BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_C15 (859 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP19A11.06 |lid2|SPBP4H10.01|Lid2 complex subunit Lid2 |Schizo... 27 2.6 SPCC330.06c |||thioredoxin peroxidase|Schizosaccharomyces pombe|... 26 7.9 >SPBP19A11.06 |lid2|SPBP4H10.01|Lid2 complex subunit Lid2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1513 Score = 27.5 bits (58), Expect = 2.6 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = -1 Query: 754 GXYRTQINSYKSIDFYNNVXRQNFIHTSRLTRQECLSKRHLYSCFDNAVGN 602 G + I+ KS+ ++V + I + L++ C S L CF++ + N Sbjct: 566 GLLNSSISVLKSMRIPSSVSYEAVIISMVLSKNPCFSSEWLIKCFEDMIAN 616 >SPCC330.06c |||thioredoxin peroxidase|Schizosaccharomyces pombe|chr 3|||Manual Length = 156 Score = 25.8 bits (54), Expect = 7.9 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -1 Query: 373 PCGSQDPGAVGLPGQFAAVIIEDLSVV 293 PC SQ PG + QFAA I + VV Sbjct: 42 PCSSQVPGYIANEKQFAAKGISGIYVV 68 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,325,354 Number of Sequences: 5004 Number of extensions: 69244 Number of successful extensions: 160 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 160 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 426466470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -