BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_C15 (859 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY071724-1|AAL49346.1| 121|Drosophila melanogaster RH40291p pro... 32 1.2 AE014297-3068|AAF55934.1| 121|Drosophila melanogaster CG17820-P... 32 1.2 BT012441-1|AAS93712.1| 1423|Drosophila melanogaster RH07858p pro... 29 8.2 AE013599-3832|AAF47176.3| 1423|Drosophila melanogaster CG3328-PA... 29 8.2 >AY071724-1|AAL49346.1| 121|Drosophila melanogaster RH40291p protein. Length = 121 Score = 31.9 bits (69), Expect = 1.2 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = +2 Query: 86 MNSKLLYFFATVLVCVNAE-VYWEDEEGYPVSGQFSKRHPRDVTWDKQVG 232 MNS L+ + L V A + W +E+ S HP V W VG Sbjct: 1 MNSTLVILLLSALALVQARNIRWSEEDNSSQGPSLSHPHPHSVNWPCDVG 50 >AE014297-3068|AAF55934.1| 121|Drosophila melanogaster CG17820-PA protein. Length = 121 Score = 31.9 bits (69), Expect = 1.2 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = +2 Query: 86 MNSKLLYFFATVLVCVNAE-VYWEDEEGYPVSGQFSKRHPRDVTWDKQVG 232 MNS L+ + L V A + W +E+ S HP V W VG Sbjct: 1 MNSTLVILLLSALALVQARNIRWSEEDNSSQGPSLSHPHPHSVNWPCDVG 50 >BT012441-1|AAS93712.1| 1423|Drosophila melanogaster RH07858p protein. Length = 1423 Score = 29.1 bits (62), Expect = 8.2 Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = +3 Query: 498 LGKNTHLSAGGVVSK--EFGHRRPDVGLQAQITH 593 LG N HLSAGG V E H P GL A +T+ Sbjct: 38 LGHNGHLSAGGGVHSHMESPHTSPMNGLDAHLTN 71 >AE013599-3832|AAF47176.3| 1423|Drosophila melanogaster CG3328-PA protein. Length = 1423 Score = 29.1 bits (62), Expect = 8.2 Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = +3 Query: 498 LGKNTHLSAGGVVSK--EFGHRRPDVGLQAQITH 593 LG N HLSAGG V E H P GL A +T+ Sbjct: 38 LGHNGHLSAGGGVHSHMESPHTSPMNGLDAHLTN 71 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,039,176 Number of Sequences: 53049 Number of extensions: 854813 Number of successful extensions: 1851 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1850 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4126982652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -