 879 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 776 GGDGGGGGDGGGGGGG 791 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 782 GGDGGGGGGGGGGGGG 797 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 785 GGGGGGGGGGGGGGGG 800 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 786 GGGGGGGGGGGGGGGG 801 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 787 GGGGGGGGGGGGGGGG 802 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 790 GGGGGGGGGGGGGDGG 805 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 813 GGGGGGGGGGGGGDGG 828 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 847 GGGGGGGGGGGGGGGG 862 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 848 GGGGGGGGGGGGGGGG 863 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 849 GGGGGGGGGGGGGGGG 864 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 850 GGGGGGGGGGGGGGGG 865 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 851 GGGGGGGGGGGGGGGG 866 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 852 GGGGGGGGGGGGGGGG 867 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 853 GGGGGGGGGGGGGGGG 868 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 854 GGGGGGGGGGGGGGGG 869 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 855 GGGGGGGGGGGGGGGG 870 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 856 GGGGGGGGGGGGGGGG 871 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 857 GGGGGGGGGGGGGGGG 872 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 858 GGGGGGGGGGGGGGGG 873 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 30.3 bits (65), Expect = 2.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 405 PPXPPPPXXXPPPXP 449 PP PPPP PPP P Sbjct: 79 PPPPPPPPPPPPPPP 93 Score = 30.3 bits (65), Expect = 2.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 408 PXPPPPXXXPPPXPP 452 P PPPP PPP PP Sbjct: 79 PPPPPPPPPPPPPPP 93 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +3 Query: 384 SILTKXXPPX--PPPPXXXPPPXPPXTXXQVP 473 S+ PP PPPP PPP PP + P Sbjct: 67 SMAAATPPPLCAPPPPPPPPPPPPPPPGAKKP 98 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 398 TXXPXTSPPPXXPPPXPP 451 T P +PPP PPP PP Sbjct: 72 TPPPLCAPPPPPPPPPPP 89 >SB_36850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1008 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/45 (37%), Positives = 21/45 (46%) Frame = +2 Query: 350 HCYMFMNNVINEHSYQTXXPXTSPPPXXPPPXPPXXXXPSTRGXG 484 HC F N++ EH+ + P T P P P PP PS G G Sbjct: 198 HCTSFQINMLPEHACSSSHPLTRPIP--KPQRPP---QPSKSGSG 237 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPP PPP PP + P Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPP 576 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PP PPP PP + P Sbjct: 565 PPLPPSEDPKPPPPPPEPPEECP 587 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 396 KXXPPXPPPPXXXPPPXP 449 K PP P PP PPP P Sbjct: 574 KPPPPPPEPPEECPPPPP 591 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 30.3 bits (65), Expect = 2.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 405 PPXPPPPXXXPPPXP 449 PP PPPP PPP P Sbjct: 69 PPPPPPPPPLPPPPP 83 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 P PPPP PPP PP Sbjct: 65 PTLPPPPPPPPPPLPP 80 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PP PP Sbjct: 68 PPPPPPPPPPLPPPPP 83 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXPSTRGXGI 487 P T PPP PPP PP P G I Sbjct: 64 PPTLPPP--PPPPPPPLPPPPPSGGNI 88 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 393 TKXXPPXPPPPXXXPPP 443 T PP PPPP PPP Sbjct: 66 TLPPPPPPPPPPLPPPP 82 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 30.3 bits (65), Expect = 2.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 405 PPXPPPPXXXPPPXP 449 PP PPPP PPP P Sbjct: 280 PPPPPPPPPPPPPPP 294 Score = 30.3 bits (65), Expect = 2.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 408 PXPPPPXXXPPPXPP 452 P PPPP PPP PP Sbjct: 280 PPPPPPPPPPPPPPP 294 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +3 Query: 384 SILTKXXPPX--PPPPXXXPPPXPPXTXXQVP 473 S+ PP PPPP PPP PP + P Sbjct: 268 SMAAATPPPLCAPPPPPPPPPPPPPPPGAKKP 299 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 398 TXXPXTSPPPXXPPPXPP 451 T P +PPP PPP PP Sbjct: 273 TPPPLCAPPPPPPPPPPP 290 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 30.3 bits (65), Expect = 2.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 405 PPXPPPPXXXPPPXP 449 PP PPPP PPP P Sbjct: 293 PPPPPPPPPLPPPPP 307 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 P PPPP PPP PP Sbjct: 289 PTLPPPPPPPPPPLPP 304 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PP PP Sbjct: 292 PPPPPPPPPPLPPPPP 307 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXPSTRGXGI 487 P T PPP PPP PP P G I Sbjct: 288 PPTLPPP--PPPPPPPLPPPPPSGGNI 312 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 393 TKXXPPXPPPPXXXPPP 443 T PP PPPP PPP Sbjct: 290 TLPPPPPPPPPPLPPPP 306 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXPST 472 P +SP P PPP PP P+T Sbjct: 1167 PPSSPSPPPPPPPPPPPPTPTT 1188 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP P P PP Sbjct: 1161 PPPPPPPPSSPSPPPP 1176 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PP PP Sbjct: 1162 PPPPPPPSSPSPPPPP 1177 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPP PPP PP Sbjct: 1163 PPPPPPSSPSPPPPPP 1178 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXT 458 P PPPP PPP P T Sbjct: 1173 PPPPPPPPPPPPTPTTT 1189 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXT 458 P P PP PPP PP T Sbjct: 1168 PSSPSPPPPPPPPPPPPT 1185 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXT 458 P PPPP PPP P T Sbjct: 1171 PSPPPPPPPPPPPPTPTT 1188 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +2 Query: 365 MNNVINEHSYQTXXPXTSPPPXXPPPXPPXXXXPSTRGXGIXPL 496 + NV+ +++ ++ P ++PPP PPP P P+ G PL Sbjct: 667 LTNVLQDNARKSS-PSSAPPPPAPPPPPIGGGDPTIWVSGGPPL 709 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 30.3 bits (65), Expect = 2.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 405 PPXPPPPXXXPPPXP 449 PP PPPP PPP P Sbjct: 163 PPQPPPPPLPPPPPP 177 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPP PPP PP Sbjct: 162 PPPQPPPPPLPPPPPP 177 >SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) Length = 198 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPP PPP PP Sbjct: 147 PPRTPPPEPTPPPTPP 162 >SB_43997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1067 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +2 Query: 386 HSYQTXXPXTSPP---PXXPPPXPPXXXXPSTRGXGIXP 493 H Y T P +SP P PP PP PS+ + P Sbjct: 135 HHYPTYPPSSSPSSSFPSVPPSSPPSSSSPSSSSPSVPP 173 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 405 PPXPPPPX--XXPPPXPPXTXXQVPGXXGXPL 494 P PPPP PPP PP PG PL Sbjct: 942 PSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPL 973 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PP PP Sbjct: 971 PPLPPPPGGSAPPPPP 986 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 982 PPPPPPP---PPPPPP 994 >SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) Length = 188 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP P PP PPP PP Sbjct: 31 PPPPSPPPSPPPPSPP 46 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP P PP PPP PP Sbjct: 154 PPPPSPPPSPPPPSPP 169 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 398 TXXPXTSPPPXXPPPXPPXXXXPSTR 475 T P +PPP PP PP P+T+ Sbjct: 427 TATPPPTPPPTPPPTPPPTTLPPTTQ 452 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP P Q P Sbjct: 85 PPPPPPLPAPPPPPAQPAPQPP 106 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP P Sbjct: 142 PPPPPPPPSPPPPCHP 157 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PP PP Sbjct: 143 PPPPPPPSPPPPCHPP 158 >SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +3 Query: 390 LTKXXPPXP-PPPXXXPPPXPP 452 LT+ PP P PP PPP PP Sbjct: 134 LTRLTPPQPSPPQPPQPPPQPP 155 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 P PPPP PPP PP Sbjct: 461 PIPPPPPMSPPPPTPP 476 Score = 28.7 bits (61), Expect = 7.5 Identities = 16/54 (29%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = +2 Query: 359 MFMNNVINEHSYQTXXPXTSPPPXXPP--PXPPXXXXPSTRGXGIXPLXXGXLG 514 MFMN ++ +H YQ T+ P P PP P + G P +G Sbjct: 840 MFMNVMLQQHHYQQHPQMTAMQPQYQPLLVPPPPQFLPMSPAMGPIPTMQPVMG 893 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/38 (36%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +3 Query: 381 TSILTKXXPPXPPPPXXXPP-PXPPXTXXQVPGXXGXP 491 +S+ PP PPPP P PP PG G P Sbjct: 689 SSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLP 726 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 393 TKXXPPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 T PP PPPP PP PG G P Sbjct: 708 TLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLP 740 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 2/25 (8%) Frame = +3 Query: 405 PPXPPPPXXX--PPPXPPXTXXQVP 473 PP PPPP PPP PP P Sbjct: 742 PPPPPPPGCAGLPPPPPPIDVPMKP 766 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 5/34 (14%) Frame = +3 Query: 405 PPXPPPP-----XXXPPPXPPXTXXQVPGXXGXP 491 PP PPPP PPP PP P G P Sbjct: 197 PPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGP 230 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVR 389 GG GGG GGGG GG + R Sbjct: 95 GGGGGGDGGGGGGGGGGGVGR 115 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 62 GGGGGGGGGGGGGGGG 77 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 63 GGGGGGGGGGGGGGGG 78 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 64 GGGGGGGGGGGGGGGG 79 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 65 GGGGGGGGGGGGGGGG 80 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 66 GGGGGGGGGGGGGGGG 81 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 67 GGGGGGGGGGGGGGGG 82 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 68 GGGGGGGGGGGGGGGG 83 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 93 GGGGGGGGDGGGGGGG 108 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 94 GGGGGGGDGGGGGGGG 109 >SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +3 Query: 390 LTKXXPPXP-PPPXXXPPPXPP 452 LT+ PP P PP PPP PP Sbjct: 152 LTRLTPPQPSPPQPPQPPPQPP 173 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXG 485 PP PPP PPP P PG G Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPG 55 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 132 GGGGGGGGGGGGGGGG 147 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 133 GGGGGGGGGGGGGGGG 148 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 134 GGGGGGGGGGGGGGGG 149 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 135 GGGGGGGGGGGGGGGG 150 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 136 GGGGGGGGGGGGGGGG 151 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 137 GGGGGGGGGGGGGGGG 152 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 138 GGGGGGGGGGGGGGGG 153 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 139 GGGGGGGGGGGGGGGG 154 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 140 GGGGGGGGGGGGGGGG 155 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 141 GGGGGGGGGGGGGGGG 156 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 142 GGGGGGGGGGGGGGGG 157 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 143 GGGGGGGGGGGGGGGG 158 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 144 GGGGGGGGGGGGGGGG 159 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 145 GGGGGGGGGGGGGGGG 160 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 146 GGGGGGGGGGGGGGGG 161 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 147 GGGGGGGGGGGGGGGG 162 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 148 GGGGGGGGGGGGGGGG 163 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 149 GGGGGGGGGGGGGGGG 164 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 150 GGGGGGGGGGGGGGGG 165 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 151 GGGGGGGGGGGGGGGG 166 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 86 GGGGGGGGVGGGGGGG 101 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 87 GGGGGGGVGGGGGGGG 102 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 88 GGGGGGVGGGGGGGGG 103 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +3 Query: 381 TSILTKXXPPXPP-PPXXXPPPXPPXTXXQVP 473 ++I T PP PP PP PP PP +P Sbjct: 183 STIPTPPTPPAPPSPPIPTAPPTPPMPETPLP 214 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 41 GGGGGGGGGGGGGGGG 56 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 42 GGGGGGGGGGGGGGGG 57 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 43 GGGGGGGGGGGGGGGG 58 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 44 GGGGGGGGGGGGGGGG 59 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 311 GGDGGGGGGGGGGGGG 326 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 314 GGGGGGGGGGGGGDGG 329 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 53 GGGGGGGGGGGGGGGG 68 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 54 GGGGGGGGGGGGGGGG 69 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 55 GGGGGGGGGGGGGGGG 70 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 56 GGGGGGGGGGGGGGGG 71 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 57 GGGGGGGGGGGGGGGG 72 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 58 GGGGGGGGGGGGGGGG 73 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 59 GGGGGGGGGGGGGGGG 74 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 60 GGGGGGGGGGGGGGGG 75 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 61 GGGGGGGGGGGGGGGG 76 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 62 GGGGGGGGGGGGGGGG 77 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 320 GGGGGGGGGGGGGGGG 335 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 321 GGGGGGGGGGGGGGGG 336 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 322 GGGGGGGGGGGGGGGG 337 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 323 GGGGGGGGGGGGGGGG 338 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 324 GGGGGGGGGGGGGGGG 339 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 514 GGGGGGGGGGGGGGGG 529 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 517 GGGGGGGGGGGGGRGG 532 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 342 GGGGGGGGGGGGGGGG 357 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 343 GGGGGGGGGGGGGGGG 358 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 344 GGGGGGGGGGGGGGGG 359 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 347 GGGGGGGGGGGGGRGG 362 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 85 GGFGGGGGFGGGGGGG 100 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 102 GGGGGGGFGGGGGGGG 117 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 103 GGGGGGFGGGGGGGGG 118 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 111 GGGGGGGGFGGGGGGG 126 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 211 PPPPPPP--PPPPPPP 224 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 659 GGDGGGGGGGGGGGGG 674 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 662 GGGGGGGGGGGGGGGG 677 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 663 GGGGGGGGGGGGGGGG 678 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 664 GGGGGGGGGGGGGGGG 679 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 665 GGGGGGGGGGGGGGGG 680 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 666 GGGGGGGGGGGGGGGG 681 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 667 GGGGGGGGGGGGGGGG 682 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 668 GGGGGGGGGGGGGGGG 683 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 669 GGGGGGGGGGGGGGGG 684 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 670 GGGGGGGGGGGGGGGG 685 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 671 GGGGGGGGGGGGGGGG 686 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 672 GGGGGGGGGGGGGGGG 687 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 673 GGGGGGGGGGGGGGGG 688 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 674 GGGGGGGGGGGGGGGG 689 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 675 GGGGGGGGGGGGGGGG 690 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 676 GGGGGGGGGGGGGGGG 691 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 677 GGGGGGGGGGGGGGGG 692 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 678 GGGGGGGGGGGGGGGG 693 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 679 GGGGGGGGGGGGGGGG 694 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 680 GGGGGGGGGGGGGGGG 695 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 681 GGGGGGGGGGGGGGGG 696 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 682 GGGGGGGGGGGGGGGG 697 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 683 GGGGGGGGGGGGGGGG 698 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 684 GGGGGGGGGGGGGGGG 699 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 685 GGGGGGGGGGGGGGGG 700 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 686 GGGGGGGGGGGGGGGG 701 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGG 404 GG GGG GGGG GG Sbjct: 689 GGGGGGGGGGGGGAGG 704 >SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) Length = 246 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXT 458 PP PP PPP PP T Sbjct: 159 PPSSSPPLSSPPPPPPST 176 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 381 TSILTKXXPPXPPPPXXXPPPXPPXTXXQVP 473 TS T P PP P PP PP VP Sbjct: 662 TSPKTTPKPHIPPAPSRPPPQLPPEASKAVP 692 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PPP PPP P +PG G P Sbjct: 249 PPGMPPPGMMPPPGFPPMG--MPGMGGMP 275 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 381 TSILTKXXPPXPPPPXXXPPPXPPXT 458 TS + + PP P P P P PP T Sbjct: 89 TSAIDQPLPPPPSSPSTGPTPAPPVT 114 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 P PPPP PPP P P P Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLPAGP 538 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 359 PPPPPPP---PPPTPP 371 >SB_29033| Best HMM Match : Ion_trans_2 (HMM E-Value=8.1e-29) Length = 387 Score = 28.3 bits (60), Expect = 9.9 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +3 Query: 219 TMPWELGTI-VNASGDRK-AVGHDGEVAGLPDIYSWFIT 329 T+PW LGT+ V G R+ V DG + L IY FIT Sbjct: 171 TLPWTLGTLHVRYVGYRRDIVRSDGTLELLDGIYFCFIT 209 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXG 485 PP PP PPP PP P G Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPG 205 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,574,545 Number of Sequences: 59808 Number of extensions: 374049 Number of successful extensions: 4751 Number of sequences better than 10.0: 68 Number of HSP's better than 10.0 without gapping: 1352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3117 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2872045441 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -