BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_C16 (875 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC823.08c |||ATP-dependent RNA helicase Rrp3 |Schizosaccharomy... 26 8.1 SPAC1F3.01 |rrp6|SPAC3H8.11|exosome subunit Rrp6 |Schizosaccharo... 26 8.1 SPCC16A11.06c |gpi10||pig-B|Schizosaccharomyces pombe|chr 3|||Ma... 26 8.1 >SPAC823.08c |||ATP-dependent RNA helicase Rrp3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 465 Score = 25.8 bits (54), Expect = 8.1 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 793 LPVLVELWVNTEPFXGTVV 849 LPV+ ELW N PF V+ Sbjct: 102 LPVIQELWNNPSPFFAVVL 120 >SPAC1F3.01 |rrp6|SPAC3H8.11|exosome subunit Rrp6 |Schizosaccharomyces pombe|chr 1|||Manual Length = 777 Score = 25.8 bits (54), Expect = 8.1 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = -3 Query: 321 DLVHH-HEIFVGFHVCVAVLAGLDVEVLGDFVVLSFIVDLVNVVEKRQNLLLLF 163 DL HH + F GF VC+ ++ + + + D + L ++ +NVV N++ +F Sbjct: 243 DLEHHDYRSFRGF-VCLMQISNREKDWIVDTLELREELEALNVVFTNPNIIKVF 295 >SPCC16A11.06c |gpi10||pig-B|Schizosaccharomyces pombe|chr 3|||Manual Length = 506 Score = 25.8 bits (54), Expect = 8.1 Identities = 13/57 (22%), Positives = 25/57 (43%) Frame = +1 Query: 634 ICYNYGIIKENEQFVMYAQLFQFPDXXXXXXXXXXXXXXMLGLNAYYYYFHSHLPVL 804 +C + ++ ++Y + F FP + GLNA++YY LP++ Sbjct: 238 LCVSLFLVNIIADRILYGR-FVFPIISFFQFNVTSGLSSLYGLNAWHYYLSQALPLI 293 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,401,568 Number of Sequences: 5004 Number of extensions: 69171 Number of successful extensions: 226 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 218 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 226 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 438479610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -