BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_C18 (973 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value D21852-1|BAA04878.2| 974|Homo sapiens KIAA0029 protein. 38 0.042 BC041093-1|AAH41093.1| 1099|Homo sapiens R3H domain containing 1... 38 0.042 AC016742-1|AAY14728.1| 784|Homo sapiens unknown protein. 38 0.042 X67337-1|CAA47752.1| 551|Homo sapiens Human pre-mRNA cleavage f... 38 0.055 X67336-1|CAA47751.1| 551|Homo sapiens HPBRII-7 protein. 38 0.055 BC005000-1|AAH05000.1| 478|Homo sapiens CPSF6 protein protein. 38 0.055 BC000714-1|AAH00714.1| 588|Homo sapiens CPSF6 protein protein. 38 0.055 AK223568-1|BAD97288.1| 551|Homo sapiens cleavage and polyadenyl... 38 0.055 BC146811-1|AAI46812.1| 854|Homo sapiens ZNF341 protein protein. 37 0.13 BC132873-1|AAI32874.1| 854|Homo sapiens ZNF341 protein protein. 37 0.13 BC094738-1|AAH94738.1| 795|Homo sapiens ZNF341 protein protein. 37 0.13 AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. 37 0.13 AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein pr... 37 0.13 AL050349-3|CAI21796.2| 847|Homo sapiens zinc finger protein 341... 37 0.13 AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. 37 0.13 AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein. 37 0.13 AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. 37 0.13 AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain... 36 0.30 AK027872-1|BAB55422.1| 509|Homo sapiens protein ( Homo sapiens ... 36 0.30 AB037732-1|BAA92549.1| 889|Homo sapiens KIAA1311 protein protein. 36 0.30 BC067364-1|AAH67364.1| 871|Homo sapiens PRP40 pre-mRNA processi... 35 0.52 BC050398-1|AAH50398.1| 788|Homo sapiens PRPF40B protein protein. 35 0.52 AB083343-1|BAE96598.1| 3599|Homo sapiens zinc-finger homeodomain... 35 0.52 Z96050-3|CAB09424.1| 281|Homo sapiens Fas ligand (TNF superfami... 34 0.68 X89102-1|CAA61474.1| 281|Homo sapiens Fasligand protein. 34 0.68 U11821-1|AAC50124.1| 281|Homo sapiens Fas ligand protein. 34 0.68 U08137-1|AAC50071.1| 281|Homo sapiens Fas ligand protein. 34 0.68 EF064739-1|ABK41922.1| 281|Homo sapiens Fas ligand (TNF superfa... 34 0.68 D38122-1|BAA07320.1| 281|Homo sapiens Fas ligand protein. 34 0.68 BC017502-1|AAH17502.1| 281|Homo sapiens Fas ligand (TNF superfa... 34 0.68 AY858799-1|AAX49569.1| 281|Homo sapiens CD95 ligand protein. 34 0.68 AY225406-1|AAO43991.1| 281|Homo sapiens FAS ligand protein. 34 0.68 AF288573-1|AAG60017.1| 127|Homo sapiens FasL isoform protein. 34 0.68 AK123353-1|BAC85591.1| 195|Homo sapiens DC3) mRNA. protein. 33 1.2 AK097947-1|BAC05201.1| 209|Homo sapiens protein ( Homo sapiens ... 33 1.2 AK095189-1|BAC04495.1| 634|Homo sapiens protein ( Homo sapiens ... 33 1.2 AB075851-1|BAB85557.1| 830|Homo sapiens KIAA1971 protein protein. 33 1.2 BX537864-1|CAD97867.1| 270|Homo sapiens hypothetical protein pr... 33 1.6 BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. 33 1.6 BC037404-1|AAH37404.1| 1015|Homo sapiens formin binding protein ... 33 1.6 AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open readi... 33 1.6 AL078621-10|CAB81647.1| 232|Homo sapiens protein ( G islands. ... 33 1.6 AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open readi... 33 1.6 AK091683-1|BAC03720.1| 749|Homo sapiens protein ( Homo sapiens ... 33 1.6 AK056450-1|BAB71186.1| 568|Homo sapiens protein ( Homo sapiens ... 33 1.6 AK022987-1|BAB14348.1| 560|Homo sapiens protein ( Homo sapiens ... 33 1.6 AB051514-1|BAB21818.1| 1130|Homo sapiens KIAA1727 protein protein. 33 1.6 AB051500-1|BAB21804.2| 1652|Homo sapiens KIAA1713 protein protein. 33 1.6 AB023231-1|BAA76858.2| 1050|Homo sapiens KIAA1014 protein protein. 33 1.6 Z46389-1|CAA86523.1| 380|Homo sapiens vasodilator-stimulated ph... 28 1.7 X98534-1|CAA67147.2| 378|Homo sapiens vasodilator-stimulated ph... 28 1.7 BC038224-1|AAH38224.1| 380|Homo sapiens vasodilator-stimulated ... 28 1.7 BC026019-1|AAH26019.1| 380|Homo sapiens vasodilator-stimulated ... 28 1.7 Y08766-1|CAA70019.1| 638|Homo sapiens SF1-Bo isoform protein. 33 2.1 Y08765-1|CAA70018.1| 639|Homo sapiens SF1-Hl1 isoform protein. 33 2.1 L49380-1|AAB04033.1| 639|Homo sapiens transcription factor ZFM1... 33 2.1 L49345-1|AAB03514.1| 571|Homo sapiens transcription factor ZFM1... 33 2.1 D26120-2|BAA05117.1| 623|Homo sapiens ZFM1 protein protein. 33 2.1 D26120-1|BAA05116.1| 548|Homo sapiens ZFM1 protein alternativel... 33 2.1 BC028050-1|AAH28050.1| 634|Homo sapiens CREB regulated transcri... 33 2.1 BC023614-1|AAH23614.2| 604|Homo sapiens CRTC1 protein protein. 33 2.1 BC020217-1|AAH20217.1| 548|Homo sapiens splicing factor 1 protein. 33 2.1 BC017075-1|AAH17075.2| 475|Homo sapiens CRTC1 protein protein. 33 2.1 BC008724-1|AAH08724.1| 548|Homo sapiens splicing factor 1 protein. 33 2.1 BC008080-1|AAH08080.1| 548|Homo sapiens splicing factor 1 protein. 33 2.1 BC000773-1|AAH00773.1| 265|Homo sapiens Similar to zinc finger ... 33 2.1 AY360171-1|AAQ98856.1| 650|Homo sapiens transducer of regulated... 33 2.1 AY040323-1|AAK93832.1| 593|Homo sapiens mucoepidermoid suscepti... 33 2.1 AL158217-11|CAI22163.1| 854|Homo sapiens espin protein. 33 2.1 AL035288-1|CAA22892.1| 671|Homo sapiens hypothetical protein pr... 33 2.1 AL031848-3|CAI19773.1| 854|Homo sapiens espin protein. 33 2.1 AL021920-3|CAI19632.1| 671|Homo sapiens espin pseudogene protein. 33 2.1 AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrom... 33 2.1 AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. 33 2.1 AC006123-1|AAC97072.1| 414|Homo sapiens KIAA0616 protein protein. 33 2.1 AB014516-1|BAA31591.1| 634|Homo sapiens KIAA0616 protein protein. 33 2.1 U26712-1|AAB09293.1| 770|Homo sapiens cbl-b truncated form 2 pr... 32 2.7 U26711-1|AAB09292.1| 810|Homo sapiens cbl-b truncated form 1 pr... 32 2.7 U26710-1|AAB09291.1| 982|Homo sapiens cbl-b protein. 32 2.7 DQ854815-1|ABI75145.1| 112|Homo sapiens hyperpolarization-activ... 32 2.7 BC050072-1|AAH50072.1| 489|Homo sapiens forkhead box G1 protein. 32 2.7 BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, mem... 32 2.7 BC032851-1|AAH32851.1| 982|Homo sapiens Cas-Br-M (murine) ecotr... 32 2.7 AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, mem... 32 2.7 AK128867-1|BAC87651.1| 121|Homo sapiens protein ( Homo sapiens ... 32 2.7 AJ133727-1|CAB42630.1| 889|Homo sapiens hyperpolarization-activ... 32 2.7 AJ012582-1|CAB42602.1| 889|Homo sapiens hyperpolarization-activ... 32 2.7 AF386649-1|AAL26987.1| 1362|Homo sapiens bromodomain-containing ... 32 2.7 AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. 32 2.7 AC005559-2|AAC33280.2| 528|Homo sapiens hyperpolarization activ... 32 2.7 AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein pro... 32 2.7 X04106-1|CAA27726.1| 268|Homo sapiens protein ( Human mRNA for ... 32 3.6 M31511-1|AAA35646.1| 268|Homo sapiens protein ( Human calcium-a... 32 3.6 D87459-1|BAA13399.2| 567|Homo sapiens KIAA0269 protein. 32 3.6 BX538087-1|CAD98010.1| 913|Homo sapiens hypothetical protein pr... 32 3.6 BX537578-1|CAD97788.1| 913|Homo sapiens hypothetical protein pr... 32 3.6 BT009775-1|AAP88777.1| 268|Homo sapiens calpain, small subunit ... 32 3.6 BC094799-1|AAH94799.1| 1222|Homo sapiens valosin containing prot... 32 3.6 BC064998-1|AAH64998.1| 268|Homo sapiens CAPNS1 protein protein. 32 3.6 BC049204-1|AAH49204.1| 251|Homo sapiens homeobox B4 protein. 32 3.6 BC044591-1|AAH44591.1| 559|Homo sapiens WAS protein family, mem... 32 3.6 BC028697-1|AAH28697.3| 913|Homo sapiens WD repeat domain 44 pro... 32 3.6 BC023643-1|AAH23643.1| 268|Homo sapiens calpain, small subunit ... 32 3.6 BC021933-1|AAH21933.1| 268|Homo sapiens calpain, small subunit ... 32 3.6 BC018931-1|AAH18931.1| 268|Homo sapiens calpain, small subunit ... 32 3.6 BC017308-1|AAH17308.1| 268|Homo sapiens calpain, small subunit ... 32 3.6 BC011903-1|AAH11903.1| 322|Homo sapiens CAPNS1 protein protein. 32 3.6 BC007779-1|AAH07779.1| 268|Homo sapiens calpain, small subunit ... 32 3.6 BC000592-1|AAH00592.1| 268|Homo sapiens calpain, small subunit ... 32 3.6 AY789642-1|AAV40829.1| 268|Homo sapiens calpain, small subunit ... 32 3.6 AL834210-1|CAD38894.1| 805|Homo sapiens hypothetical protein pr... 32 3.6 AL590009-1|CAI12485.1| 559|Homo sapiens WAS protein family, mem... 32 3.6 AL391830-2|CAI41512.1| 913|Homo sapiens WD repeat domain 44 pro... 32 3.6 AL391830-1|CAI41513.1| 905|Homo sapiens WD repeat domain 44 pro... 32 3.6 AL391803-3|CAI41482.1| 913|Homo sapiens WD repeat domain 44 pro... 32 3.6 AL391803-2|CAI41483.1| 905|Homo sapiens WD repeat domain 44 pro... 32 3.6 AL391803-1|CAI41481.1| 805|Homo sapiens WD repeat domain 44 pro... 32 3.6 AL391474-2|CAI41402.1| 913|Homo sapiens WD repeat domain 44 pro... 32 3.6 AL391474-1|CAI41403.1| 905|Homo sapiens WD repeat domain 44 pro... 32 3.6 AL137449-1|CAB70742.1| 246|Homo sapiens hypothetical protein pr... 32 3.6 AK123671-1|BAC85674.1| 520|Homo sapiens protein ( Homo sapiens ... 32 3.6 AK095824-1|BAC04633.1| 231|Homo sapiens protein ( Homo sapiens ... 32 3.6 AF307160-1|AAG45052.1| 251|Homo sapiens HOXB4 protein. 32 3.6 AF287967-4|AAG31554.1| 251|Homo sapiens homeobox B4 protein. 32 3.6 AF134303-1|AAD33052.1| 559|Homo sapiens Scar1 protein. 32 3.6 AF110377-1|AAD04629.1| 3859|Homo sapiens PCAF-associated factor ... 32 3.6 AF076974-1|AAD09420.1| 3830|Homo sapiens TRRAP protein protein. 32 3.6 AF065164-1|AAC28444.2| 889|Homo sapiens hyperpolarization-activ... 32 3.6 AD001527-4|AAB51183.1| 268|Homo sapiens calcium-dependent prote... 32 3.6 AC004991-1|AAC27675.2| 2089|Homo sapiens unknown protein. 32 3.6 AC002984-1|AAB81546.1| 268|Homo sapiens CANS_Human protein. 32 3.6 AB209489-1|BAD92726.1| 3587|Homo sapiens Transformation/transcri... 32 3.6 AB058753-1|BAB47479.1| 1236|Homo sapiens KIAA1850 protein protein. 32 3.6 AB028974-1|BAA83003.2| 402|Homo sapiens KIAA1051 protein protein. 32 3.6 U88666-1|AAC05299.1| 686|Homo sapiens serine kinase SRPK2 protein. 31 4.8 U66615-1|AAC50693.1| 1104|Homo sapiens SWI/SNF complex 155 KDa s... 31 4.8 U23767-1|AAA92290.1| 1178|Homo sapiens calcium-activated potassi... 31 4.8 U13913-1|AAA85104.1| 1178|Homo sapiens large-conductance calcium... 31 4.8 BC117407-1|AAI17408.1| 1081|Homo sapiens LOC152485 protein protein. 31 4.8 BC117213-1|AAI17214.1| 1105|Homo sapiens SWI/SNF related, matrix... 31 4.8 BC113465-1|AAI13466.1| 1105|Homo sapiens SWI/SNF related, matrix... 31 4.8 BC068547-1|AAH68547.1| 688|Homo sapiens SRPK2 protein protein. 31 4.8 BC062659-1|AAH62659.1| 168|Homo sapiens KCNMA1 protein protein. 31 4.8 BC050564-1|AAH50564.1| 1105|Homo sapiens SWI/SNF related, matrix... 31 4.8 BC035214-1|AAH35214.1| 688|Homo sapiens SFRS protein kinase 2 p... 31 4.8 BC023532-1|AAH23532.1| 641|Homo sapiens WW domain binding prote... 31 4.8 BC016441-1|AAH16441.2| 400|Homo sapiens WBP11 protein protein. 31 4.8 BC001621-1|AAH01621.1| 641|Homo sapiens WW domain binding prote... 31 4.8 AY950679-1|AAY34147.1| 659|Homo sapiens MEX3C protein. 31 4.8 AY354201-1|AAQ63886.1| 546|Homo sapiens SFRS protein kinase 2 i... 31 4.8 AL731560-10|CAI40877.1| 1178|Homo sapiens potassium large conduc... 31 4.8 AL731560-8|CAI40874.1| 1205|Homo sapiens potassium large conduct... 31 4.8 AL731560-2|CAI40870.1| 1177|Homo sapiens potassium large conduct... 31 4.8 AL731556-10|CAI14082.1| 1178|Homo sapiens potassium large conduc... 31 4.8 AL731556-8|CAI14079.1| 1205|Homo sapiens potassium large conduct... 31 4.8 AL731556-2|CAI14074.1| 1177|Homo sapiens potassium large conduct... 31 4.8 AL627447-10|CAI16171.1| 1178|Homo sapiens potassium large conduc... 31 4.8 AL627447-8|CAI16166.1| 1205|Homo sapiens potassium large conduct... 31 4.8 AL627447-2|CAI16162.1| 1177|Homo sapiens potassium large conduct... 31 4.8 AL157833-10|CAI39736.1| 1178|Homo sapiens potassium large conduc... 31 4.8 AL157833-8|CAI39734.1| 1205|Homo sapiens potassium large conduct... 31 4.8 AL157833-2|CAI39730.1| 1177|Homo sapiens potassium large conduct... 31 4.8 AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens ... 31 4.8 AK091130-1|BAC03591.1| 1077|Homo sapiens protein ( Homo sapiens ... 31 4.8 AF499137-1|AAQ07403.1| 903|Homo sapiens synaptopodin protein. 31 4.8 AF499136-1|AAQ07402.1| 903|Homo sapiens synaptopodin protein. 31 4.8 AF118023-1|AAD30425.1| 641|Homo sapiens SH3 domain-binding prot... 31 4.8 AC005070-2|AAC29140.1| 675|Homo sapiens serine kinase SRPK2 pro... 31 4.8 AC005070-1|AAC29141.1| 675|Homo sapiens WUGSC:H_RG152G17.1a pro... 31 4.8 AB058717-1|BAB47443.1| 1285|Homo sapiens KIAA1814 protein protein. 31 4.8 AB029309-1|BAA88410.1| 641|Homo sapiens Npw38-binding protein N... 31 4.8 AB028952-1|BAA82981.2| 1015|Homo sapiens KIAA1029 protein protein. 31 4.8 U59832-1|AAC50661.1| 465|Homo sapiens FREAC-4 protein. 31 6.3 U59831-1|AAC50660.1| 465|Homo sapiens forkhead related activato... 31 6.3 D88460-1|BAA20128.1| 505|Homo sapiens N-WASP protein. 31 6.3 BC052955-1|AAH52955.1| 505|Homo sapiens Wiskott-Aldrich syndrom... 31 6.3 BC035727-1|AAH35727.1| 337|Homo sapiens Lix1 homolog (mouse)-li... 31 6.3 AM404259-1|CAL49295.1| 1200|Homo sapiens breast cancer anti-estr... 31 6.3 AM404183-1|CAL49297.1| 1200|Homo sapiens breast cancer anti-estr... 31 6.3 AM404182-1|CAL49296.1| 1220|Homo sapiens breast cancer anti-estr... 31 6.3 AM295156-1|CAL26602.1| 505|Homo sapiens WASL protein protein. 31 6.3 AL096814-1|CAD92526.1| 1200|Homo sapiens transcriptional regulat... 31 6.3 AK127803-1|BAC87142.1| 1063|Homo sapiens protein ( Homo sapiens ... 31 6.3 AK075231-1|BAC11488.1| 169|Homo sapiens protein ( Homo sapiens ... 31 6.3 AK024089-1|BAB14822.1| 593|Homo sapiens protein ( Homo sapiens ... 31 6.3 AF492646-1|AAO85488.1| 546|Homo sapiens proline rich, vinculin ... 31 6.3 AF297872-1|AAL01653.1| 1200|Homo sapiens zinc finger transcripti... 31 6.3 AF070530-1|AAC28630.1| 416|Homo sapiens unknown protein. 31 6.3 AC006333-1|AAQ96857.1| 505|Homo sapiens unknown protein. 31 6.3 AB209373-1|BAD92610.1| 410|Homo sapiens CS0DA006YC23 variant pr... 31 6.3 AB097023-1|BAC77376.1| 712|Homo sapiens putative NFkB activatin... 31 6.3 AB093555-1|BAC44839.1| 712|Homo sapiens TIR domain containing a... 31 6.3 AB086380-1|BAC55579.1| 712|Homo sapiens TICAM-1 protein. 31 6.3 AB002337-1|BAA20797.2| 1709|Homo sapiens KIAA0339 protein protein. 31 6.3 X16667-1|CAA34657.1| 431|Homo sapiens protein ( Human HOX2G mRN... 31 8.4 U69127-1|AAC50893.1| 600|Homo sapiens FUSE binding protein 3 pr... 31 8.4 U59298-1|AAD10852.1| 431|Homo sapiens hox homeobox transcriptio... 31 8.4 BC111560-1|AAI11561.1| 1040|Homo sapiens protocadherin 10 protein. 31 8.4 BC050283-1|AAH50283.1| 499|Homo sapiens WASF3 protein protein. 31 8.4 BC021165-1|AAH21165.1| 609|Homo sapiens ZNF503 protein protein. 31 8.4 BC013011-1|AAH13011.1| 609|Homo sapiens ZNF503 protein protein. 31 8.4 BC011625-1|AAH11625.1| 646|Homo sapiens zinc finger protein 503... 31 8.4 AY013874-1|AAK21987.1| 896|Homo sapiens protocadherin 10 protein. 31 8.4 AL163538-1|CAH72487.1| 502|Homo sapiens WAS protein family, mem... 31 8.4 AL159978-1|CAI14691.1| 502|Homo sapiens WAS protein family, mem... 31 8.4 AF521671-1|AAN03447.1| 2165|Homo sapiens SWI/SNF chromatin remod... 31 8.4 AF454702-1|AAL51032.1| 502|Homo sapiens WAVE3 protein. 31 8.4 AF287967-5|AAG31555.1| 431|Homo sapiens homeobox B3 protein. 31 8.4 AF253515-1|AAN70985.1| 1957|Homo sapiens BAF250b subunit protein. 31 8.4 AF134305-1|AAD33054.1| 455|Homo sapiens Scar3 protein. 31 8.4 AC105383-1|AAY41018.1| 1040|Homo sapiens unknown protein. 31 8.4 AB209210-1|BAD92447.1| 387|Homo sapiens dishevelled 1 isoform a... 31 8.4 AB037821-1|BAA92638.1| 1093|Homo sapiens KIAA1400 protein protein. 31 8.4 AB026543-1|BAA81796.1| 502|Homo sapiens WASP-family protein pro... 31 8.4 AB020707-1|BAA74923.2| 503|Homo sapiens KIAA0900 protein protein. 31 8.4 >D21852-1|BAA04878.2| 974|Homo sapiens KIAA0029 protein. Length = 974 Score = 38.3 bits (85), Expect = 0.042 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +3 Query: 387 ILTKXXPPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 I+T PP PPPP PPP PP Q G P Sbjct: 459 IMTAAPPPHPPPPPPPPPPPPPLPPGQPVPTAGYP 493 Score = 34.3 bits (75), Expect = 0.68 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +2 Query: 350 HCYMFMNNVINEHSYQTXXPXTSPPPXXPPPXPPXXXXP 466 H MF + V+ + Q+ T+ PP PPP PP P Sbjct: 440 HAAMFQSTVVLQSPQQSGYIMTAAPPPHPPPPPPPPPPP 478 >BC041093-1|AAH41093.1| 1099|Homo sapiens R3H domain containing 1 protein. Length = 1099 Score = 38.3 bits (85), Expect = 0.042 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +3 Query: 387 ILTKXXPPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 I+T PP PPPP PPP PP Q G P Sbjct: 584 IMTAAPPPHPPPPPPPPPPPPPLPPGQPVPTAGYP 618 Score = 34.3 bits (75), Expect = 0.68 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +2 Query: 350 HCYMFMNNVINEHSYQTXXPXTSPPPXXPPPXPPXXXXP 466 H MF + V+ + Q+ T+ PP PPP PP P Sbjct: 565 HAAMFQSTVVLQSPQQSGYIMTAAPPPHPPPPPPPPPPP 603 >AC016742-1|AAY14728.1| 784|Homo sapiens unknown protein. Length = 784 Score = 38.3 bits (85), Expect = 0.042 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +3 Query: 387 ILTKXXPPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 I+T PP PPPP PPP PP Q G P Sbjct: 584 IMTAAPPPHPPPPPPPPPPPPPLPPGQPVPTAGYP 618 Score = 34.3 bits (75), Expect = 0.68 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +2 Query: 350 HCYMFMNNVINEHSYQTXXPXTSPPPXXPPPXPPXXXXP 466 H MF + V+ + Q+ T+ PP PPP PP P Sbjct: 565 HAAMFQSTVVLQSPQQSGYIMTAAPPPHPPPPPPPPPPP 603 >X67337-1|CAA47752.1| 551|Homo sapiens Human pre-mRNA cleavage factor I 68 kDa subunit protein. Length = 551 Score = 37.9 bits (84), Expect = 0.055 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXPL 494 PP PPPP PPP P + PG G PL Sbjct: 306 PPGPPPPQQGPPPPPGPFPPRPPGPLGPPL 335 >X67336-1|CAA47751.1| 551|Homo sapiens HPBRII-7 protein. Length = 551 Score = 37.9 bits (84), Expect = 0.055 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXPL 494 PP PPPP PPP P + PG G PL Sbjct: 306 PPGPPPPQQGPPPPPGPFPPRPPGPLGPPL 335 >BC005000-1|AAH05000.1| 478|Homo sapiens CPSF6 protein protein. Length = 478 Score = 37.9 bits (84), Expect = 0.055 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXPL 494 PP PPPP PPP P + PG G PL Sbjct: 233 PPGPPPPQQGPPPPPGPFPPRPPGPLGPPL 262 >BC000714-1|AAH00714.1| 588|Homo sapiens CPSF6 protein protein. Length = 588 Score = 37.9 bits (84), Expect = 0.055 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXPL 494 PP PPPP PPP P + PG G PL Sbjct: 343 PPGPPPPQQGPPPPPGPFPPRPPGPLGPPL 372 >AK223568-1|BAD97288.1| 551|Homo sapiens cleavage and polyadenylation specific factor 6, 68 kD subunit variant protein. Length = 551 Score = 37.9 bits (84), Expect = 0.055 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXPL 494 PP PPPP PPP P + PG G PL Sbjct: 306 PPGPPPPQQGPPPPPGPFPPRPPGPLGPPL 335 >BC146811-1|AAI46812.1| 854|Homo sapiens ZNF341 protein protein. Length = 854 Score = 36.7 bits (81), Expect = 0.13 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +3 Query: 384 SILTKXXPPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 S LT+ PP PPPP PPP PP P G P Sbjct: 173 SYLTQPPPP-PPPPPPLPPPPPPQPPPPPPQSLGPP 207 Score = 33.9 bits (74), Expect = 0.90 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PPP PPP PP Q G G P Sbjct: 182 PPPPPPLPPPPPPQPPPPPPQSLGPPGRP 210 >BC132873-1|AAI32874.1| 854|Homo sapiens ZNF341 protein protein. Length = 854 Score = 36.7 bits (81), Expect = 0.13 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +3 Query: 384 SILTKXXPPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 S LT+ PP PPPP PPP PP P G P Sbjct: 173 SYLTQPPPP-PPPPPPLPPPPPPQPPPPPPQSLGPP 207 Score = 33.9 bits (74), Expect = 0.90 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PPP PPP PP Q G G P Sbjct: 182 PPPPPPLPPPPPPQPPPPPPQSLGPPGRP 210 >BC094738-1|AAH94738.1| 795|Homo sapiens ZNF341 protein protein. Length = 795 Score = 36.7 bits (81), Expect = 0.13 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +3 Query: 384 SILTKXXPPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 S LT+ PP PPPP PPP PP P G P Sbjct: 114 SYLTQPPPP-PPPPPPLPPPPPPQPPPPPPQSLGPP 148 Score = 33.9 bits (74), Expect = 0.90 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PPP PPP PP Q G G P Sbjct: 123 PPPPPPLPPPPPPQPPPPPPQSLGPPGRP 151 >AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. Length = 1250 Score = 36.7 bits (81), Expect = 0.13 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PP P PPP PP T P G P Sbjct: 928 PPPPPSPVPAPPPPPPPTASPTPDKSGSP 956 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP P Sbjct: 633 PPPPPPPPPPPPPPPPLPSQSAP 655 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQ 467 PP PPPP PPP PP Q Sbjct: 632 PPPPPPPPPPPPPPPPPLPSQ 652 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 626 PPLPPPPPPPPPPPPP 641 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 629 PPPPPPPPPPPPPPPP 644 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 630 PPPPPPPPPPPPPPPP 645 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 631 PPPPPPPPPPPPPPPP 646 Score = 32.3 bits (70), Expect = 2.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 390 LTKXXPPXPPPPXXXPPPXPP 452 +T+ PP PPPP P P PP Sbjct: 755 ITQVAPPTPPPPPPIPAPLPP 775 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP PP +P Sbjct: 629 PPPPPPPPPPPPPPPPPPPPLP 650 >AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein protein. Length = 1009 Score = 36.7 bits (81), Expect = 0.13 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPG 476 PP PPPP PPP PP +PG Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPLPG 493 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +3 Query: 390 LTKXXPPXPPPPXXXPPPXPP 452 +T PP PPPP PPP PP Sbjct: 464 VTPPMPPPPPPPPPPPPPPPP 484 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PPPP PPP PP P P Sbjct: 472 PPPPPPPPPPPPPPPPPPPLPGPAAETVP 500 >AL050349-3|CAI21796.2| 847|Homo sapiens zinc finger protein 341 protein. Length = 847 Score = 36.7 bits (81), Expect = 0.13 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +3 Query: 384 SILTKXXPPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 S LT+ PP PPPP PPP PP P G P Sbjct: 173 SYLTQPPPP-PPPPPPLPPPPPPQPPPPPPQSLGPP 207 Score = 33.9 bits (74), Expect = 0.90 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PPP PPP PP Q G G P Sbjct: 182 PPPPPPLPPPPPPQPPPPPPQSLGPPGRP 210 >AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. Length = 1250 Score = 36.7 bits (81), Expect = 0.13 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PP P PPP PP T P G P Sbjct: 928 PPPPPSPVPAPPPPPPPTASPTPDKSGSP 956 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP P Sbjct: 633 PPPPPPPPPPPPPPPPLPSQSAP 655 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQ 467 PP PPPP PPP PP Q Sbjct: 632 PPPPPPPPPPPPPPPPPLPSQ 652 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 626 PPLPPPPPPPPPPPPP 641 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 629 PPPPPPPPPPPPPPPP 644 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 630 PPPPPPPPPPPPPPPP 645 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 631 PPPPPPPPPPPPPPPP 646 Score = 32.3 bits (70), Expect = 2.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 390 LTKXXPPXPPPPXXXPPPXPP 452 +T+ PP PPPP P P PP Sbjct: 755 ITQVAPPTPPPPPPIPAPLPP 775 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP PP +P Sbjct: 629 PPPPPPPPPPPPPPPPPPPPLP 650 >AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein. Length = 1112 Score = 36.7 bits (81), Expect = 0.13 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPG 476 PP PPPP PPP PP +PG Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPLPG 596 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +3 Query: 390 LTKXXPPXPPPPXXXPPPXPP 452 +T PP PPPP PPP PP Sbjct: 567 VTPPMPPPPPPPPPPPPPPPP 587 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PPPP PPP PP P P Sbjct: 575 PPPPPPPPPPPPPPPPPPPLPGPASETVP 603 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXPSTRGXGIXPL 496 P PPP PPP PP P++ PL Sbjct: 578 PPPPPPPPPPPPPPPPLPGPASETVPAPPL 607 >AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. Length = 1236 Score = 36.7 bits (81), Expect = 0.13 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PP P PPP PP T P G P Sbjct: 914 PPPPPSPVPAPPPPPPPTASPTPDKSGSP 942 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP P Sbjct: 619 PPPPPPPPPPPPPPPPLPSQSAP 641 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQ 467 PP PPPP PPP PP Q Sbjct: 618 PPPPPPPPPPPPPPPPPLPSQ 638 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 612 PPLPPPPPPPPPPPPP 627 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 615 PPPPPPPPPPPPPPPP 630 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 616 PPPPPPPPPPPPPPPP 631 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 617 PPPPPPPPPPPPPPPP 632 Score = 32.3 bits (70), Expect = 2.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 390 LTKXXPPXPPPPXXXPPPXPP 452 +T+ PP PPPP P P PP Sbjct: 741 ITQVAPPTPPPPPPIPAPLPP 761 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP PP +P Sbjct: 615 PPPPPPPPPPPPPPPPPPPPLP 636 >AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain 4 protein protein. Length = 3567 Score = 35.5 bits (78), Expect = 0.30 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQV 470 PP PPPP PPP PP QV Sbjct: 2001 PPPPPPPPPPPPPPPPSAPPQV 2022 Score = 34.7 bits (76), Expect = 0.52 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXPSTRG 478 P T PPP PPP PP PS+ G Sbjct: 1955 PETPPPPPPPPPLPPAPPQPSSMG 1978 Score = 34.7 bits (76), Expect = 0.52 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXPL 494 PP PPPP PPP PP P P+ Sbjct: 1997 PPPPPPPPPPPPPPPPPPPPSAPPQVQLPV 2026 Score = 33.9 bits (74), Expect = 0.90 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 393 TKXXPPXPPPPXXXPPPXPP 452 T PP PPPP PPP PP Sbjct: 1996 TPPPPPPPPPPPPPPPPPPP 2015 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 1994 PPTPPPPPPPPPPPPP 2009 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXPL 494 PP PPPP PPP Q+P PL Sbjct: 2003 PPPPPPPPPPPPPPSAPPQVQLPVSLDLPL 2032 Score = 30.7 bits (66), Expect = 8.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXP 466 P T PPP PPP PP P Sbjct: 1994 PPTPPPPPPPPPPPPPPPPP 2013 >AK027872-1|BAB55422.1| 509|Homo sapiens protein ( Homo sapiens cDNA FLJ14966 fis, clone THYRO1000034, weakly similar to TRICHOHYALIN. ). Length = 509 Score = 35.5 bits (78), Expect = 0.30 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +3 Query: 390 LTKXXPPXPPPPXXXPPPXPPXT 458 L + PP PPPP PPP PP T Sbjct: 263 LRQAAPPPPPPPPPPPPPPPPPT 285 Score = 35.1 bits (77), Expect = 0.39 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 381 TSILTKXXPPXPPPPXXXPPPXPP 452 TS+ PP PPPP PPP PP Sbjct: 261 TSLRQAAPPPPPPPPPPPPPPPPP 284 Score = 30.7 bits (66), Expect = 8.4 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 416 SPPPXXPPPXPPXXXXPSTRG 478 +PPP PPP PP P T G Sbjct: 267 APPPPPPPPPPPPPPPPPTAG 287 >AB037732-1|BAA92549.1| 889|Homo sapiens KIAA1311 protein protein. Length = 889 Score = 35.5 bits (78), Expect = 0.30 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +2 Query: 374 VINEHSYQTXXPXTSPPPXXPPPXPPXXXXPSTRGXGIXP 493 V++E + + P PPP PPP PP P G G P Sbjct: 133 VVDEVALPSMIPFPPPPPGLPPPPPPGMLMPPMPGPGPGP 172 >BC067364-1|AAH67364.1| 871|Homo sapiens PRP40 pre-mRNA processing factor 40 homolog B (S. cerevisiae) protein. Length = 871 Score = 34.7 bits (76), Expect = 0.52 Identities = 21/56 (37%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXP-STRGXGIXPLXXGXLGXXT*YXPFVGXWGXPPQXT 571 P PPP PPP PP P S R I P+ G L P + G PP T Sbjct: 4 PPFMPPPGIPPPFPPMGLPPMSQRPPAIPPMPPGIL------PPMLPPMGAPPPLT 53 >BC050398-1|AAH50398.1| 788|Homo sapiens PRPF40B protein protein. Length = 788 Score = 34.7 bits (76), Expect = 0.52 Identities = 21/56 (37%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXP-STRGXGIXPLXXGXLGXXT*YXPFVGXWGXPPQXT 571 P PPP PPP PP P S R I P+ G L P + G PP T Sbjct: 4 PPFMPPPGIPPPFPPMGLPPMSQRPPAIPPMPPGIL------PPMLPPMGAPPPLT 53 >AB083343-1|BAE96598.1| 3599|Homo sapiens zinc-finger homeodomain protein 4 protein. Length = 3599 Score = 34.7 bits (76), Expect = 0.52 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXPSTRG 478 P T PPP PPP PP PS+ G Sbjct: 2000 PETPPPPPPPPPLPPAPPQPSSMG 2023 >Z96050-3|CAB09424.1| 281|Homo sapiens Fas ligand (TNF superfamily, member 6) protein. Length = 281 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP +P Sbjct: 45 PPPPPPPPPLPPPPPPPPLPPLP 67 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP +P Sbjct: 47 PPPPPPPLPPPPPPPPLPPLPLP 69 >X89102-1|CAA61474.1| 281|Homo sapiens Fasligand protein. Length = 281 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP +P Sbjct: 45 PPPPPPPPPLPPPPPPPPLPPLP 67 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP +P Sbjct: 47 PPPPPPPLPPPPPPPPLPPLPLP 69 >U11821-1|AAC50124.1| 281|Homo sapiens Fas ligand protein. Length = 281 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP +P Sbjct: 45 PPPPPPPPPLPPPPPPPPLPPLP 67 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP +P Sbjct: 47 PPPPPPPLPPPPPPPPLPPLPLP 69 >U08137-1|AAC50071.1| 281|Homo sapiens Fas ligand protein. Length = 281 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP +P Sbjct: 45 PPPPPPPPPLPPPPPPPPLPPLP 67 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP +P Sbjct: 47 PPPPPPPLPPPPPPPPLPPLPLP 69 >EF064739-1|ABK41922.1| 281|Homo sapiens Fas ligand (TNF superfamily, member 6) protein. Length = 281 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP +P Sbjct: 45 PPPPPPPPPLPPPPPPPPLPPLP 67 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP +P Sbjct: 47 PPPPPPPLPPPPPPPPLPPLPLP 69 >D38122-1|BAA07320.1| 281|Homo sapiens Fas ligand protein. Length = 281 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP +P Sbjct: 45 PPPPPPPPPLPPPPPPPPLPPLP 67 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP +P Sbjct: 47 PPPPPPPLPPPPPPPPLPPLPLP 69 >BC017502-1|AAH17502.1| 281|Homo sapiens Fas ligand (TNF superfamily, member 6) protein. Length = 281 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP +P Sbjct: 45 PPPPPPPPPLPPPPPPPPLPPLP 67 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP +P Sbjct: 47 PPPPPPPLPPPPPPPPLPPLPLP 69 >AY858799-1|AAX49569.1| 281|Homo sapiens CD95 ligand protein. Length = 281 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP +P Sbjct: 45 PPPPPPPPPLPPPPPPPPLPPLP 67 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP +P Sbjct: 47 PPPPPPPLPPPPPPPPLPPLPLP 69 >AY225406-1|AAO43991.1| 281|Homo sapiens FAS ligand protein. Length = 281 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP +P Sbjct: 45 PPPPPPPPPLPPPPPPPPLPPLP 67 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP +P Sbjct: 47 PPPPPPPLPPPPPPPPLPPLPLP 69 >AF288573-1|AAG60017.1| 127|Homo sapiens FasL isoform protein. Length = 127 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP +P Sbjct: 45 PPPPPPPPPLPPPPPPPPLPPLP 67 Score = 34.3 bits (75), Expect = 0.68 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP +P Sbjct: 47 PPPPPPPLPPPPPPPPLPPLPLP 69 >AK123353-1|BAC85591.1| 195|Homo sapiens DC3) mRNA. protein. Length = 195 Score = 33.5 bits (73), Expect = 1.2 Identities = 20/52 (38%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Frame = +2 Query: 419 PPPXXPPPXPPXXXXP-STRGXGIXPLXXGXLGXXT*YXPFVGXWGXPPQXT 571 PPP PPP PP P S R I P+ G L P + G PP T Sbjct: 3 PPPGIPPPFPPMGLPPMSQRPPAIPPMPPGIL------PPMLPPMGAPPPLT 48 >AK097947-1|BAC05201.1| 209|Homo sapiens protein ( Homo sapiens cDNA FLJ40628 fis, clone THYMU2014204, weakly similar to WISKOTT-ALDRICH SYNDROME PROTEIN. ). Length = 209 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +3 Query: 390 LTKXXPPXPPPPXXXPPPXPP 452 L+ PP PPPP PPP PP Sbjct: 62 LSLPPPPPPPPPPPPPPPPPP 82 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 68 PPPPPPPPPPPPPPPP 83 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 69 PPPPPPPPPPPPPPPP 84 >AK095189-1|BAC04495.1| 634|Homo sapiens protein ( Homo sapiens cDNA FLJ37870 fis, clone BRSSN2017682, highly similar to Mus musculus p300 transcriptional cofactor JMY mRNA. ). Length = 634 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 390 LTKXXPPXPPPPXXXPPPXPP 452 L PP PPPP PPP PP Sbjct: 449 LPSPLPPTPPPPPPPPPPPPP 469 Score = 32.3 bits (70), Expect = 2.7 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXPSTRGXG 484 P T PPP PPP PP P + G Sbjct: 454 PPTPPPPPPPPPPPPPPPLPVAKDSG 479 >AB075851-1|BAB85557.1| 830|Homo sapiens KIAA1971 protein protein. Length = 830 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +3 Query: 390 LTKXXPPXPPPPXXXPPPXPP 452 L+ PP PPPP PPP PP Sbjct: 657 LSLPPPPPPPPPPPPPPPPPP 677 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 663 PPPPPPPPPPPPPPPP 678 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 664 PPPPPPPPPPPPPPPP 679 >BX537864-1|CAD97867.1| 270|Homo sapiens hypothetical protein protein. Length = 270 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 49 PPPPPPPPESPPPPPP 64 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 50 PPPPPPPESPPPPPPP 65 >BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. Length = 673 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 73 PPPPPPPPQQPPPPPP 88 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 74 PPPPPPPQQPPPPPPP 89 Score = 32.7 bits (71), Expect = 2.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 P PPPP PPP P PG G P Sbjct: 542 PNGPPPPWMQPPPPPMNQGPHPPGHHGPP 570 Score = 30.7 bits (66), Expect = 8.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPP PPP PP P Sbjct: 75 PPPPPPQQPPPPPPPPSPGASYP 97 >BC037404-1|AAH37404.1| 1015|Homo sapiens formin binding protein 4 protein. Length = 1015 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 710 PPPPPPPPESPPPPPP 725 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 711 PPPPPPPESPPPPPPP 726 >AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 919 PPPPPPPPPPPPPPPP 934 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 920 PPPPPPPPPPPPPPPP 935 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 921 PPPPPPPPPPPPPPPP 936 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 922 PPPPPPPPPPPPPPPP 937 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 923 PPPPPPPPPPPPPPPP 938 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 924 PPPPPPPPPPPPPPPP 939 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 925 PPPPPPPPPPPPPPPP 940 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 926 PPPPPPPPPPPPPPPP 941 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 927 PPPPPPPPPPPPPPPP 942 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 928 PPPPPPPPPPPPPPPP 943 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 929 PPPPPPPPPPPPPPPP 944 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 930 PPPPPPPPPPPPPPPP 945 >AL078621-10|CAB81647.1| 232|Homo sapiens protein ( G islands. ).). Length = 232 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 163 PPPPPPPSPLPPPPPP 178 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXT 458 PP PP P PPP PP T Sbjct: 165 PPPPPSPLPPPPPPPPPT 182 >AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 919 PPPPPPPPPPPPPPPP 934 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 920 PPPPPPPPPPPPPPPP 935 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 921 PPPPPPPPPPPPPPPP 936 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 922 PPPPPPPPPPPPPPPP 937 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 923 PPPPPPPPPPPPPPPP 938 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 924 PPPPPPPPPPPPPPPP 939 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 925 PPPPPPPPPPPPPPPP 940 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 926 PPPPPPPPPPPPPPPP 941 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 927 PPPPPPPPPPPPPPPP 942 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 928 PPPPPPPPPPPPPPPP 943 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 929 PPPPPPPPPPPPPPPP 944 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 930 PPPPPPPPPPPPPPPP 945 >AK091683-1|BAC03720.1| 749|Homo sapiens protein ( Homo sapiens cDNA FLJ34364 fis, clone FEBRA2015175, weakly similar to Mus musculus (clone E5.53) Huntington disease (hdh) gene. ). Length = 749 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 660 PPPPPPPLALPPPPPP 675 >AK056450-1|BAB71186.1| 568|Homo sapiens protein ( Homo sapiens cDNA FLJ31888 fis, clone NT2RP7003055. ). Length = 568 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 342 PPPPPPPLALPPPPPP 357 >AK022987-1|BAB14348.1| 560|Homo sapiens protein ( Homo sapiens cDNA FLJ12925 fis, clone NT2RP2004710, highly similar to Mus musculus formin binding protein 30 mRNA. ). Length = 560 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 255 PPPPPPPPESPPPPPP 270 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 256 PPPPPPPESPPPPPPP 271 >AB051514-1|BAB21818.1| 1130|Homo sapiens KIAA1727 protein protein. Length = 1130 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 18 PPAPPPPPPPPPPSPP 33 >AB051500-1|BAB21804.2| 1652|Homo sapiens KIAA1713 protein protein. Length = 1652 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 1426 PPPPPPPLALPPPPPP 1441 >AB023231-1|BAA76858.2| 1050|Homo sapiens KIAA1014 protein protein. Length = 1050 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 745 PPPPPPPPESPPPPPP 760 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPP 452 PP PPPP PPP PP Sbjct: 746 PPPPPPPESPPPPPPP 761 >Z46389-1|CAA86523.1| 380|Homo sapiens vasodilator-stimulated phosphoprotein (VASP) protein. Length = 380 Score = 27.9 bits (59), Expect(2) = 1.7 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 414 PPPPXXXPPPXPP 452 PPPP PPP PP Sbjct: 171 PPPPGPPPPPGPP 183 Score = 23.8 bits (49), Expect(2) = 1.7 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +3 Query: 435 PPPXPPXTXXQVPGXXG 485 PPP PP Q PG G Sbjct: 204 PPPAPPLPAAQGPGGGG 220 >X98534-1|CAA67147.2| 378|Homo sapiens vasodilator-stimulated phosphoprotein protein. Length = 378 Score = 27.9 bits (59), Expect(2) = 1.7 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 414 PPPPXXXPPPXPP 452 PPPP PPP PP Sbjct: 169 PPPPGPPPPPGPP 181 Score = 23.8 bits (49), Expect(2) = 1.7 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +3 Query: 435 PPPXPPXTXXQVPGXXG 485 PPP PP Q PG G Sbjct: 202 PPPAPPLPAAQGPGGGG 218 >BC038224-1|AAH38224.1| 380|Homo sapiens vasodilator-stimulated phosphoprotein protein. Length = 380 Score = 27.9 bits (59), Expect(2) = 1.7 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 414 PPPPXXXPPPXPP 452 PPPP PPP PP Sbjct: 171 PPPPGPPPPPGPP 183 Score = 23.8 bits (49), Expect(2) = 1.7 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +3 Query: 435 PPPXPPXTXXQVPGXXG 485 PPP PP Q PG G Sbjct: 204 PPPAPPLPAAQGPGGGG 220 >BC026019-1|AAH26019.1| 380|Homo sapiens vasodilator-stimulated phosphoprotein protein. Length = 380 Score = 27.9 bits (59), Expect(2) = 1.7 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 414 PPPPXXXPPPXPP 452 PPPP PPP PP Sbjct: 172 PPPPGPPPPPGPP 184 Score = 23.8 bits (49), Expect(2) = 1.7 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +3 Query: 435 PPPXPPXTXXQVPGXXG 485 PPP PP Q PG G Sbjct: 205 PPPAPPLPAAQGPGGGG 221 >Y08766-1|CAA70019.1| 638|Homo sapiens SF1-Bo isoform protein. Length = 638 Score = 32.7 bits (71), Expect = 2.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 P PPPP PPP P PG G P Sbjct: 417 PNGPPPPWMQPPPPPMNQGPHPPGHHGPP 445 >Y08765-1|CAA70018.1| 639|Homo sapiens SF1-Hl1 isoform protein. Length = 639 Score = 32.7 bits (71), Expect = 2.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 P PPPP PPP P PG G P Sbjct: 417 PNGPPPPWMQPPPPPMNQGPHPPGHHGPP 445 >L49380-1|AAB04033.1| 639|Homo sapiens transcription factor ZFM1 protein. Length = 639 Score = 32.7 bits (71), Expect = 2.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 P PPPP PPP P PG G P Sbjct: 417 PNGPPPPWMQPPPPPMNQGPHPPGHHGPP 445 >L49345-1|AAB03514.1| 571|Homo sapiens transcription factor ZFM1 protein. Length = 571 Score = 32.7 bits (71), Expect = 2.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 P PPPP PPP P PG G P Sbjct: 417 PNGPPPPWMQPPPPPMNQGPHPPGHHGPP 445 >D26120-2|BAA05117.1| 623|Homo sapiens ZFM1 protein protein. Length = 623 Score = 32.7 bits (71), Expect = 2.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 P PPPP PPP P PG G P Sbjct: 417 PNGPPPPWMQPPPPPMNQGPHPPGHHGPP 445 >D26120-1|BAA05116.1| 548|Homo sapiens ZFM1 protein alternatively spliced product protein. Length = 548 Score = 32.7 bits (71), Expect = 2.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 P PPPP PPP P PG G P Sbjct: 417 PNGPPPPWMQPPPPPMNQGPHPPGHHGPP 445 >BC028050-1|AAH28050.1| 634|Homo sapiens CREB regulated transcription coactivator 1 protein. Length = 634 Score = 32.7 bits (71), Expect = 2.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXPL 494 PP PPPP PP PP V G PL Sbjct: 369 PPPPPPPASQQPPPPPPPQAPVRLPPGGPL 398 >BC023614-1|AAH23614.2| 604|Homo sapiens CRTC1 protein protein. Length = 604 Score = 32.7 bits (71), Expect = 2.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXPL 494 PP PPPP PP PP V G PL Sbjct: 339 PPPPPPPASQQPPPPPPPQAPVRLPPGGPL 368 >BC020217-1|AAH20217.1| 548|Homo sapiens splicing factor 1 protein. Length = 548 Score = 32.7 bits (71), Expect = 2.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 P PPPP PPP P PG G P Sbjct: 417 PNGPPPPWMQPPPPPMNQGPHPPGHHGPP 445 >BC017075-1|AAH17075.2| 475|Homo sapiens CRTC1 protein protein. Length = 475 Score = 32.7 bits (71), Expect = 2.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXPL 494 PP PPPP PP PP V G PL Sbjct: 210 PPPPPPPASQQPPPPPPPQAPVRLPPGGPL 239 >BC008724-1|AAH08724.1| 548|Homo sapiens splicing factor 1 protein. Length = 548 Score = 32.7 bits (71), Expect = 2.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 P PPPP PPP P PG G P Sbjct: 417 PNGPPPPWMQPPPPPMNQGPHPPGHHGPP 445 >BC008080-1|AAH08080.1| 548|Homo sapiens splicing factor 1 protein. Length = 548 Score = 32.7 bits (71), Expect = 2.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 P PPPP PPP P PG G P Sbjct: 417 PNGPPPPWMQPPPPPMNQGPHPPGHHGPP 445 >BC000773-1|AAH00773.1| 265|Homo sapiens Similar to zinc finger protein 162 protein. Length = 265 Score = 32.7 bits (71), Expect = 2.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 P PPPP PPP P PG G P Sbjct: 43 PNGPPPPWMQPPPPPMNQGPHPPGHHGPP 71 >AY360171-1|AAQ98856.1| 650|Homo sapiens transducer of regulated CREB protein 1 protein. Length = 650 Score = 32.7 bits (71), Expect = 2.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXPL 494 PP PPPP PP PP V G PL Sbjct: 385 PPPPPPPASQQPPPPPPPQAPVRLPPGGPL 414 >AY040323-1|AAK93832.1| 593|Homo sapiens mucoepidermoid susceptibility protein protein. Length = 593 Score = 32.7 bits (71), Expect = 2.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXPL 494 PP PPPP PP PP V G PL Sbjct: 369 PPPPPPPASQQPPPPPPPQAPVRLPPGGPL 398 >AL158217-11|CAI22163.1| 854|Homo sapiens espin protein. Length = 854 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP PP T P Sbjct: 430 PPPPPPSFPPPPPPPGTQLPPP 451 Score = 32.3 bits (70), Expect = 2.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 P PPPP PPP PP P G P Sbjct: 428 PTPPPPPPSFPPPPPPPGTQLPPPPPGYP 456 >AL035288-1|CAA22892.1| 671|Homo sapiens hypothetical protein protein. Length = 671 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP PP T P Sbjct: 332 PPPPPPSFPPPPPPPGTQLPPP 353 >AL031848-3|CAI19773.1| 854|Homo sapiens espin protein. Length = 854 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP PP T P Sbjct: 430 PPPPPPSFPPPPPPPGTQLPPP 451 Score = 32.3 bits (70), Expect = 2.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 P PPPP PPP PP P G P Sbjct: 428 PTPPPPPPSFPPPPPPPGTQLPPPPPGYP 456 >AL021920-3|CAI19632.1| 671|Homo sapiens espin pseudogene protein. Length = 671 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP PP T P Sbjct: 332 PPPPPPSFPPPPPPPGTQLPPP 353 >AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrome protein family member 4 protein. Length = 625 Score = 32.7 bits (71), Expect = 2.1 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 Query: 393 TKXXPPXPPPPXXXPPPXPPXT 458 T+ PP PPPP PPP PP T Sbjct: 515 TRGAPPPPPPPPPGPPP-PPFT 535 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PPPP PP PP PG P Sbjct: 450 PPPPPPPMIGIPPPPPPIGFGSPGTPPPP 478 >AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. Length = 496 Score = 32.7 bits (71), Expect = 2.1 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 Query: 393 TKXXPPXPPPPXXXPPPXPPXT 458 T+ PP PPPP PPP PP T Sbjct: 386 TRGAPPPPPPPPPGPPP-PPFT 406 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PPPP PP PP PG P Sbjct: 321 PPPPPPPMIGIPPPPPPIGFGSPGTPPPP 349 >AC006123-1|AAC97072.1| 414|Homo sapiens KIAA0616 protein protein. Length = 414 Score = 32.7 bits (71), Expect = 2.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXPL 494 PP PPPP PP PP V G PL Sbjct: 343 PPPPPPPASQQPPPPPPPQAPVRLPPGGPL 372 >AB014516-1|BAA31591.1| 634|Homo sapiens KIAA0616 protein protein. Length = 634 Score = 32.7 bits (71), Expect = 2.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXPL 494 PP PPPP PP PP V G PL Sbjct: 369 PPPPPPPASQQPPPPPPPQAPVRLPPGGPL 398 >U26712-1|AAB09293.1| 770|Homo sapiens cbl-b truncated form 2 protein. Length = 770 Score = 32.3 bits (70), Expect = 2.7 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP PP +P Sbjct: 545 PAPPPPLRDPPPPPPERPPPIP 566 >U26711-1|AAB09292.1| 810|Homo sapiens cbl-b truncated form 1 protein. Length = 810 Score = 32.3 bits (70), Expect = 2.7 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP PP +P Sbjct: 545 PAPPPPLRDPPPPPPERPPPIP 566 >U26710-1|AAB09291.1| 982|Homo sapiens cbl-b protein. Length = 982 Score = 32.3 bits (70), Expect = 2.7 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP PP +P Sbjct: 545 PAPPPPLRDPPPPPPERPPPIP 566 >DQ854815-1|ABI75145.1| 112|Homo sapiens hyperpolarization-activated cyclic nucleotide-gated potassium channel 2 protein. Length = 112 Score = 32.3 bits (70), Expect = 2.7 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPG 476 PP P PP PPP PP PG Sbjct: 25 PPPPAPPQQQPPPPPPPAPPPGPG 48 >BC050072-1|AAH50072.1| 489|Homo sapiens forkhead box G1 protein. Length = 489 Score = 32.3 bits (70), Expect = 2.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 P PPPP PP PP Q P G P Sbjct: 63 PQPPPPPQQQQPPPPPPPAPQPPQTRGAP 91 >BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 32.3 bits (70), Expect = 2.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PPPP PP PP PG P Sbjct: 322 PPPPPPPMIGIPPPPPPVGFGSPGTPPPP 350 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 393 TKXXPPXPPPPXXXPPPXPPXT 458 T PP PPPP PP PP T Sbjct: 387 TGGAPPPPPPPPPPGPPPPPFT 408 >BC032851-1|AAH32851.1| 982|Homo sapiens Cas-Br-M (murine) ecotropic retroviral transforming sequence b protein. Length = 982 Score = 32.3 bits (70), Expect = 2.7 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP PP +P Sbjct: 545 PAPPPPLRDPPPPPPERPPPIP 566 >AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 32.3 bits (70), Expect = 2.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PPPP PP PP PG P Sbjct: 322 PPPPPPPMIGIPPPPPPVGFGSPGTPPPP 350 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 393 TKXXPPXPPPPXXXPPPXPPXT 458 T PP PPPP PP PP T Sbjct: 387 TGGAPPPPPPPPPPGPPPPPFT 408 >AK128867-1|BAC87651.1| 121|Homo sapiens protein ( Homo sapiens cDNA FLJ46838 fis, clone UTERU2035926. ). Length = 121 Score = 32.3 bits (70), Expect = 2.7 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 407 PXTSPPPXXPPPXPPXXXXPSTRGXG 484 P PPP PPP PP P G G Sbjct: 85 PGLPPPPPPPPPPPPLPPPPGVAGCG 110 >AJ133727-1|CAB42630.1| 889|Homo sapiens hyperpolarization-activated cyclic nucleotide-gated channel hHCN2 protein. Length = 889 Score = 32.3 bits (70), Expect = 2.7 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPG 476 PP P PP PPP PP PG Sbjct: 25 PPPPAPPQQQPPPPPPPAPPPGPG 48 >AJ012582-1|CAB42602.1| 889|Homo sapiens hyperpolarization-activated cation channel HCN2 protein. Length = 889 Score = 32.3 bits (70), Expect = 2.7 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPG 476 PP P PP PPP PP PG Sbjct: 25 PPPPAPPQQQPPPPPPPAPPPGPG 48 >AF386649-1|AAL26987.1| 1362|Homo sapiens bromodomain-containing 4 protein. Length = 1362 Score = 32.3 bits (70), Expect = 2.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP PP Q P Sbjct: 754 PQQPPPPPQQPPPPPPPQQQQQP 776 >AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. Length = 1248 Score = 32.3 bits (70), Expect = 2.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP P T P Sbjct: 599 PPPPPPPPPPPPPLPGGTAISPP 621 >AC005559-2|AAC33280.2| 528|Homo sapiens hyperpolarization activated cyclic nucleotide-gated potassium channel 2 protein. Length = 528 Score = 32.3 bits (70), Expect = 2.7 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPG 476 PP P PP PPP PP PG Sbjct: 25 PPPPAPPQQQPPPPPPPAPPPGPG 48 >AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein protein. Length = 498 Score = 32.3 bits (70), Expect = 2.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 PP PPPP PP PP PG P Sbjct: 322 PPPPPPPMIGIPPPPPPVGFGSPGTPPPP 350 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 393 TKXXPPXPPPPXXXPPPXPPXT 458 T PP PPPP PP PP T Sbjct: 387 TGGAPPPPPPPPPPGPPPPPFT 408 >X04106-1|CAA27726.1| 268|Homo sapiens protein ( Human mRNA for calcium dependent protease (small subunit). ). Length = 268 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRML 383 GG GGG GGGG GG +R+L Sbjct: 40 GGGGGGGGGGGGGGGGGTAMRIL 62 >M31511-1|AAA35646.1| 268|Homo sapiens protein ( Human calcium-activated neutral protease small subunit gene, exon 11. ). Length = 268 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRML 383 GG GGG GGGG GG +R+L Sbjct: 40 GGGGGGGGGGGGGGGGGTAMRIL 62 >D87459-1|BAA13399.2| 567|Homo sapiens KIAA0269 protein. Length = 567 Score = 31.9 bits (69), Expect = 3.6 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 381 TSILTKXXPPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 TS L PPPP PPP PP T Q P P Sbjct: 345 TSSLRASMTSTPPPPVP-PPPPPPATALQAPAVPPPP 380 >BX538087-1|CAD98010.1| 913|Homo sapiens hypothetical protein protein. Length = 913 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 396 KXXPPXPPPPXXXPPPXPPXTXXQVP 473 K P PPPP PPP PP P Sbjct: 230 KPVPARPPPPTNFPPPRPPPPSRPAP 255 >BX537578-1|CAD97788.1| 913|Homo sapiens hypothetical protein protein. Length = 913 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 396 KXXPPXPPPPXXXPPPXPPXTXXQVP 473 K P PPPP PPP PP P Sbjct: 230 KPVPARPPPPTNFPPPRPPPPSRPAP 255 >BT009775-1|AAP88777.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRML 383 GG GGG GGGG GG +R+L Sbjct: 40 GGGGGGGGGGGGGGGGGTAMRIL 62 >BC094799-1|AAH94799.1| 1222|Homo sapiens valosin containing protein (p97)/p47 complex interacting protein 1 protein. Length = 1222 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP Q P Sbjct: 4 PPPPPPP--LPPPPPPPEAPQTP 24 >BC064998-1|AAH64998.1| 268|Homo sapiens CAPNS1 protein protein. Length = 268 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRML 383 GG GGG GGGG GG +R+L Sbjct: 40 GGGGGGGGGGGGGGGGGTAMRIL 62 >BC049204-1|AAH49204.1| 251|Homo sapiens homeobox B4 protein. Length = 251 Score = 31.9 bits (69), Expect = 3.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP PP + P Sbjct: 73 PPPPPPPPPPPPPPPGLSPRAP 94 >BC044591-1|AAH44591.1| 559|Homo sapiens WAS protein family, member 1 protein. Length = 559 Score = 31.9 bits (69), Expect = 3.6 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 381 TSILTKXXPPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 TS L PPPP PPP PP T Q P P Sbjct: 337 TSSLRASMTSTPPPPVP-PPPPPPATALQAPAVPPPP 372 >BC028697-1|AAH28697.3| 913|Homo sapiens WD repeat domain 44 protein. Length = 913 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 396 KXXPPXPPPPXXXPPPXPPXTXXQVP 473 K P PPPP PPP PP P Sbjct: 230 KPVPARPPPPTNFPPPRPPPPSRPAP 255 >BC023643-1|AAH23643.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRML 383 GG GGG GGGG GG +R+L Sbjct: 40 GGGGGGGGGGGGGGGGGTAMRIL 62 >BC021933-1|AAH21933.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRML 383 GG GGG GGGG GG +R+L Sbjct: 40 GGGGGGGGGGGGGGGGGTAMRIL 62 >BC018931-1|AAH18931.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRML 383 GG GGG GGGG GG +R+L Sbjct: 40 GGGGGGGGGGGGGGGGGTAMRIL 62 >BC017308-1|AAH17308.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRML 383 GG GGG GGGG GG +R+L Sbjct: 40 GGGGGGGGGGGGGGGGGTAMRIL 62 >BC011903-1|AAH11903.1| 322|Homo sapiens CAPNS1 protein protein. Length = 322 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRML 383 GG GGG GGGG GG +R+L Sbjct: 40 GGGGGGGGGGGGGGGGGTAMRIL 62 >BC007779-1|AAH07779.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRML 383 GG GGG GGGG GG +R+L Sbjct: 40 GGGGGGGGGGGGGGGGGTAMRIL 62 >BC000592-1|AAH00592.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRML 383 GG GGG GGGG GG +R+L Sbjct: 40 GGGGGGGGGGGGGGGGGTAMRIL 62 >AY789642-1|AAV40829.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRML 383 GG GGG GGGG GG +R+L Sbjct: 40 GGGGGGGGGGGGGGGGGTAMRIL 62 >AL834210-1|CAD38894.1| 805|Homo sapiens hypothetical protein protein. Length = 805 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 396 KXXPPXPPPPXXXPPPXPPXTXXQVP 473 K P PPPP PPP PP P Sbjct: 129 KPVPARPPPPTNFPPPRPPPPSRPAP 154 >AL590009-1|CAI12485.1| 559|Homo sapiens WAS protein family, member 1 protein. Length = 559 Score = 31.9 bits (69), Expect = 3.6 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 381 TSILTKXXPPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 TS L PPPP PPP PP T Q P P Sbjct: 337 TSSLRASMTSTPPPPVP-PPPPPPATALQAPAVPPPP 372 >AL391830-2|CAI41512.1| 913|Homo sapiens WD repeat domain 44 protein. Length = 913 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 396 KXXPPXPPPPXXXPPPXPPXTXXQVP 473 K P PPPP PPP PP P Sbjct: 230 KPVPARPPPPTNFPPPRPPPPSRPAP 255 >AL391830-1|CAI41513.1| 905|Homo sapiens WD repeat domain 44 protein. Length = 905 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 396 KXXPPXPPPPXXXPPPXPPXTXXQVP 473 K P PPPP PPP PP P Sbjct: 230 KPVPARPPPPTNFPPPRPPPPSRPAP 255 >AL391803-3|CAI41482.1| 913|Homo sapiens WD repeat domain 44 protein. Length = 913 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 396 KXXPPXPPPPXXXPPPXPPXTXXQVP 473 K P PPPP PPP PP P Sbjct: 230 KPVPARPPPPTNFPPPRPPPPSRPAP 255 >AL391803-2|CAI41483.1| 905|Homo sapiens WD repeat domain 44 protein. Length = 905 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 396 KXXPPXPPPPXXXPPPXPPXTXXQVP 473 K P PPPP PPP PP P Sbjct: 230 KPVPARPPPPTNFPPPRPPPPSRPAP 255 >AL391803-1|CAI41481.1| 805|Homo sapiens WD repeat domain 44 protein. Length = 805 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 396 KXXPPXPPPPXXXPPPXPPXTXXQVP 473 K P PPPP PPP PP P Sbjct: 129 KPVPARPPPPTNFPPPRPPPPSRPAP 154 >AL391474-2|CAI41402.1| 913|Homo sapiens WD repeat domain 44 protein. Length = 913 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 396 KXXPPXPPPPXXXPPPXPPXTXXQVP 473 K P PPPP PPP PP P Sbjct: 230 KPVPARPPPPTNFPPPRPPPPSRPAP 255 >AL391474-1|CAI41403.1| 905|Homo sapiens WD repeat domain 44 protein. Length = 905 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 396 KXXPPXPPPPXXXPPPXPPXTXXQVP 473 K P PPPP PPP PP P Sbjct: 230 KPVPARPPPPTNFPPPRPPPPSRPAP 255 >AL137449-1|CAB70742.1| 246|Homo sapiens hypothetical protein protein. Length = 246 Score = 31.9 bits (69), Expect = 3.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP PP + P Sbjct: 68 PPPPPPPPPPPPPPPGLSPRAP 89 >AK123671-1|BAC85674.1| 520|Homo sapiens protein ( Homo sapiens cDNA FLJ41677 fis, clone HCASM2002918. ). Length = 520 Score = 31.9 bits (69), Expect = 3.6 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +3 Query: 381 TSILTKXXPPXPPPPXXXPPPXPPXT 458 TS+ PP PPPP PPP PP T Sbjct: 450 TSLRQAAPPPPPPPP---PPPPPPPT 472 >AK095824-1|BAC04633.1| 231|Homo sapiens protein ( Homo sapiens cDNA FLJ38505 fis, clone HCHON2000226. ). Length = 231 Score = 31.9 bits (69), Expect = 3.6 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -2 Query: 498 LKGXIPXPRVLGXXXXGGXGGGXXGGG 418 L+G P PR G GG GGG GGG Sbjct: 28 LRGEEPVPRERGRDPCGGSGGGGGGGG 54 >AF307160-1|AAG45052.1| 251|Homo sapiens HOXB4 protein. Length = 251 Score = 31.9 bits (69), Expect = 3.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP PP + P Sbjct: 73 PPPPPPPPPPPPPPPGLSPRAP 94 >AF287967-4|AAG31554.1| 251|Homo sapiens homeobox B4 protein. Length = 251 Score = 31.9 bits (69), Expect = 3.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP PP + P Sbjct: 73 PPPPPPPPPPPPPPPGLSPRAP 94 >AF134303-1|AAD33052.1| 559|Homo sapiens Scar1 protein. Length = 559 Score = 31.9 bits (69), Expect = 3.6 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 381 TSILTKXXPPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 TS L PPPP PPP PP T Q P P Sbjct: 337 TSSLRASMTSTPPPPVP-PPPPPPATALQAPAVPPPP 372 >AF110377-1|AAD04629.1| 3859|Homo sapiens PCAF-associated factor 400 protein. Length = 3859 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP P T VP Sbjct: 504 PAPPPPPPPPPPATPVTPAPVP 525 >AF076974-1|AAD09420.1| 3830|Homo sapiens TRRAP protein protein. Length = 3830 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP P T VP Sbjct: 504 PAPPPPPPPPPPATPVTPAPVP 525 >AF065164-1|AAC28444.2| 889|Homo sapiens hyperpolarization-activated, cyclic nucleotide-gated channel 2 protein. Length = 889 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPG 476 PP P PP PPP PP PG Sbjct: 25 PPPPRPPKQQPPPPPPPAPPPGPG 48 >AD001527-4|AAB51183.1| 268|Homo sapiens calcium-dependent protease, small (regulatory) subunit (calpain) (calcium-activ protein. Length = 268 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRML 383 GG GGG GGGG GG +R+L Sbjct: 40 GGGGGGGGGGGGGGGGGTAMRIL 62 >AC004991-1|AAC27675.2| 2089|Homo sapiens unknown protein. Length = 2089 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP P T VP Sbjct: 504 PAPPPPPPPPPPATPVTPAPVP 525 >AC002984-1|AAB81546.1| 268|Homo sapiens CANS_Human protein. Length = 268 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRML 383 GG GGG GGGG GG +R+L Sbjct: 40 GGGGGGGGGGGGGGGGGTAMRIL 62 >AB209489-1|BAD92726.1| 3587|Homo sapiens Transformation/transcription domain-associated protein variant protein. Length = 3587 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 408 PXPPPPXXXPPPXPPXTXXQVP 473 P PPPP PPP P T VP Sbjct: 218 PAPPPPPPPPPPATPVTPAPVP 239 >AB058753-1|BAB47479.1| 1236|Homo sapiens KIAA1850 protein protein. Length = 1236 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPPP PPP PP Q P Sbjct: 18 PPPPPPP--LPPPPPPPEAPQTP 38 >AB028974-1|BAA83003.2| 402|Homo sapiens KIAA1051 protein protein. Length = 402 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 380 NEHSYQTXXPXTSPPPXXPPPXPPXXXXPS 469 N H Y+ PPP PPP PP PS Sbjct: 369 NPHWYRQPPVPQYPPPQPPPPPPPPPPPPS 398 >U88666-1|AAC05299.1| 686|Homo sapiens serine kinase SRPK2 protein. Length = 686 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXT 458 PP PPPP PPP P T Sbjct: 24 PPPPPPPPPPPPPLPDPT 41 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPG 476 PP PPPP P P PP ++ G Sbjct: 28 PPPPPPPPPLPDPTPPEPEEEILG 51 >U66615-1|AAC50693.1| 1104|Homo sapiens SWI/SNF complex 155 KDa subunit protein. Length = 1104 Score = 31.5 bits (68), Expect = 4.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 390 LTKXXPPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 LT PPPP PPP PP P G P Sbjct: 1066 LTAPNGMYPPPPQQQPPPPPPADGVPPPPAPGPP 1099 >U23767-1|AAA92290.1| 1178|Homo sapiens calcium-activated potassium channel protein. Length = 1178 Score = 31.5 bits (68), Expect = 4.8 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRM 386 GG GGG GGGG GG +RM Sbjct: 4 GGGGGGGSSGGGGGGGGSSLRM 25 >U13913-1|AAA85104.1| 1178|Homo sapiens large-conductance calcium-activated potassium channel protein. Length = 1178 Score = 31.5 bits (68), Expect = 4.8 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRM 386 GG GGG GGGG GG +RM Sbjct: 4 GGGGGGGSSGGGGGGGGSSLRM 25 >BC117407-1|AAI17408.1| 1081|Homo sapiens LOC152485 protein protein. Length = 1081 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 396 KXXPPXPPPPXXXPPPXP 449 K PP PPPP PPP P Sbjct: 326 KVTPPPPPPPPPPPPPPP 343 >BC117213-1|AAI17214.1| 1105|Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, sub protein. Length = 1105 Score = 31.5 bits (68), Expect = 4.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 390 LTKXXPPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 LT PPPP PPP PP P G P Sbjct: 1067 LTAPNGMYPPPPQQQPPPPPPADGVPPPPAPGPP 1100 >BC113465-1|AAI13466.1| 1105|Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, sub protein. Length = 1105 Score = 31.5 bits (68), Expect = 4.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 390 LTKXXPPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 LT PPPP PPP PP P G P Sbjct: 1067 LTAPNGMYPPPPQQQPPPPPPADGVPPPPAPGPP 1100 >BC068547-1|AAH68547.1| 688|Homo sapiens SRPK2 protein protein. Length = 688 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXT 458 PP PPPP PPP P T Sbjct: 24 PPPPPPPPPPPPPLPDPT 41 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPG 476 PP PPPP P P PP ++ G Sbjct: 28 PPPPPPPPPLPDPTPPEPEEEILG 51 >BC062659-1|AAH62659.1| 168|Homo sapiens KCNMA1 protein protein. Length = 168 Score = 31.5 bits (68), Expect = 4.8 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRM 386 GG GGG GGGG GG +RM Sbjct: 4 GGGGGGGSSGGGGGGGGSSLRM 25 >BC050564-1|AAH50564.1| 1105|Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, sub protein. Length = 1105 Score = 31.5 bits (68), Expect = 4.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 390 LTKXXPPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 LT PPPP PPP PP P G P Sbjct: 1067 LTAPNGMYPPPPQQQPPPPPPADGVPPPPAPGPP 1100 >BC035214-1|AAH35214.1| 688|Homo sapiens SFRS protein kinase 2 protein. Length = 688 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXT 458 PP PPPP PPP P T Sbjct: 24 PPPPPPPPPPPPPLPDPT 41 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPG 476 PP PPPP P P PP ++ G Sbjct: 28 PPPPPPPPPLPDPTPPEPEEEILG 51 >BC023532-1|AAH23532.1| 641|Homo sapiens WW domain binding protein 11 protein. Length = 641 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +3 Query: 405 PPXPPP---PXXXPPPXPPXTXXQVPGXXGXPL 494 PP PPP P PPP PP PG PL Sbjct: 479 PPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPL 511 >BC016441-1|AAH16441.2| 400|Homo sapiens WBP11 protein protein. Length = 400 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +3 Query: 405 PPXPPP---PXXXPPPXPPXTXXQVPGXXGXPL 494 PP PPP P PPP PP PG PL Sbjct: 238 PPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPL 270 >BC001621-1|AAH01621.1| 641|Homo sapiens WW domain binding protein 11 protein. Length = 641 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +3 Query: 405 PPXPPP---PXXXPPPXPPXTXXQVPGXXGXPL 494 PP PPP P PPP PP PG PL Sbjct: 479 PPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPL 511 >AY950679-1|AAY34147.1| 659|Homo sapiens MEX3C protein. Length = 659 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 419 PPPXXPPPXPPXXXXPSTRGXGI 487 PPP PPP PP P G G+ Sbjct: 24 PPPPPPPPLPPPSGGPELEGDGL 46 >AY354201-1|AAQ63886.1| 546|Homo sapiens SFRS protein kinase 2 isoform c protein. Length = 546 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXT 458 PP PPPP PPP P T Sbjct: 24 PPPPPPPPPPPPPLPDPT 41 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPG 476 PP PPPP P P PP ++ G Sbjct: 28 PPPPPPPPPLPDPTPPEPEEEILG 51 >AL731560-10|CAI40877.1| 1178|Homo sapiens potassium large conductance calcium-activated channel, subfamily M, alpha membe protein. Length = 1178 Score = 31.5 bits (68), Expect = 4.8 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRM 386 GG GGG GGGG GG +RM Sbjct: 4 GGGGGGGSSGGGGGGGGSSLRM 25 >AL731560-8|CAI40874.1| 1205|Homo sapiens potassium large conductance calcium-activated channel, subfamily M, alpha membe protein. Length = 1205 Score = 31.5 bits (68), Expect = 4.8 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRM 386 GG GGG GGGG GG +RM Sbjct: 4 GGGGGGGSSGGGGGGGGSSLRM 25 >AL731560-2|CAI40870.1| 1177|Homo sapiens potassium large conductance calcium-activated channel, subfamily M, alpha membe protein. Length = 1177 Score = 31.5 bits (68), Expect = 4.8 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRM 386 GG GGG GGGG GG +RM Sbjct: 4 GGGGGGGSSGGGGGGGGSSLRM 25 >AL731556-10|CAI14082.1| 1178|Homo sapiens potassium large conductance calcium-activated channel, subfamily M, alpha membe protein. Length = 1178 Score = 31.5 bits (68), Expect = 4.8 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRM 386 GG GGG GGGG GG +RM Sbjct: 4 GGGGGGGSSGGGGGGGGSSLRM 25 >AL731556-8|CAI14079.1| 1205|Homo sapiens potassium large conductance calcium-activated channel, subfamily M, alpha membe protein. Length = 1205 Score = 31.5 bits (68), Expect = 4.8 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRM 386 GG GGG GGGG GG +RM Sbjct: 4 GGGGGGGSSGGGGGGGGSSLRM 25 >AL731556-2|CAI14074.1| 1177|Homo sapiens potassium large conductance calcium-activated channel, subfamily M, alpha membe protein. Length = 1177 Score = 31.5 bits (68), Expect = 4.8 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRM 386 GG GGG GGGG GG +RM Sbjct: 4 GGGGGGGSSGGGGGGGGSSLRM 25 >AL627447-10|CAI16171.1| 1178|Homo sapiens potassium large conductance calcium-activated channel, subfamily M, alpha membe protein. Length = 1178 Score = 31.5 bits (68), Expect = 4.8 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRM 386 GG GGG GGGG GG +RM Sbjct: 4 GGGGGGGSSGGGGGGGGSSLRM 25 >AL627447-8|CAI16166.1| 1205|Homo sapiens potassium large conductance calcium-activated channel, subfamily M, alpha membe protein. Length = 1205 Score = 31.5 bits (68), Expect = 4.8 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRM 386 GG GGG GGGG GG +RM Sbjct: 4 GGGGGGGSSGGGGGGGGSSLRM 25 >AL627447-2|CAI16162.1| 1177|Homo sapiens potassium large conductance calcium-activated channel, subfamily M, alpha membe protein. Length = 1177 Score = 31.5 bits (68), Expect = 4.8 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRM 386 GG GGG GGGG GG +RM Sbjct: 4 GGGGGGGSSGGGGGGGGSSLRM 25 >AL157833-10|CAI39736.1| 1178|Homo sapiens potassium large conductance calcium-activated channel, subfamily M, alpha membe protein. Length = 1178 Score = 31.5 bits (68), Expect = 4.8 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRM 386 GG GGG GGGG GG +RM Sbjct: 4 GGGGGGGSSGGGGGGGGSSLRM 25 >AL157833-8|CAI39734.1| 1205|Homo sapiens potassium large conductance calcium-activated channel, subfamily M, alpha membe protein. Length = 1205 Score = 31.5 bits (68), Expect = 4.8 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRM 386 GG GGG GGGG GG +RM Sbjct: 4 GGGGGGGSSGGGGGGGGSSLRM 25 >AL157833-2|CAI39730.1| 1177|Homo sapiens potassium large conductance calcium-activated channel, subfamily M, alpha membe protein. Length = 1177 Score = 31.5 bits (68), Expect = 4.8 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 451 GGXGGGXXXGGGGXGGXXLVRM 386 GG GGG GGGG GG +RM Sbjct: 4 GGGGGGGSSGGGGGGGGSSLRM 25 >AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens cDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV. ). Length = 844 Score = 31.5 bits (68), Expect = 4.8 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXGXPL 494 PP PPPP PP PP + P PL Sbjct: 326 PPLPPPPPPPPPLPPPSSAGPPPPPPPPPL 355 >AK091130-1|BAC03591.1| 1077|Homo sapiens protein ( Homo sapiens cDNA FLJ33811 fis, clone CTONG2002095. ). Length = 1077 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 396 KXXPPXPPPPXXXPPPXP 449 K PP PPPP PPP P Sbjct: 326 KVTPPPPPPPPPPPPPPP 343 >AF499137-1|AAQ07403.1| 903|Homo sapiens synaptopodin protein. Length = 903 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXG 485 PP PPP PPP PP P G Sbjct: 785 PPRAPPPPPPPPPPPPRMRSPQPARPG 811 >AF499136-1|AAQ07402.1| 903|Homo sapiens synaptopodin protein. Length = 903 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXG 485 PP PPP PPP PP P G Sbjct: 785 PPRAPPPPPPPPPPPPRMRSPQPARPG 811 >AF118023-1|AAD30425.1| 641|Homo sapiens SH3 domain-binding protein SNP70 protein. Length = 641 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +3 Query: 405 PPXPPP---PXXXPPPXPPXTXXQVPGXXGXPL 494 PP PPP P PPP PP PG PL Sbjct: 479 PPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPL 511 >AC005070-2|AAC29140.1| 675|Homo sapiens serine kinase SRPK2 protein. Length = 675 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXT 458 PP PPPP PPP P T Sbjct: 11 PPPPPPPPPPPPPLPDPT 28 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPG 476 PP PPPP P P PP ++ G Sbjct: 15 PPPPPPPPPLPDPTPPEPEEEILG 38 >AC005070-1|AAC29141.1| 675|Homo sapiens WUGSC:H_RG152G17.1a protein. Length = 675 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXT 458 PP PPPP PPP P T Sbjct: 11 PPPPPPPPPPPPPLPDPT 28 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPG 476 PP PPPP P P PP ++ G Sbjct: 15 PPPPPPPPPLPDPTPPEPEEEILG 38 >AB058717-1|BAB47443.1| 1285|Homo sapiens KIAA1814 protein protein. Length = 1285 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 384 SILTKXXPPXPPPPXXXPPP 443 S+ T+ PP PPPP PPP Sbjct: 1133 SVETRPPPPPPPPPPPLPPP 1152 >AB029309-1|BAA88410.1| 641|Homo sapiens Npw38-binding protein NpwBP protein. Length = 641 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +3 Query: 405 PPXPPP---PXXXPPPXPPXTXXQVPGXXGXPL 494 PP PPP P PPP PP PG PL Sbjct: 479 PPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPL 511 >AB028952-1|BAA82981.2| 1015|Homo sapiens KIAA1029 protein protein. Length = 1015 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVPGXXG 485 PP PPP PPP PP P G Sbjct: 897 PPRAPPPPPPPPPPPPRMRSPQPARPG 923 >U59832-1|AAC50661.1| 465|Homo sapiens FREAC-4 protein. Length = 465 Score = 31.1 bits (67), Expect = 6.3 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 490 GNPXXPGTWXXVXGGXGGGXXXGGGGXGG 404 G+P PG G GGG GG G GG Sbjct: 85 GSPAPPGPAPAAGAGAGGGGGGGGAGGGG 113 >U59831-1|AAC50660.1| 465|Homo sapiens forkhead related activator 4 protein. Length = 465 Score = 31.1 bits (67), Expect = 6.3 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 490 GNPXXPGTWXXVXGGXGGGXXXGGGGXGG 404 G+P PG G GGG GG G GG Sbjct: 85 GSPAPPGPAPAAGAGAGGGGGGGGAGGGG 113 >D88460-1|BAA20128.1| 505|Homo sapiens N-WASP protein. Length = 505 Score = 31.1 bits (67), Expect = 6.3 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 390 LTKXXPPXPPPPXXXPPPXPP 452 L + PP PPP PPP PP Sbjct: 272 LRRQAPPPPPPSRGGPPPPPP 292 Score = 30.7 bits (66), Expect = 8.4 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 405 PPXPPPPXXXPPP-XPPXTXXQVPGXXG 485 PP PPPP PPP P QVP G Sbjct: 377 PPPPPPPGPPPPPGLPSDGDHQVPTTAG 404 >BC052955-1|AAH52955.1| 505|Homo sapiens Wiskott-Aldrich syndrome-like protein. Length = 505 Score = 31.1 bits (67), Expect = 6.3 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 390 LTKXXPPXPPPPXXXPPPXPP 452 L + PP PPP PPP PP Sbjct: 272 LRRQAPPPPPPSRGGPPPPPP 292 Score = 30.7 bits (66), Expect = 8.4 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 405 PPXPPPPXXXPPP-XPPXTXXQVPGXXG 485 PP PPPP PPP P QVP G Sbjct: 377 PPPPPPPGPPPPPGLPSDGDHQVPTTAG 404 >BC035727-1|AAH35727.1| 337|Homo sapiens Lix1 homolog (mouse)-like protein. Length = 337 Score = 31.1 bits (67), Expect = 6.3 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +2 Query: 398 TXXPXTSPPPXXPPPXPPXXXXPSTRGXGIXPLXXGXLG 514 T P PPP PPP PP + G+ PL G G Sbjct: 35 TATPPAGPPPAPPPPAPPPPPLLLSGAPGL-PLPPGAAG 72 >AM404259-1|CAL49295.1| 1200|Homo sapiens breast cancer anti-estrogen resistance 2 protein. Length = 1200 Score = 31.1 bits (67), Expect = 6.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 396 KXXPPXPPPPXXXPPPXPP 452 K PP P PP PPP PP Sbjct: 550 KVLPPQPQPPLPPPPPPPP 568 >AM404183-1|CAL49297.1| 1200|Homo sapiens breast cancer anti-estrogen resistance 2 protein. Length = 1200 Score = 31.1 bits (67), Expect = 6.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 396 KXXPPXPPPPXXXPPPXPP 452 K PP P PP PPP PP Sbjct: 550 KVLPPQPQPPLPPPPPPPP 568 >AM404182-1|CAL49296.1| 1220|Homo sapiens breast cancer anti-estrogen resistance 2 protein. Length = 1220 Score = 31.1 bits (67), Expect = 6.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 396 KXXPPXPPPPXXXPPPXPP 452 K PP P PP PPP PP Sbjct: 550 KVLPPQPQPPLPPPPPPPP 568 >AM295156-1|CAL26602.1| 505|Homo sapiens WASL protein protein. Length = 505 Score = 31.1 bits (67), Expect = 6.3 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 390 LTKXXPPXPPPPXXXPPPXPP 452 L + PP PPP PPP PP Sbjct: 272 LRRQAPPPPPPSRGGPPPPPP 292 Score = 30.7 bits (66), Expect = 8.4 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 405 PPXPPPPXXXPPP-XPPXTXXQVPGXXG 485 PP PPPP PPP P QVP G Sbjct: 377 PPPPPPPGPPPPPGLPSDGDHQVPTTAG 404 >AL096814-1|CAD92526.1| 1200|Homo sapiens transcriptional regulating factor 1 protein. Length = 1200 Score = 31.1 bits (67), Expect = 6.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 396 KXXPPXPPPPXXXPPPXPP 452 K PP P PP PPP PP Sbjct: 550 KVLPPQPQPPLPPPPPPPP 568 >AK127803-1|BAC87142.1| 1063|Homo sapiens protein ( Homo sapiens cDNA FLJ45904 fis, clone OCBBF3026361. ). Length = 1063 Score = 31.1 bits (67), Expect = 6.3 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 390 LTKXXPPXPPPPXXXPPPXPPXTXXQ 467 L + PP PPPP PPP P Q Sbjct: 537 LQQQQPPQPPPPPPPPPPSQPQPLQQ 562 >AK075231-1|BAC11488.1| 169|Homo sapiens protein ( Homo sapiens cDNA FLJ90750 fis, clone PLACE2000118, weakly similar to WISKOTT-ALDRICH SYNDROME PROTEIN HOMOLOG. ). Length = 169 Score = 31.1 bits (67), Expect = 6.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 393 TKXXPPXPPPPXXXPPPXPPXT 458 T PP PPPP PPP PP T Sbjct: 59 TGGAPPPPPPPPPGPPP-PPFT 79 >AK024089-1|BAB14822.1| 593|Homo sapiens protein ( Homo sapiens cDNA FLJ14027 fis, clone HEMBA1003827. ). Length = 593 Score = 31.1 bits (67), Expect = 6.3 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +3 Query: 405 PPXPPPP--XXXPPPXPPXTXXQVPGXXGXPL 494 PP PPPP PPP PP ++P G PL Sbjct: 369 PPPPPPPASQQPPPPSPPQAPVRLP--PGGPL 398 >AF492646-1|AAO85488.1| 546|Homo sapiens proline rich, vinculin and TIR domain containing protein-B protein. Length = 546 Score = 31.1 bits (67), Expect = 6.3 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 381 TSILTKXXPPXPPPPXXXPPPXPP 452 TS TK PP P P PPP PP Sbjct: 203 TSPNTKPCPPTPTTPETSPPPPPP 226 >AF297872-1|AAL01653.1| 1200|Homo sapiens zinc finger transcription factor TReP-132 protein. Length = 1200 Score = 31.1 bits (67), Expect = 6.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 396 KXXPPXPPPPXXXPPPXPP 452 K PP P PP PPP PP Sbjct: 550 KVLPPQPQPPLPPPPPPPP 568 >AF070530-1|AAC28630.1| 416|Homo sapiens unknown protein. Length = 416 Score = 31.1 bits (67), Expect = 6.3 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 381 TSILTKXXPPXPPPPXXXPPPXPP 452 TS TK PP P P PPP PP Sbjct: 46 TSPNTKPCPPTPTTPETSPPPPPP 69 >AC006333-1|AAQ96857.1| 505|Homo sapiens unknown protein. Length = 505 Score = 31.1 bits (67), Expect = 6.3 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 390 LTKXXPPXPPPPXXXPPPXPP 452 L + PP PPP PPP PP Sbjct: 272 LRRQAPPPPPPSRGGPPPPPP 292 Score = 30.7 bits (66), Expect = 8.4 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 405 PPXPPPPXXXPPP-XPPXTXXQVPGXXG 485 PP PPPP PPP P QVP G Sbjct: 377 PPPPPPPGPPPPPGLPSDGDHQVPTTAG 404 >AB209373-1|BAD92610.1| 410|Homo sapiens CS0DA006YC23 variant protein. Length = 410 Score = 31.1 bits (67), Expect = 6.3 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +3 Query: 405 PPXPPPPXXXPPP---XPPXTXXQVPGXXGXP 491 PP PPPP PPP PP PG P Sbjct: 309 PPNPPPPPVPPPPASFPPPAIPPPTPGYPPPP 340 >AB097023-1|BAC77376.1| 712|Homo sapiens putative NFkB activating protein protein. Length = 712 Score = 31.1 bits (67), Expect = 6.3 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 381 TSILTKXXPPXPPPPXXXPPPXPP 452 TS TK PP P P PPP PP Sbjct: 342 TSPNTKPCPPTPTTPETSPPPPPP 365 >AB093555-1|BAC44839.1| 712|Homo sapiens TIR domain containing adaptor inducing interferon-beta protein. Length = 712 Score = 31.1 bits (67), Expect = 6.3 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 381 TSILTKXXPPXPPPPXXXPPPXPP 452 TS TK PP P P PPP PP Sbjct: 342 TSPNTKPCPPTPTTPETSPPPPPP 365 >AB086380-1|BAC55579.1| 712|Homo sapiens TICAM-1 protein. Length = 712 Score = 31.1 bits (67), Expect = 6.3 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 381 TSILTKXXPPXPPPPXXXPPPXPP 452 TS TK PP P P PPP PP Sbjct: 342 TSPNTKPCPPTPTTPETSPPPPPP 365 >AB002337-1|BAA20797.2| 1709|Homo sapiens KIAA0339 protein protein. Length = 1709 Score = 31.1 bits (67), Expect = 6.3 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 405 PPXPPPPXXXPPPXPPXTXXQVP 473 PP PPP PPP PP +P Sbjct: 602 PPQQPPPPPPPPPPPPPYLASLP 624 >X16667-1|CAA34657.1| 431|Homo sapiens protein ( Human HOX2G mRNA from the Hox2 locus. ). Length = 431 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 475 PGTWXXVXGGXGGGXXXGGGGXGG 404 PGT GG GGG G GG GG Sbjct: 147 PGTAEGCGGGGGGGGGGGSGGSGG 170 >U69127-1|AAC50893.1| 600|Homo sapiens FUSE binding protein 3 protein. Length = 600 Score = 30.7 bits (66), Expect = 8.4 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = -1 Query: 490 GNPXXPGTWXXVXGGXGGGXXXGGGGXGG 404 G PG+ V GG GGG GGGG GG Sbjct: 4 GREAGPGSRARV-GGVGGGGDGGGGGNGG 31 >U59298-1|AAD10852.1| 431|Homo sapiens hox homeobox transcription factor HOXB3 protein. Length = 431 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 475 PGTWXXVXGGXGGGXXXGGGGXGG 404 PGT GG GGG G GG GG Sbjct: 147 PGTAEGCGGGGGGGGGGGSGGSGG 170 >BC111560-1|AAI11561.1| 1040|Homo sapiens protocadherin 10 protein. Length = 1040 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 457 VXGGXGGGXXXGGGGXGGXXL 395 V GG GGG GGGG GG L Sbjct: 204 VDGGGGGGVGEGGGGGGGAGL 224 >BC050283-1|AAH50283.1| 499|Homo sapiens WASF3 protein protein. Length = 499 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +2 Query: 386 HSYQTXXPXTSPPPXXPPPXPPXXXXPST 472 H T T+PPP PPP PP P + Sbjct: 381 HPPSTGLLVTAPPPPGPPPPPPGPPGPGS 409 >BC021165-1|AAH21165.1| 609|Homo sapiens ZNF503 protein protein. Length = 609 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -1 Query: 475 PGTWXXVXGGXGGGXXXGGGGXGG 404 PG+ GG GGG GGGG GG Sbjct: 181 PGSDKKEPGGGGGGGGGGGGGGGG 204 >BC013011-1|AAH13011.1| 609|Homo sapiens ZNF503 protein protein. Length = 609 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -1 Query: 475 PGTWXXVXGGXGGGXXXGGGGXGG 404 PG+ GG GGG GGGG GG Sbjct: 181 PGSDKKEPGGGGGGGGGGGGGGGG 204 >BC011625-1|AAH11625.1| 646|Homo sapiens zinc finger protein 503 protein. Length = 646 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -1 Query: 475 PGTWXXVXGGXGGGXXXGGGGXGG 404 PG+ GG GGG GGGG GG Sbjct: 181 PGSDKKEPGGGGGGGGGGGGGGGG 204 >AY013874-1|AAK21987.1| 896|Homo sapiens protocadherin 10 protein. Length = 896 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 457 VXGGXGGGXXXGGGGXGGXXL 395 V GG GGG GGGG GG L Sbjct: 204 VDGGGGGGVGEGGGGGGGAGL 224 >AL163538-1|CAH72487.1| 502|Homo sapiens WAS protein family, member 3 protein. Length = 502 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +2 Query: 386 HSYQTXXPXTSPPPXXPPPXPPXXXXPST 472 H T T+PPP PPP PP P + Sbjct: 384 HPPSTGLLVTAPPPPGPPPPPPGPPGPGS 412 >AL159978-1|CAI14691.1| 502|Homo sapiens WAS protein family, member 3 protein. Length = 502 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +2 Query: 386 HSYQTXXPXTSPPPXXPPPXPPXXXXPST 472 H T T+PPP PPP PP P + Sbjct: 384 HPPSTGLLVTAPPPPGPPPPPPGPPGPGS 412 >AF521671-1|AAN03447.1| 2165|Homo sapiens SWI/SNF chromatin remodeling complex subunit OSA2 protein. Length = 2165 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 475 PGTWXXVXGGXGGGXXXGGGGXGG 404 PG GG GGG GGGG GG Sbjct: 233 PGAGGGGGGGGGGGGGSGGGGGGG 256 >AF454702-1|AAL51032.1| 502|Homo sapiens WAVE3 protein. Length = 502 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +2 Query: 386 HSYQTXXPXTSPPPXXPPPXPPXXXXPST 472 H T T+PPP PPP PP P + Sbjct: 384 HPPSTGLLVTAPPPPGPPPPPPGPPGPGS 412 >AF287967-5|AAG31555.1| 431|Homo sapiens homeobox B3 protein. Length = 431 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 475 PGTWXXVXGGXGGGXXXGGGGXGG 404 PGT GG GGG G GG GG Sbjct: 147 PGTAEGCGGGGGGGGGGGSGGSGG 170 >AF253515-1|AAN70985.1| 1957|Homo sapiens BAF250b subunit protein. Length = 1957 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 475 PGTWXXVXGGXGGGXXXGGGGXGG 404 PG GG GGG GGGG GG Sbjct: 25 PGAGGGGGGGGGGGGGSGGGGGGG 48 >AF134305-1|AAD33054.1| 455|Homo sapiens Scar3 protein. Length = 455 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +2 Query: 386 HSYQTXXPXTSPPPXXPPPXPPXXXXPST 472 H T T+PPP PPP PP P + Sbjct: 337 HPPSTGLLVTAPPPPGPPPPPPGPPGPGS 365 >AC105383-1|AAY41018.1| 1040|Homo sapiens unknown protein. Length = 1040 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 457 VXGGXGGGXXXGGGGXGGXXL 395 V GG GGG GGGG GG L Sbjct: 204 VDGGGGGGVGEGGGGGGGAGL 224 >AB209210-1|BAD92447.1| 387|Homo sapiens dishevelled 1 isoform a variant protein. Length = 387 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 393 TKXXPPXPPPPXXXPPPXPPXTXXQVPGXXGXP 491 T PP PP P PPP PP P P Sbjct: 327 TAAPPPAPPHPAAAPPPAPPHPAAAPPCFSADP 359 >AB037821-1|BAA92638.1| 1093|Homo sapiens KIAA1400 protein protein. Length = 1093 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 457 VXGGXGGGXXXGGGGXGGXXL 395 V GG GGG GGGG GG L Sbjct: 257 VDGGGGGGVGEGGGGGGGAGL 277 >AB026543-1|BAA81796.1| 502|Homo sapiens WASP-family protein protein. Length = 502 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +2 Query: 386 HSYQTXXPXTSPPPXXPPPXPPXXXXPST 472 H T T+PPP PPP PP P + Sbjct: 384 HPPSTGLLVTAPPPPGPPPPPPGPPGPGS 412 >AB020707-1|BAA74923.2| 503|Homo sapiens KIAA0900 protein protein. Length = 503 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +2 Query: 386 HSYQTXXPXTSPPPXXPPPXPPXXXXPST 472 H T T+PPP PPP PP P + Sbjct: 385 HPPSTGLLVTAPPPPGPPPPPPGPPGPGS 413 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,047,983 Number of Sequences: 237096 Number of extensions: 2436215 Number of successful extensions: 37834 Number of sequences better than 10.0: 215 Number of HSP's better than 10.0 without gapping: 8585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23862 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 12936258326 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -