BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_C14 (1049 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 41 0.001 At1g61080.1 68414.m06877 proline-rich family protein 41 0.002 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 40 0.002 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 40 0.002 At4g18570.1 68417.m02749 proline-rich family protein common fami... 39 0.005 At1g75550.1 68414.m08780 glycine-rich protein 39 0.005 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 39 0.005 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 38 0.011 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 38 0.011 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 38 0.011 At2g30560.1 68415.m03722 glycine-rich protein 38 0.015 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 38 0.015 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 37 0.019 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 37 0.026 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 37 0.026 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 36 0.034 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 36 0.045 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 36 0.045 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 36 0.059 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 36 0.059 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 35 0.078 At2g30505.1 68415.m03716 Expressed protein 35 0.078 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 35 0.078 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 35 0.078 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 35 0.10 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 35 0.10 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 35 0.10 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 35 0.10 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 35 0.10 At1g21310.1 68414.m02662 proline-rich extensin-like family prote... 35 0.10 At1g53625.1 68414.m06096 expressed protein 34 0.14 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 34 0.14 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 34 0.14 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 34 0.18 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 34 0.18 At4g33660.1 68417.m04781 expressed protein 34 0.18 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 34 0.18 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 33 0.24 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 33 0.24 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 33 0.24 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 33 0.24 At3g24550.1 68416.m03083 protein kinase family protein contains ... 33 0.24 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 33 0.24 At1g27710.1 68414.m03387 glycine-rich protein 33 0.24 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 33 0.31 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 33 0.31 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 33 0.31 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 33 0.31 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 33 0.31 At3g21215.1 68416.m02681 RNA-binding protein, putative contains ... 33 0.31 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 33 0.31 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 33 0.31 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 33 0.31 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 33 0.31 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 30 0.33 At3g50180.1 68416.m05486 hypothetical protein 33 0.42 At3g18810.1 68416.m02389 protein kinase family protein contains ... 33 0.42 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 25 0.53 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 25 0.54 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 32 0.55 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 32 0.55 At5g03160.1 68418.m00264 DNAJ heat shock N-terminal domain-conta... 32 0.55 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 32 0.55 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 32 0.55 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 32 0.55 At3g13225.1 68416.m01660 WW domain-containing protein contains P... 32 0.55 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 32 0.55 At1g29380.1 68414.m03592 hypothetical protein 32 0.55 At4g08230.1 68417.m01358 glycine-rich protein 32 0.73 At3g51290.1 68416.m05614 proline-rich family protein 32 0.73 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 32 0.73 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 32 0.73 At1g15830.1 68414.m01900 expressed protein 32 0.73 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 25 0.89 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 31 0.96 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 31 0.96 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 31 0.96 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 31 1.3 At5g56140.1 68418.m07003 KH domain-containing protein 31 1.3 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 31 1.3 At4g30460.1 68417.m04325 glycine-rich protein 31 1.3 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 31 1.3 At4g03390.1 68417.m00461 leucine-rich repeat transmembrane prote... 31 1.3 At3g49300.1 68416.m05388 proline-rich family protein contains pr... 31 1.3 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 31 1.3 At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1... 31 1.3 At1g74720.1 68414.m08658 C2 domain-containing protein contains I... 31 1.3 At1g15840.1 68414.m01901 expressed protein 31 1.3 At5g67060.1 68418.m08455 basic helix-loop-helix (bHLH) family pr... 31 1.7 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 31 1.7 At5g52510.1 68418.m06514 scarecrow-like transcription factor 8 (... 31 1.7 At5g41460.1 68418.m05035 fringe-related protein strong similarit... 31 1.7 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 31 1.7 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 31 1.7 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 31 1.7 At3g08640.1 68416.m01003 alphavirus core protein family contains... 31 1.7 At2g48160.1 68415.m06031 PWWP domain-containing protein 31 1.7 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 31 1.7 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 30 2.2 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 30 2.2 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 30 2.2 At4g21720.1 68417.m03145 expressed protein 30 2.2 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 30 2.2 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 30 2.2 At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family... 30 2.2 At2g39250.1 68415.m04820 AP2 domain-containing transcription fac... 30 2.2 At2g34670.1 68415.m04259 proline-rich family protein contains pr... 30 2.2 At1g49270.1 68414.m05524 protein kinase family protein contains ... 30 2.2 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 30 2.2 At1g26150.1 68414.m03192 protein kinase family protein similar t... 30 2.2 At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family... 29 2.7 At5g48385.1 68418.m05980 expressed protein 25 2.7 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 30 2.9 At4g01985.1 68417.m00265 expressed protein 30 2.9 At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (... 30 2.9 At3g08630.1 68416.m01002 expressed protein 30 2.9 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 30 2.9 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 30 2.9 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 30 2.9 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 30 2.9 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 30 2.9 At1g18170.1 68414.m02258 immunophilin / FKBP-type peptidyl-proly... 30 2.9 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 30 2.9 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 29 3.9 At5g04290.1 68418.m00422 KOW domain-containing transcription fac... 29 3.9 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 29 3.9 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 29 3.9 At3g55950.1 68416.m06217 protein kinase family protein contains ... 29 3.9 At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family... 29 3.9 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 29 3.9 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 29 3.9 At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family... 27 4.0 At3g05470.1 68416.m00599 formin homology 2 domain-containing pro... 25 4.3 At5g53060.1 68418.m06592 KH domain-containing protein 29 5.1 At5g46780.2 68418.m05763 VQ motif-containing protein contains PF... 29 5.1 At5g46780.1 68418.m05762 VQ motif-containing protein contains PF... 29 5.1 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 29 5.1 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 29 5.1 At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) fa... 29 5.1 At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) fa... 29 5.1 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 29 5.1 At1g62240.1 68414.m07021 expressed protein 29 5.1 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 29 6.8 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 29 6.8 At4g16240.1 68417.m02464 hypothetical protein 29 6.8 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 29 6.8 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 29 6.8 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 29 6.8 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 29 6.8 At2g05440.2 68415.m00575 glycine-rich protein 29 6.8 At2g05440.1 68415.m00574 glycine-rich protein 29 6.8 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 29 6.8 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 29 6.8 At1g70990.1 68414.m08190 proline-rich family protein 29 6.8 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 29 6.8 At1g55540.1 68414.m06356 proline-rich family protein contains pr... 29 6.8 At1g02710.1 68414.m00222 glycine-rich protein 29 6.8 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 25 7.5 At5g46730.1 68418.m05757 glycine-rich protein 28 9.0 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 28 9.0 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 28 9.0 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 28 9.0 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 28 9.0 At3g46740.1 68416.m05074 chloroplast outer envelope protein, put... 28 9.0 At3g18360.1 68416.m02335 VQ motif-containing protein contains PF... 28 9.0 At3g08530.1 68416.m00990 clathrin heavy chain, putative similar ... 28 9.0 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 28 9.0 At1g53640.1 68414.m06100 hypothetical protein ; expression suppo... 28 9.0 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 28 9.0 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 28 9.0 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 28 9.0 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 PP P PPPPP PPPPPPP + P PP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/46 (36%), Positives = 19/46 (41%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 P P PPPPP PPPPPPP + + P PP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/52 (34%), Positives = 20/52 (38%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 P PP P PPPPP PPPPPP + + P PP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPP 437 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 P PP P PPPPP PPPPPP P +PP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPP 436 Score = 36.7 bits (81), Expect = 0.026 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 706 GXGXXXPPPPPXXXXXPPPPPPP 774 G PPPPP PPPPPPP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPP 395 Score = 36.3 bits (80), Expect = 0.034 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P PP P PPPPP PPPPPPP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPP--PPPPPPPPP 407 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPP 771 PP P PPPPP PPP PP Sbjct: 415 PPPPSPPPYVYPPPPPPYVYPPPPSPP 441 Score = 32.7 bits (71), Expect = 0.42 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXP---PPPPPPXXXFXFXXAGXPASXFPP 828 P PP P PPPP P PPPPPP + + P +PP Sbjct: 395 PPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP---YVYPPPPSPPYVYPP 446 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P PP P PP PP PPP P P Sbjct: 420 PPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQP 453 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/57 (29%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +1 Query: 667 VXPXXXKXPPXPGGXGXXXPPPPPXXXXXPPP----PPPPXXXFXFXXAGXPASXFP 825 V P PP P PPPP P P PPPP + P + P Sbjct: 409 VYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPPCNDLP 465 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/53 (26%), Positives = 17/53 (32%) Frame = +3 Query: 672 PPXXKXXPXXGGRXGGXPXPPXXXXXXPPXPPPTTXXFXFXXRGXXXXXXPPP 830 PP P P PP PP PPP+ + + PPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPP 438 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 40.7 bits (91), Expect = 0.002 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP PG PPPPP PPPPPP Sbjct: 540 PPPPGTAAAPPPPPPPPGTQAAPPPPPP 567 Score = 38.7 bits (86), Expect = 0.006 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP PPPPP PPPPPPP Sbjct: 528 PPPRAAVAPPPPPPPPGTAAAPPPPPPP 555 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +1 Query: 691 PPXPGGXGXXX--PPPPPXXXXXPPPPPPP 774 PP P G PPPPP PPPPPPP Sbjct: 539 PPPPPGTAAAPPPPPPPPGTQAAPPPPPPP 568 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P PP P PPPPP PPPPPP Sbjct: 508 PPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPP 541 Score = 37.1 bits (82), Expect = 0.019 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP P PPPPP PPPPPP Sbjct: 527 PPPPRAAVAPPPPPPPPGTAAAPPPPPP 554 Score = 35.9 bits (79), Expect = 0.045 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 5/55 (9%) Frame = +1 Query: 691 PPXP----GGXGXXXPPPP-PXXXXXPPPPPPPXXXFXFXXAGXPASXFPPXXXG 840 PP P G G PPPP P PPPPPP AG P PP G Sbjct: 578 PPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPPMAMANGAAGPPP---PPPRMG 629 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPP----XXXXXPPPPPPPXXXFXFXXAGXP 810 PP P G PPPPP PPPPPP AG P Sbjct: 595 PPMPLANGATPPPPPPPMAMANGAAGPPPPPPRMGMANGAAGPP 638 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPP 771 PP PG PPPPP P PPP Sbjct: 553 PPPPGTQAAPPPPPPPPMQNRAPSPPP 579 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXP 810 PP P G PPPPP P PPP G P Sbjct: 552 PPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPP 591 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P P G PPPP PPPPPP Sbjct: 495 PTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPP 528 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 PP P PPPPP P PP +G P PP Sbjct: 551 PPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPP 596 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 727 PPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 PPPP PPPPPPP A P PP Sbjct: 454 PPPP-----PPPPPPPAVMPLKHFAPPPPPPLPP 482 Score = 29.5 bits (63), Expect = 3.9 Identities = 27/107 (25%), Positives = 29/107 (27%), Gaps = 2/107 (1%) Frame = +3 Query: 672 PPXXKXXPXXGGRXGGXPXPPXXXXXXPPXPPP--TTXXFXFXXRGXXXXXXPPPXXGXX 845 PP P P PP PP PPP T PPP Sbjct: 510 PPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Query: 846 FFXKXPNXXASSXLXXXGGGPLPFLXXXAXGXGXXFXXPXXPPPPPP 986 + P+ GGP P G PPPPPP Sbjct: 570 MQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANG-----ATPPPPPPP 611 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 PP P PPPPP PPPPPPP + P PP Sbjct: 431 PPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPP 476 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 P PP PPPPP PPPPPPP + P PP Sbjct: 471 PPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPP 522 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 P PP PPPPP PPPPPPP P PP Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 P PP PPPPP PPPPPPP P+ PP Sbjct: 440 PPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPP 491 Score = 37.5 bits (83), Expect = 0.015 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P PP PPPPP PPPPPPP Sbjct: 470 PPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPP 503 Score = 35.1 bits (77), Expect = 0.078 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPP 771 P + PP P PPPPP PPPPP Sbjct: 613 PPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPP 645 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 PP P PPPPP PPPP P P PP Sbjct: 501 PPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPP 546 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 P PP P PPPP PPPPPPP P PP Sbjct: 446 PPVYSPPPPP----PPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 694 PXPGGXGXXXPPPPPXXXXXPPPPPP 771 P P PPPPP PPPPPP Sbjct: 609 PPPPPPCIEPPPPPPCIEYSPPPPPP 634 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPP 768 PP P PPPPP PPPPP Sbjct: 630 PPPPPVVHYSSPPPPPVYYSSPPPPP 655 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 694 PXPGGXGXXXPPPPPXXXXXPPPPPP 771 P P PPPPP PPPPPP Sbjct: 641 PPPPPVYYSSPPPPPVYYSSPPPPPP 666 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P PP P PPPP PPPPPP Sbjct: 469 PPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPP 502 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP P PPPP PPPPP P Sbjct: 500 PPPPPPPPPVYSPPPPPVYSSPPPPPSP 527 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPP---PPPXXXFXFXXAGXPASXFPP 828 PP P PPP PPPP PPP + + P S PP Sbjct: 524 PPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPP 572 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP PPPP PPPPPPP Sbjct: 420 PPTLTSPPPPSPPPPVYSPPPPPPPPPP 447 Score = 32.7 bits (71), Expect = 0.42 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP P PPPPP PPPPP Sbjct: 618 PPPPPPCIEYSPPPPPPVVHYSSPPPPP 645 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXP---PPPPPP 774 P PP P PPPP P PPPPPP Sbjct: 420 PPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPP 456 Score = 31.9 bits (69), Expect = 0.73 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPP 765 P PP P PPPPP PPPP Sbjct: 645 PVYYSSPPPPPVYYSSPPPPPPVHYSSPPPP 675 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P PP PPPP PPPPP P Sbjct: 564 PPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTP 597 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/78 (24%), Positives = 20/78 (25%) Frame = +3 Query: 597 PPXXXPXPPGGGXKNNXXXXXGXXXPPXXKXXPXXGGRXGGXPXPPXXXXXXPPXPPPTT 776 PP P PP PP P P PP PP PPP Sbjct: 446 PPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPP 505 Query: 777 XXFXFXXRGXXXXXXPPP 830 + PPP Sbjct: 506 PPPVYSPPPPPVYSSPPP 523 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPP 771 P PP P PPPP PPPPP Sbjct: 623 PCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPP 655 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 5/33 (15%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPP-----PPP 774 PP P PPP P PPPP PPP Sbjct: 693 PPPPSAPCEESPPPAPVVHHSPPPPMVHHSPPP 725 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPP PPPPP Sbjct: 603 PTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPP 634 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPP 768 PP P PPPP PPPPP Sbjct: 641 PPPPPVYYSSPPPPPVYYSSPPPPPP 666 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 727 PPPPXXXXXPPPPPPP 774 PPPP PPPPPP Sbjct: 651 PPPPPVYYSSPPPPPP 666 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPP 771 P P P PPPP PPPPP Sbjct: 563 PPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPP 595 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPP PPP P Sbjct: 655 PVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSP 686 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 5/32 (15%) Frame = +1 Query: 694 PXPGGXGXXXPPPPPXXXXXPPP-----PPPP 774 P P PPPPP PPP PPPP Sbjct: 581 PPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPP 612 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +1 Query: 691 PPXPGGXGXXXP--PPPPXXXXXPPPPPPP 774 PP P P PPP PPPPPP Sbjct: 594 PPTPVSSPPPTPVYSPPPPPPCIEPPPPPP 623 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPP P PPPPP Sbjct: 666 PVHYSSPPPPE-VHYHSPPPSPVHYSSPPPPP 696 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 5/39 (12%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPP-----PPPPP 774 P PP P PPPP PP PPPPP Sbjct: 575 PPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPP 613 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 694 PXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P P PPPPP PPP P Sbjct: 682 PPPSPVHYSSPPPPPSAPCEESPPPAP 708 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = +1 Query: 625 GGEXKTTLXXXXVXVXPXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPP 771 GG T L + PP P G G PPPPP PPPPPP Sbjct: 660 GGGKSTNLPSARPPLPGGGPPPPPPPPGGG---PPPPPGGGPPPPPPPP 705 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 4/56 (7%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXX----PPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 P + PP G G PP PPPPPPP G P PP Sbjct: 649 PRVPRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPP 704 Score = 28.7 bits (61), Expect = 6.8 Identities = 21/70 (30%), Positives = 22/70 (31%), Gaps = 3/70 (4%) Frame = +3 Query: 567 KXKKKXXKTXPPXXXPXPP---GGGXKNNXXXXXGXXXPPXXKXXPXXGGRXGGXPXPPX 737 K K + PP PP GGG N P G GG P PP Sbjct: 638 KMKLVDIEKRPPRVPRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPG--GGPPPPPG 695 Query: 738 XXXXXPPXPP 767 PP PP Sbjct: 696 GGPPPPPPPP 705 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -2 Query: 733 GGXGXPPXRPPXXGXFXXXGGXXXPXXXXXLFFXPPPGGXGXXXGG 596 GG PP PP G GG P PPPG G GG Sbjct: 676 GGGPPPPPPPPGGGPPPPPGGGPPPP-------PPPPGALGRGAGG 714 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP P PPPPP PPPPPPP Sbjct: 313 PPPPPPPLLQQPPPPPSVSKAPPPPPPP 340 Score = 35.9 bits (79), Expect = 0.045 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP P PPPP PPPPPPP Sbjct: 314 PPPPPPLLQQPPPPPSVSKAPPPPPPPP 341 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP P PPPP PPPPPP Sbjct: 312 PPPPPPPPLLQQPPPPPSVSKAPPPPPP 339 Score = 31.9 bits (69), Expect = 0.73 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPP 768 PP PPPPP PPPPP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPP 328 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 730 PPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 PPP PPPPPPP S PP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPP 335 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 694 PXPGGXGXXXPPPPPXXXXXPPPPPP 771 P P PPPPP PPPPP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPP 328 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 727 PPPPXXXXXPPPPPPP 774 PPP PPPPPPP Sbjct: 303 PPPQKSIPPPPPPPPP 318 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPP PPPPPPP Sbjct: 303 PPPQKSIPPPPPPPPPP 319 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPP 765 P + PP P PPPPP PPPP Sbjct: 318 PPLLQQPPPPPSVSKAPPPPPP-----PPPP 343 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGGXFXXWG 672 GGGGGGG GGGGG G GG + WG Sbjct: 75 GGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWG 108 Score = 35.1 bits (77), Expect = 0.078 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGGXFXXW 675 GGGGGGG GGGGG G GG W Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGW 104 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 GGGGGGG GGGGG G GG Sbjct: 86 GGGGGGGWGWGGGGGGGGWYKWGCGGGG 113 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 GGGGGGG GGGGG G GG Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGG 97 Score = 32.7 bits (71), Expect = 0.42 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 GGGGGGG GGGGG G GG Sbjct: 84 GGGGGGGGGWGWGGGGGGGGWYKWGCGG 111 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGGXFXXWG 672 G GGGGG GGGGG G GG WG Sbjct: 68 GWGGGGGGGGGGGGGGGGG-----GGGGGGWGWG 96 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -1 Query: 827 GGXXXAGXPAXXKXKXXCGGGGGGGXXXXXGGGGGXXXPXPPGXG 693 GG G GGGGGGG G GGG G G Sbjct: 78 GGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREGRG 122 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP P PPPP PPPPPPP Sbjct: 387 PPPPSAAAPPPPPPPKKGPAAPPPPPPP 414 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +1 Query: 691 PPXPGGXGXXX--PPPPPXXXXXPPPPPPP 774 PP P G PPPPP PPPPPPP Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPPP 401 Score = 38.3 bits (85), Expect = 0.008 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP P PPPPP PPPPPP Sbjct: 386 PPPPPSAAAPPPPPPPKKGPAAPPPPPP 413 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP PG G PPPPP PP PP Sbjct: 405 PAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPP 436 Score = 37.1 bits (82), Expect = 0.019 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP G PPPPP PPPPPP Sbjct: 399 PPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPP---XXXXXPPPPPP 771 PP P G PPPPP PPPPPP Sbjct: 397 PPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPP 771 PP P G PPPPP PP PP Sbjct: 410 PPPPPGKKGAGPPPPPPMSKKGPPKPP 436 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP P PPPPP PPPPP Sbjct: 398 PPPPKKGPAAPPPPPPPGKKGAGPPPPP 425 Score = 29.5 bits (63), Expect = 3.9 Identities = 18/60 (30%), Positives = 20/60 (33%) Frame = +3 Query: 588 KTXPPXXXPXPPGGGXKNNXXXXXGXXXPPXXKXXPXXGGRXGGXPXPPXXXXXXPPXPP 767 +T PP P P G PP P G + G P PP PP PP Sbjct: 381 QTSPPPPPP-PSAAAPPPPPPPKKGPAAPPPP---PPPGKKGAGPPPPPPMSKKGPPKPP 436 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 827 GGXXXAGXPAXXKXKXXCGGGGGGGXXXXXGGGGG 723 GG G PA GGGGGGG GGGGG Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 827 GGXXXAGXPAXXKXKXXCGGGGGGGXXXXXGGGGG 723 GG G PA GGGGGGG GGGGG Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 GGGG GG GGGGG G GG Sbjct: 315 GGGGPGGKKGGPGGGGGNMGNQNQGGGG 342 Score = 28.7 bits (61), Expect = 6.8 Identities = 30/99 (30%), Positives = 30/99 (30%) Frame = -1 Query: 986 GXXGGGGXWXXKXXTXPPXXXXXKRXGAPPXXXKXRGRGXVWXFXKKXXPXXXGGXXXAG 807 G GGGG K G P K G G K GG G Sbjct: 324 GGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNK-----GGGGVQMNG 378 Query: 806 XPAXXKXKXXCGGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 P K GGGGGGG GG P G GG Sbjct: 379 GPNGGKKGG--GGGGGGGGGPMSGGLPPGFRPMGGGGGG 415 Score = 25.4 bits (53), Expect(2) = 4.5 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = -1 Query: 827 GGXXXAGXPAXXKXKXXCGGGGGGGXXXXXGGGGGXXXP 711 GG G P + GGGGGG GG P Sbjct: 395 GGPMSGGLPPGFRPMGGGGGGGGGPQSMSMPMGGAMGGP 433 Score = 22.2 bits (45), Expect(2) = 4.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -1 Query: 737 GGGGGXXXPXPPG 699 GGGGG PPG Sbjct: 465 GGGGGPSAEAPPG 477 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 643 TLXXXXVXVXPXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPP 771 TL P K G G PPPPP PPPPPP Sbjct: 205 TLQVYFKPTKPEPNKPQSAVGANGLPPPPPPPPHQAQPPPPPP 247 Score = 37.1 bits (82), Expect = 0.019 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPP 771 PP P PPPPP PPPPPP Sbjct: 231 PPPPPPPHQAQPPPPPPSGLFPPPPPP 257 Score = 35.1 bits (77), Expect = 0.078 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXF 786 P G PPPPP PPPPPP F Sbjct: 220 PQSAVGANGLPPPPPPPPHQAQPPPPPPSGLF 251 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPP 771 P PP P G PPPPP P PP Sbjct: 236 PPHQAQPPPPPPSGLFPPPPPPMANNGFRPMPP 268 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 37.5 bits (83), Expect = 0.015 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 827 GGXXXAGXPAXXKXKXXCGGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 GG G K CGGGGGG GG GG PG G Sbjct: 102 GGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGGGYMVAPGSNG 147 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 770 GGGGGGXXXXXGGGGGXXXPXPPGXGG 690 GGGGGG GGGGG G GG Sbjct: 15 GGGGGGSGGGRGGGGGGGAKGGCGGGG 41 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -1 Query: 824 GXXXAGXPAXXKXKXXCGGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 G G K GGGGG GGGGG G GG Sbjct: 92 GGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGG 136 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGG 723 GGGGGG GGGGG Sbjct: 15 GGGGGGSGGGRGGGGGG 31 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGG 723 GGGGG G GGGGG Sbjct: 16 GGGGGSGGGRGGGGGGG 32 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGG 726 GGGGGGG GGGG Sbjct: 26 GGGGGGGAKGGCGGGG 41 Score = 28.7 bits (61), Expect = 6.8 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = -1 Query: 827 GGXXXAGXPAXXKXKXXCGGG--GGGGXXXXXGGGGGXXXPXPPGXGG 690 GG +G A K CGGG GGGG GGG G G G Sbjct: 86 GGGGISGGGAGGKS--GCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSG 131 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 37.5 bits (83), Expect = 0.015 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = +1 Query: 691 PPXPGGXGXXXPPP---PPXXXXXPPPPPPPXXXFXFXXAGXPASXFPPXXXGS 843 PP P PPP PP PPPPPPP + P PP GS Sbjct: 577 PPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGS 630 Score = 37.5 bits (83), Expect = 0.015 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P PP G PPPPP P PPPPP Sbjct: 699 PAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPP 732 Score = 34.7 bits (76), Expect = 0.10 Identities = 22/72 (30%), Positives = 23/72 (31%), Gaps = 3/72 (4%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPP---PPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPPXXXGS 843 P PP P PP PPP PPPPPP A P PP + Sbjct: 572 PPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGST 631 Query: 844 XFX*NXQTXPRP 879 Q P P Sbjct: 632 GNKRQAQPPPPP 643 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/61 (31%), Positives = 20/61 (32%) Frame = +3 Query: 588 KTXPPXXXPXPPGGGXKNNXXXXXGXXXPPXXKXXPXXGGRXGGXPXPPXXXXXXPPXPP 767 + PP P PP K N PP P R G P PP P PP Sbjct: 673 RVGPPSTPPPPPPPPPKAN---ISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPP 729 Query: 768 P 770 P Sbjct: 730 P 730 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP P PPPP P PPPPP Sbjct: 716 PPPPPPLSKTPAPPPPPLSKTPVPPPPP 743 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = +1 Query: 724 PPPPPXXXXX-----PPPPPPPXXXFXFXXAGXPASXFPP 828 PPPPP PPPPPPP G P++ PP Sbjct: 644 PPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPP 683 Score = 31.5 bits (68), Expect = 0.96 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 12/58 (20%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPP------------XXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 PP G PPPPP PPPPPPP F + P+ PP Sbjct: 471 PPSSGDHVTLLPPPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPP 528 Score = 31.5 bits (68), Expect = 0.96 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 7/42 (16%) Frame = +1 Query: 724 PPPPPXXXXX-------PPPPPPPXXXFXFXXAGXPASXFPP 828 PPPPP PPPPPPP F + P+ PP Sbjct: 508 PPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPPPP 549 Score = 31.1 bits (67), Expect = 1.3 Identities = 32/133 (24%), Positives = 38/133 (28%) Frame = +3 Query: 588 KTXPPXXXPXPPGGGXKNNXXXXXGXXXPPXXKXXPXXGGRXGGXPXPPXXXXXXPPXPP 767 KT PP P PP + PP + P P PP PP Sbjct: 570 KTPPPPPPPPPP----LPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPP 625 Query: 768 PTTXXFXFXXRGXXXXXXPPPXXGXXFFXKXPNXXASSXLXXXGGGPLPFLXXXAXGXGX 947 P+ F G PPP P ++ P P + G Sbjct: 626 PS-----FGSTGNKRQAQPPPPPPPP----PPTRIPAAKCAPPPPPPPPTSHSGSIRVGP 676 Query: 948 XFXXPXXPPPPPP 986 P PPPPPP Sbjct: 677 P-STPPPPPPPPP 688 Score = 31.1 bits (67), Expect = 1.3 Identities = 22/69 (31%), Positives = 22/69 (31%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPPXXXGSXFX 852 P PP G G PP PPPPPPP A P P GS Sbjct: 619 PPPPPPPPSFGSTGNKRQAQPPP----PPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRV 674 Query: 853 *NXQTXPRP 879 T P P Sbjct: 675 GPPSTPPPP 683 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +1 Query: 691 PPXPG-GXGXXXPPPP--PXXXXXPPPPPP 771 PP PG G G PPP PPPPPP Sbjct: 740 PPPPGLGRGTSSGPPPLGAKGSNAPPPPPP 769 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXP 810 PP P P PPP P PPPP +G P Sbjct: 715 PPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPP 754 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +1 Query: 691 PPXPGGXG---XXXPPPPPXXXXXPPPPPPP 774 PP P G G PPP PPPPPP Sbjct: 739 PPPPPGLGRGTSSGPPPLGAKGSNAPPPPPP 769 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXP 810 P P PPPPP PPPPPPP G P Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIP 75 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPP 771 P + PP P PPPPP PPPPPP Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPP----PPPPPP 64 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 4/56 (7%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXP----PPPPPPXXXFXFXXAGXPASXFPP 828 P PP P PPPPP PPPPPP + P PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPP 98 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP P P PPP PPPPPPP Sbjct: 25 PPPPPPMRRSAPSPPPMSGRVPPPPPPP 52 Score = 33.9 bits (74), Expect = 0.18 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 712 GXXXPPPPPXXXXXPPPPPPP 774 G PPPP PPPPPPP Sbjct: 636 GSPSPPPPSMSGGAPPPPPPP 656 Score = 33.5 bits (73), Expect = 0.24 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPPXXXF 786 PPPPP PPPPPP F Sbjct: 151 PPPPPMPRRSPPPPPPRFDAF 171 Score = 32.7 bits (71), Expect = 0.42 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP P PPP PPPPPPP Sbjct: 26 PPPPPMRRSAPSPPPMSGRVPPPPPPPP 53 Score = 32.7 bits (71), Expect = 0.42 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPPP PPPPPP Sbjct: 150 PPPPPPMPRRSPPPPPP 166 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 9/47 (19%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXP---------PPPPPPXXXFXFXXAG 804 PP G PPPPP P PPPPPP F AG Sbjct: 15 PPMRGRVPLPPPPPPPMRRSAPSPPPMSGRVPPPPPPPPMFDPKGAG 61 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPP 771 PP G PPPPP PPP Sbjct: 642 PPSMSGGAPPPPPPPPMLVASRTAPPP 668 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 260 PGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPP 291 Score = 35.9 bits (79), Expect = 0.045 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP G PPPPP P PPPPP Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPP 281 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPP 771 P PP P PPPP PPPPP Sbjct: 259 PPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPP 291 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P PP P P PPP PPP PP Sbjct: 268 PPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 36.3 bits (80), Expect = 0.034 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPP 771 P K PP P PPPPP PPPPPP Sbjct: 49 PYVYKSPP-PSPYLYSSPPPPPYVYNSPPPPPP 80 Score = 31.9 bits (69), Expect = 0.73 Identities = 19/59 (32%), Positives = 21/59 (35%), Gaps = 7/59 (11%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP-----PPXXXFXFXXAGXPASXF--PP 828 P PP P PPPPP PP PP PP F + P + PP Sbjct: 59 PYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIYNSPP 117 Score = 31.5 bits (68), Expect = 0.96 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPP 768 PP P PPP P PPPPP Sbjct: 44 PPLPSPYVYKSPPPSPYLYSSPPPPP 69 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPP PPPPP Sbjct: 90 PYVYKSPPPPPFV-YSSPPPPTYIYNSPPPPP 120 Score = 30.3 bits (65), Expect = 2.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 724 PPPPPXXXXXPPPPP 768 PPPPP PPPPP Sbjct: 176 PPPPPYVYNSPPPPP 190 >At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 359 Score = 35.9 bits (79), Expect = 0.045 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPPP PPPPPPP Sbjct: 24 PPPPPYYYLDPPPPPPP 40 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 35.9 bits (79), Expect = 0.045 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPP 771 P PP P P PPP PPPPPP Sbjct: 153 PPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 35.5 bits (78), Expect = 0.059 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXF 786 PP P PPPP PPPP PP F Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPPPPSPPPPAF 97 Score = 32.7 bits (71), Expect = 0.42 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPPP PP PPPP Sbjct: 64 PPPPPPTSPPPPSPPPP 80 Score = 31.5 bits (68), Expect = 0.96 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPP 771 PP P P PPP P PPPP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPP 90 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 694 PXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P P PP PP PP PPPP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPP 90 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP P PPPP PPPP P Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSP 92 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P PP P PPP P PP PPPP Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPP----PPSPPPP 95 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 35.5 bits (78), Expect = 0.059 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 694 PXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 P P PPPPP PPP PPP P PP Sbjct: 52 PEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPP 96 Score = 32.3 bits (70), Expect = 0.55 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP P PPP P PP PPPP Sbjct: 65 PPPPPCPPPPSPPPCPPPPSPPPSPPPP 92 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P PP P PP PP P PPPP Sbjct: 65 PPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXP--PPPPPP 774 P PP P PPPP P PPP PP Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 5/29 (17%) Frame = +1 Query: 703 GGXGXXXPPPPPXXXXXP-----PPPPPP 774 GG PPP P P PPPPPP Sbjct: 39 GGGNDNNPPPSPSPEPEPEPADCPPPPPP 67 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 35.1 bits (77), Expect = 0.078 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPP---PPPXXXXXPPPPPPP 774 P PP P PP PPP PPPPPPP Sbjct: 528 PPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPP 564 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPP---PPPPP 774 P PP P PPPPP PP PPPPP Sbjct: 520 PAPVNSPPPP--VYSPPPPPPPVHSPPPPVHSPPPPP 554 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPP---PPP 774 P PP P PPPPP PPPP PPP Sbjct: 545 PPVHSPPPPP----VYSPPPPPPPVHSPPPPVFSPPP 577 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 6/40 (15%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPP---PPPXXXXXPPP---PPPP 774 P PP P PP PPP PPP PPPP Sbjct: 553 PPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPP 592 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPP---PPPXXXFXFXXAGXPASXFPP 828 P PP P PPPP PPPP PPP P PP Sbjct: 590 PPPVHSPPPP---APVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPP 641 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPP---PPP 774 P PP PPPP PPPP PPP Sbjct: 578 PVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPP 614 >At2g30505.1 68415.m03716 Expressed protein Length = 321 Score = 35.1 bits (77), Expect = 0.078 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFP 825 PPPPP PPPPPPP F G PA FP Sbjct: 6 PPPPPP----PPPPPPPRRDSGF---GDPALVFP 32 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 35.1 bits (77), Expect = 0.078 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 694 PXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P P PPPPP P PPPPP Sbjct: 12 PQPPSQNSLAPPPPPPSLPPPVPPPPP 38 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAG 804 PP P PPPPP PPPPP + G Sbjct: 23 PPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQG 60 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/46 (30%), Positives = 16/46 (34%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXP 810 P P P PPPPP PPPPP + + P Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPP 51 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 35.1 bits (77), Expect = 0.078 Identities = 26/105 (24%), Positives = 31/105 (29%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPPXXXGSXFX 852 P PP P PPPP PPPP P + P PP Sbjct: 522 PSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPP 581 Query: 853 *NXQTXPRPLXXXXXGGAPXLFXFXXXGGXVXXFXXXXPPPPXXP 987 QT P P +P + + + PPPP P Sbjct: 582 KYEQT-PSP-REYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPP 624 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPPXXXGS 843 PPPP PPPPPP + P + P S Sbjct: 607 PPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTAS 646 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPP---XXXXXPPPPPPP 774 PP P PPPPP PPPPPP Sbjct: 607 PPPPTYYATQSPPPPPPPTYYAVQSPPPPPP 637 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXP 810 PP PPPPP PPPPP + A P Sbjct: 609 PPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPP 648 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXP---PPPPPP 774 PP P PPPPP P PPPPP Sbjct: 621 PPPPTYYAVQSPPPPPPVYYPPVTASPPPPP 651 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPP 771 PPPPP P PPPP Sbjct: 501 PPPPPPPEYEPSPPPP 516 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 5/22 (22%) Frame = +1 Query: 724 PPPP-----PXXXXXPPPPPPP 774 PPPP P PPPPPPP Sbjct: 486 PPPPSSKMSPSVKAYPPPPPPP 507 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P P P G G PPPPP PPPP Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPP--PXXXXXPPPPPPP 774 P P P G PPPP P P PPPPP Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPP 406 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 685 KXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 K PP PG G PPP P PP P Sbjct: 401 KPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 685 KXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 + PP G P PPP P PPPP Sbjct: 387 RPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P P P G G PPPPP PPPP Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPP--PXXXXXPPPPPPP 774 P P P G PPPP P P PPPPP Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPP 406 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 685 KXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 K PP PG G PPP P PP P Sbjct: 401 KPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 685 KXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 + PP G P PPP P PPPP Sbjct: 387 RPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 774 PAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPP 805 Score = 32.7 bits (71), Expect = 0.42 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPPP PPPPP P Sbjct: 758 PPPPPTVHYNPPPPPSP 774 Score = 31.9 bits (69), Expect = 0.73 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P PP P PPP P PPPPP Sbjct: 762 PTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPP 795 Score = 31.5 bits (68), Expect = 0.96 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P + P P PPPPP PPP PP Sbjct: 751 PPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPP 784 Score = 31.5 bits (68), Expect = 0.96 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPP 768 PP P PPPP PPPPP Sbjct: 791 PPPPPAVHYSPPPPPVIHHSQPPPPP 816 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 8/36 (22%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPP--------PPPPP 774 PP P PPPPP PP PPPPP Sbjct: 704 PPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPP 739 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPP P P PPPPP Sbjct: 703 PPPAPYYYSSPQPPPPP 719 Score = 29.5 bits (63), Expect = 3.9 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 11/63 (17%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPP-----------PPPPPXXXFXFXXAGXPASX 819 P PP PPPPP PP PPPPP + PA Sbjct: 718 PPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHY 777 Query: 820 FPP 828 PP Sbjct: 778 SPP 780 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPP 771 P P P PPP P PPPPP Sbjct: 707 PYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPP 739 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPP 771 PP P PPPPP PPPP P Sbjct: 445 PPPPPSIHYSSPPPPPVHHSSPPPPSP 471 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 694 PXPGGXGXXXPPPPPXXXXXPPPPP 768 P P PPPP PPPPP Sbjct: 436 PPPSPPVYSPPPPPSIHYSSPPPPP 460 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPP PPP P Sbjct: 440 PPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSP 471 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/59 (32%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPP--XXXXXPPPPPPPXXXFXFXXAGXPASXFPPXXXGS 843 P PP P PPPPP P PPPPP + + PP GS Sbjct: 243 PPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPPLKKTAALSSSASKKPPPAPRGS 301 >At1g21310.1 68414.m02662 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 431 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/56 (30%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP----PPPPXXXFXFXXAGXPASXFPP 828 P PP P PPPP PPP PPPP + + P + P Sbjct: 51 PPVYHSPPPPKKHYEYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 106 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/56 (30%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP----PPPPXXXFXFXXAGXPASXFPP 828 P PP P PPPP PPP PPPP + + P + P Sbjct: 79 PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 134 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/56 (30%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP----PPPPXXXFXFXXAGXPASXFPP 828 P PP P PPPP PPP PPPP + + P + P Sbjct: 107 PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 162 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/56 (30%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP----PPPPXXXFXFXXAGXPASXFPP 828 P PP P PPPP PPP PPPP + + P + P Sbjct: 135 PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 190 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/56 (30%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP----PPPPXXXFXFXXAGXPASXFPP 828 P PP P PPPP PPP PPPP + + P + P Sbjct: 163 PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 218 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/56 (30%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP----PPPPXXXFXFXXAGXPASXFPP 828 P PP P PPPP PPP PPPP + + P + P Sbjct: 191 PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 246 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/56 (30%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP----PPPPXXXFXFXXAGXPASXFPP 828 P PP P PPPP PPP PPPP + + P + P Sbjct: 219 PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 274 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/56 (30%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP----PPPPXXXFXFXXAGXPASXFPP 828 P PP P PPPP PPP PPPP + + P + P Sbjct: 247 PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 302 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/56 (30%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP----PPPPXXXFXFXXAGXPASXFPP 828 P PP P PPPP PPP PPPP + + P + P Sbjct: 275 PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 330 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/56 (30%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP----PPPPXXXFXFXXAGXPASXFPP 828 P PP P PPPP PPP PPPP + + P + P Sbjct: 303 PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 358 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/56 (30%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP----PPPPXXXFXFXXAGXPASXFPP 828 P PP P PPPP PPP PPPP + + P + P Sbjct: 331 PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 386 Score = 31.5 bits (68), Expect = 0.96 Identities = 16/50 (32%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP----PPPPXXXFXFXXAGXP 810 P PP P PPPP PPP PPPP + + P Sbjct: 359 PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKEKYVYKSPPPP 408 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 776 CGGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 CGGG GGG GGGGG G GG Sbjct: 58 CGGGDGGGDGGGDGGGGGCGGGGGCGGGG 86 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 163 PPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPP 194 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 104 PYVYKSPPPPPYV-YSSPPPPPYVYKSPPPPP 134 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 154 PYVYKSPPPPPYV-YSPPPPPPYVYQSPPPPP 184 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 194 PYVYKSPPPPPYV-YSSPPPPPYVYKSPPPPP 224 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 214 PYVYKSPPPPPYV-YSSPPPPPYVYKSPPPPP 244 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 234 PYVYKSPPPPPYV-YSSPPPPPYVYKSPPPPP 264 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 254 PYVYKSPPPPPYV-YSSPPPPPYVYKSPPPPP 284 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 274 PYVYKSPPPPPYV-YSSPPPPPYVYSSPPPPP 304 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 314 PYVYKSPPPPPYV-YTSPPPPPYVYKSPPPPP 344 Score = 32.7 bits (71), Expect = 0.42 Identities = 18/57 (31%), Positives = 21/57 (36%), Gaps = 5/57 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP-----PPXXXFXFXXAGXPASXFPP 828 P PP P PPPPP PPPPP PP + + P + P Sbjct: 114 PYVYSSPPPPPYV-YKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSP 169 Score = 31.9 bits (69), Expect = 0.73 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P + PP P PPPPP PPPPP Sbjct: 174 PYVYQSPPPPPYV-YSSPPPPPYVYKSPPPPP 204 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 64 PYIYSSPPPPPYV-YSSPPPPPYVYNSPPPPP 94 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 74 PYVYSSPPPPPYV-YNSPPPPPYVYSSPPPPP 104 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 84 PYVYNSPPPPPYV-YSSPPPPPYVYKSPPPPP 114 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 94 PYVYSSPPPPPYV-YKSPPPPPYVYSSPPPPP 124 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 144 PYVYSSPPPPPYV-YKSPPPPPYVYSPPPPPP 174 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 184 PYVYSSPPPPPYV-YKSPPPPPYVYSSPPPPP 214 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 204 PYVYSSPPPPPYV-YKSPPPPPYVYSSPPPPP 234 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 224 PYVYSSPPPPPYV-YKSPPPPPYVYSSPPPPP 254 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 244 PYVYSSPPPPPYV-YKSPPPPPYVYSSPPPPP 274 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 264 PYVYSSPPPPPYV-YKSPPPPPYVYSSPPPPP 294 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 284 PYVYSSPPPPPYV-YSSPPPPPYVYSSPPPPP 314 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 294 PYVYSSPPPPPYV-YSSPPPPPYVYKSPPPPP 324 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 304 PYVYSSPPPPPYV-YKSPPPPPYVYTSPPPPP 334 Score = 28.3 bits (60), Expect = 9.0 Identities = 16/53 (30%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPP-PPPPPXXXFXFXXAGXPASXFPP 828 P K PP P PPP P PP PP + + P PP Sbjct: 334 PYVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKPPPYVYNYSPPPAPYVYKPP 386 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/75 (26%), Positives = 27/75 (36%), Gaps = 5/75 (6%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP-----PPXXXFXFXXAGXPASXFPPXXX 837 P K PP P PPPPP PPPPP PP + + P + Sbjct: 404 PYVYKSPPPPPYV-YSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPP 462 Query: 838 GSXFX*NXQTXPRPL 882 + + + P P+ Sbjct: 463 PPSYSYSYSSPPPPI 477 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 64 PYIYKSPPPPPYV-YSSPPPPPYIYKSPPPPP 94 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 84 PYIYKSPPPPPYV-YSSPPPPPYIYKSPPPPP 114 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 104 PYIYKSPPPPPYV-YSSPPPPPYVYKSPPPPP 134 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 124 PYVYKSPPPPPYV-YNSPPPPPYVYKSPPPPP 154 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 144 PYVYKSPPPPPYV-YSSPPPPPYVYKSPPPPP 174 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 164 PYVYKSPPPPPYV-YSSPPPPPYVYKSPPPPP 194 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 184 PYVYKSPPPPPYV-YSSPPPPPYVYKSPPPPP 214 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 204 PYVYKSPPPPPYV-YSSPPPPPYVYKSPPPPP 234 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 224 PYVYKSPPPPPYV-YSSPPPPPYVYKSPPPPP 254 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 244 PYVYKSPPPPPYV-YSSPPPPPYVYKSPPPPP 274 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 264 PYVYKSPPPPPYV-YSSPPPPPYVYKSPPPPP 294 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 284 PYVYKSPPPPPYV-YSSPPPPPYVYKSPPPPP 314 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 304 PYVYKSPPPPPYV-YSSPPPPPYVYKSPPPPP 334 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 324 PYVYKSPPPPPYV-YNSPPPPPYVYKSPPPPP 354 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 364 PYVYKSPPPPPYV-YSSPPPPPYVYKSPPPPP 394 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPPPP PPPPP Sbjct: 384 PYVYKSPPPPPYV-YSSPPPPPYVYKSPPPPP 414 Score = 31.9 bits (69), Expect = 0.73 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 694 PXPGGXGXXXPPPPPXXXXXPPPPP 768 P P PPPPP PPPPP Sbjct: 360 PPPSPYVYKSPPPPPYVYSSPPPPP 384 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 54 PYVYSSPPPPPYI-YKSPPPPPYVYSSPPPPP 84 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 74 PYVYSSPPPPPYI-YKSPPPPPYVYSSPPPPP 104 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 94 PYVYSSPPPPPYI-YKSPPPPPYVYSSPPPPP 124 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 114 PYVYSSPPPPPYV-YKSPPPPPYVYNSPPPPP 144 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 134 PYVYNSPPPPPYV-YKSPPPPPYVYSSPPPPP 164 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 154 PYVYSSPPPPPYV-YKSPPPPPYVYSSPPPPP 184 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 174 PYVYSSPPPPPYV-YKSPPPPPYVYSSPPPPP 204 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 194 PYVYSSPPPPPYV-YKSPPPPPYVYSSPPPPP 224 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 214 PYVYSSPPPPPYV-YKSPPPPPYVYSSPPPPP 244 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 234 PYVYSSPPPPPYV-YKSPPPPPYVYSSPPPPP 264 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 254 PYVYSSPPPPPYV-YKSPPPPPYVYSSPPPPP 284 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 274 PYVYSSPPPPPYV-YKSPPPPPYVYSSPPPPP 304 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 294 PYVYSSPPPPPYV-YKSPPPPPYVYSSPPPPP 324 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 314 PYVYSSPPPPPYV-YKSPPPPPYVYNSPPPPP 344 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 374 PYVYSSPPPPPYV-YKSPPPPPYVYSSPPPPP 404 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 394 PYVYSSPPPPPYV-YKSPPPPPYVYSSPPPPP 424 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 694 PXPGGXGXXXPPPPPXXXXXPPPPP 768 P P PPPPP PPPPP Sbjct: 50 PPPPPYVYSSPPPPPYIYKSPPPPP 74 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P K PP P PPP P PPPPP Sbjct: 344 PYVYKSPPPPPYV-YSSPPPSPYVYKSPPPPP 374 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPP P Sbjct: 334 PYVYNSPPPPPYV-YKSPPPPPYVYSSPPPSP 364 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P PP P PPP PPPPPPP Sbjct: 1095 PPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/52 (36%), Positives = 20/52 (38%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 P PP P PPP P PPPP PP PA+ FPP Sbjct: 1056 PLPEDSPPLP----QESPPPLPPLPPSPPPPSPPLPPSSLPPP-PPAALFPP 1102 Score = 32.3 bits (70), Expect = 0.55 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPP 771 PP P PPPPP P PPPP Sbjct: 1081 PPSPPLPPSSLPPPPPAALFPPLPPPP 1107 Score = 31.5 bits (68), Expect = 0.96 Identities = 16/58 (27%), Positives = 17/58 (29%) Frame = +3 Query: 597 PPXXXPXPPGGGXKNNXXXXXGXXXPPXXKXXPXXGGRXGGXPXPPXXXXXXPPXPPP 770 PP P PP + PP P P PP PP PPP Sbjct: 1069 PPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPP 1126 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXP--PPPPPP 774 P PP P PPPP P PPP PP Sbjct: 1087 PPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPP 1122 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 PP P PP PP PPPPP F P S PP Sbjct: 1070 PPLPPLPPSPPPPSPPLPPSSLPPPPPAA---LFPPLPPPPSQPPP 1112 Score = 28.3 bits (60), Expect = 9.0 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPP---PPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 P PP P PP PPP PP PPP P S PP Sbjct: 1070 PPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPP 1124 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 33.9 bits (74), Expect = 0.18 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPPXXXF 786 PPP P PPPPPPP F Sbjct: 104 PPPQPLNLFSPPPPPPPPDPF 124 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPP PPPPPP Sbjct: 103 PPPPQPLNLFSPPPPPP 119 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP P G PPPP PPPPPPP Sbjct: 20 PPPPVGVPPQYYPPPPPP---PPPPPPP 44 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXF 792 PP G PPPPP PPPPPPP F Sbjct: 21 PPPVGVPPQYYPPPPP-----PPPPPPPPRKVGF 49 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +1 Query: 694 PXPGGXGXXXPPP----PPXXXXXPPPPPPP 774 P PG PPP P PPPPPPP Sbjct: 11 PAPGNYPQGPPPPVGVPPQYYPPPPPPPPPP 41 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Frame = +1 Query: 694 PXPGGXGXXXPPPPP---XXXXXPPPPPPP 774 P P PPPP PPPPPPP Sbjct: 9 PYPAPGNYPQGPPPPVGVPPQYYPPPPPPP 38 Score = 23.8 bits (49), Expect(2) = 8.0 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +3 Query: 936 GXGXXFXXPXXPPPPPP 986 G + P PPPPPP Sbjct: 25 GVPPQYYPPPPPPPPPP 41 Score = 23.4 bits (48), Expect(2) = 8.0 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 Query: 960 PXXPPPPPPXXGG 998 P PPPPPP G Sbjct: 36 PPPPPPPPPRKVG 48 >At2g39750.1 68415.m04881 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 694 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPPXXXFXFXXA 801 PPPPP PPPPP P F A Sbjct: 107 PPPPPPPSPSPPPPPGPVKSFGIVDA 132 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 667 VXPXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 V P PP P P PPP PPPP PP Sbjct: 402 VKPLLPTLPPPPVIEITRDPSPPPSPVQPPPPPSPP 437 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXX--PPPPPPP 774 PP P PPPPP PPPPPPP Sbjct: 33 PPPPLMRRRAPPPPPPPLMRRRAPPPPPPP 62 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P PP PPPPP PPPPPP Sbjct: 28 PLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPP 61 Score = 32.7 bits (71), Expect = 0.42 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPP--XXXXXPPPPPPP 774 P PP PPPPP PPPPPPP Sbjct: 14 PLPPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPP 49 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 694 PXPGGXGXXXPPPPPXXXXXPPPPPP 771 P PGG PPPPP PPPP P Sbjct: 210 PPPGGM-MRGPPPPPHGMQGPPPPRP 234 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 P + P P G PPPP PPPP P P PP Sbjct: 201 PQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 694 PXPGGXGXXXPPPPPXXXXXPPPPPP 771 P PGG PPPPP PPPP P Sbjct: 210 PPPGGM-MRGPPPPPHGMQGPPPPRP 234 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 P + P P G PPPP PPPP P P PP Sbjct: 201 PQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFP 825 PPP P PPPPPP F G S P Sbjct: 217 PPPKPPSPPRKPPPPPPPPAFMSSSGGSDYSDLP 250 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPP 771 PP P PP P PPP PP Sbjct: 44 PPSPSTNSTSPPPSSPLPPSLPPPSPP 70 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P PP P PPP PPPPPPP Sbjct: 77 PPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPP 110 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +1 Query: 700 PGGXGXXXPPPP--PXXXXXPPPPPPP 774 PG G PPP P PPP PPP Sbjct: 21 PGTTGTCCPPPLVFPLLPLSPPPSPPP 47 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -1 Query: 824 GXXXAGXPAXXKXKXXCGGGGGGGXXXXXGGGGGXXXPXPPGXGGXFXXWG 672 G G P GGGGG G GGGGG G GG +G Sbjct: 150 GGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYG 200 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 685 KXPPXPGGXGXXXPPPPPXXXXXPPPPPP 771 K PP GG G PPP P PPPP Sbjct: 93 KYPPPYGGGGQGYYYPPPYSGNYPTPPPP 121 Score = 28.3 bits (60), Expect = 9.0 Identities = 21/80 (26%), Positives = 23/80 (28%) Frame = +3 Query: 612 PXPPGGGXKNNXXXXXGXXXPPXXKXXPXXGGRXGGXPXPPXXXXXXPPXPPPTTXXFXF 791 P PP G ++ K P GG G PP P PPP F Sbjct: 69 PSPPSSGGGSSYYYPPPSQSGGGSKYPPPYGGGGQGYYYPPPYSGNYPTPPPPNPIVPYF 128 Query: 792 XXRGXXXXXXPPPXXGXXFF 851 PPP G F Sbjct: 129 ----PFYYHTPPPGSGSDRF 144 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 33.1 bits (72), Expect = 0.31 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPP 771 PPPPP PPPPPP Sbjct: 90 PPPPPPIENLPPPPPP 105 Score = 31.9 bits (69), Expect = 0.73 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPPP PPPPP P Sbjct: 91 PPPPPIENLPPPPPPLP 107 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 727 PPPPXXXXXPPPPPPPXXXF 786 PPPP PPPPPP F Sbjct: 90 PPPPPPIENLPPPPPPLPKF 109 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P PP PPPPP P PPPPP Sbjct: 26 PPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPP 59 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +1 Query: 661 VXVXPXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 V + P PP PPPPP P PPPP P PP Sbjct: 21 VPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPP 76 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 5/33 (15%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPP-----XXXXXPPPPPPP 774 PP G PPPPP PPPPPPP Sbjct: 15 PPMRGRVPLPPPPPPPPPPMRRRAPLPPPPPPP 47 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXP--PPPPPPXXXFXFXXAGXPASXFPP 828 PP P PPPPP P PPPP A +PP Sbjct: 44 PPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPPLPMFDAEVLCCCYPP 91 Score = 23.4 bits (48), Expect(2) = 9.4 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 969 PPPPPPXXGGXRXRRXXP 1022 PPPPPP R R P Sbjct: 24 PPPPPPPPPPMRRRAPLP 41 Score = 23.0 bits (47), Expect(2) = 9.4 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 960 PXXPPPPPP 986 P PPPPPP Sbjct: 22 PLPPPPPPP 30 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP---PPPP 774 P K PP P PPPPP PPP PPPP Sbjct: 84 PPTVKPPPPP----YVKPPPPPTVKPPPPPYVKPPPP 116 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPP----PPPPP 774 P K PP P PPPPP PP PPPPP Sbjct: 92 PPYVKPPPPP----TVKPPPPPYVKPPPPPTVKPPPPP 125 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP----PPPP 774 P K PP P PPPPP PPP PPPP Sbjct: 100 PPTVKPPPPP----YVKPPPPPTVKPPPPPTPYTPPPP 133 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP----PPPP 774 P K PP P PPPPP PPP PPPP Sbjct: 108 PPYVKPPPPP----TVKPPPPPTPYTPPPPTPYTPPPP 141 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P K PP P PPPP P PPPPP Sbjct: 140 PPTVKPPPPP----VVTPPPPTPTPEAPCPPPPP 169 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPP---PPPP 774 PP PPPPP PPP PPPP Sbjct: 78 PPYTPKPPTVKPPPPPYVKPPPPPTVKPPPP 108 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/59 (32%), Positives = 21/59 (35%), Gaps = 7/59 (11%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPP--PPXXXXXPPP-----PPPPXXXFXFXXAGXPASXFPP 828 P K PP P P P PP PPP PPPP P + +PP Sbjct: 116 PPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPP 174 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP P PPPP PPPPP P Sbjct: 124 PPPPDLDTTTAPPPPSTDIPIPPPPPAP 151 >At3g21215.1 68416.m02681 RNA-binding protein, putative contains RNA recognition motif, Pfam:PF00076; contains AT-AC splice sites at intron 8 Length = 339 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPP 768 PP P PP PP PPPPP Sbjct: 19 PPPPAAVSSAAPPHPPPIHHHPPPPP 44 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGGXFXXW 675 GGGGGGG G GGG G GG W Sbjct: 53 GGGGGGGAWGGEGEGGGEWGGGGEGGGGGRRGW 85 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP---PPPPXXXFXFXXAGXPASXFPP 828 P PP P PPPP PPP PPPP + + P S PP Sbjct: 576 PPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVY----SPPPPSHSPP 626 Score = 31.5 bits (68), Expect = 0.96 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP---PPPP 774 P PP P PPPP PPP PPPP Sbjct: 569 PPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPP 605 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P PP P PPPP PP PPPP Sbjct: 561 PPVYSSPPPP----HVYSPPPPVASPPPPSPPPP 590 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/61 (32%), Positives = 24/61 (39%), Gaps = 10/61 (16%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPP---PPXXXXXPPP-------PPPPXXXFXFXXAGXPASXF 822 P + PP P PPP PP PPP PPPP F + G P + + Sbjct: 53 PSCIQNPPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPPANFLYI-TGPPGNLY 111 Query: 823 P 825 P Sbjct: 112 P 112 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXF 792 P PP P PP PPPPPPP F + Sbjct: 58 PSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTY 97 Score = 31.9 bits (69), Expect = 0.73 Identities = 18/56 (32%), Positives = 20/56 (35%), Gaps = 5/56 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPP--PPPXXXXXPP---PPPPPXXXFXFXXAGXPASXFP 825 P PP P PP PPP PP PPPPP + P +P Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTYPPGDLYP 104 Score = 31.5 bits (68), Expect = 0.96 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 661 VXVXPXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 V P PP P PPPP PPP PPP + P PP Sbjct: 39 VNCIPCLQNQPPPPPS-----PPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPP 89 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 30.3 bits (65), Expect(2) = 0.33 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 730 PPPXXXXXPPPPPPP 774 PPP PPPPPPP Sbjct: 381 PPPSPPPPPPPPPPP 395 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PP P PPPPPPP Sbjct: 244 PPQQPPATPPPPPPPPP 260 Score = 27.5 bits (58), Expect(2) = 0.43 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPP 771 PPPPP PPPPPP Sbjct: 385 PPPPP-----PPPPPP 395 Score = 27.1 bits (57), Expect(2) = 2.7 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 724 PPPPPXXXXXPPPPP 768 PPP P PPPPP Sbjct: 381 PPPSPPPPPPPPPPP 395 Score = 23.8 bits (49), Expect(2) = 0.43 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 754 PPPPPPP 774 PPPPPPP Sbjct: 423 PPPPPPP 429 Score = 23.8 bits (49), Expect(2) = 5.8 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 754 PPPPPPP 774 PPPPPPP Sbjct: 474 PPPPPPP 480 Score = 23.4 bits (48), Expect(2) = 5.8 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPP 771 PPPPP P PP Sbjct: 425 PPPPPRYTQFDPQTPP 440 Score = 21.4 bits (43), Expect(2) = 0.33 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +1 Query: 757 PPPPPPXXXFXFXXAGXP 810 PPPPPP F P Sbjct: 423 PPPPPPPRYTQFDPQTPP 440 Score = 21.4 bits (43), Expect(2) = 2.7 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 754 PPPPPPPXXXF 786 PPPPPP F Sbjct: 424 PPPPPPRYTQF 434 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 32.7 bits (71), Expect = 0.42 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPP P PPPPPPP Sbjct: 25 PPPQPPPPPPPPPPPPP 41 Score = 32.7 bits (71), Expect = 0.42 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PP PP PPPPPPP Sbjct: 26 PPQPPPPPPPPPPPPPP 42 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP P PP PPPPPPP Sbjct: 11 PPLPPRLELRRQRAPPPQPPPPPPPPPP 38 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 32.7 bits (71), Expect = 0.42 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPPP P PPPPP Sbjct: 267 PPPPPPGSWQPSPPPPP 283 Score = 32.7 bits (71), Expect = 0.42 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPPP PPPPPP Sbjct: 268 PPPPPGSWQPSPPPPPP 284 Score = 32.3 bits (70), Expect = 0.55 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPP PPPPPPP Sbjct: 269 PPPPGSWQPSPPPPPPP 285 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 24.6 bits (51), Expect(3) = 0.53 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 960 PXXPPPPPPXXG 995 P PPPPPP G Sbjct: 59 PSPPPPPPPQWG 70 Score = 23.0 bits (47), Expect(3) = 0.53 Identities = 10/34 (29%), Positives = 12/34 (35%) Frame = +3 Query: 729 PPXXXXXXPPXPPPTTXXFXFXXRGXXXXXXPPP 830 PP P PPP T + + PPP Sbjct: 6 PPPQYLRPPSGPPPPTDPYHQYYQHQARPPVPPP 39 Score = 21.4 bits (43), Expect(3) = 0.53 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 Query: 951 FXXPXXPPPPPP 986 F P P PPPP Sbjct: 53 FHHPHSPSPPPP 64 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 24.6 bits (51), Expect(3) = 0.54 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 960 PXXPPPPPPXXG 995 P PPPPPP G Sbjct: 59 PSPPPPPPPQWG 70 Score = 23.0 bits (47), Expect(3) = 0.54 Identities = 10/34 (29%), Positives = 12/34 (35%) Frame = +3 Query: 729 PPXXXXXXPPXPPPTTXXFXFXXRGXXXXXXPPP 830 PP P PPP T + + PPP Sbjct: 6 PPPQYLRPPSGPPPPTDPYHQYYQHQARPPVPPP 39 Score = 21.4 bits (43), Expect(3) = 0.54 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 Query: 951 FXXPXXPPPPPP 986 F P P PPPP Sbjct: 53 FHHPHSPSPPPP 64 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = +1 Query: 667 VXPXXXKXPPXPGGX--GXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 V P PP P PPPPP P PP P + PA PP Sbjct: 706 VPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPP 761 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 685 KXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 K PP P P P PPPPPPP Sbjct: 705 KVPPPPPPAPPAPPTPIVHTSSPPPPPPPP 734 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 32.3 bits (70), Expect = 0.55 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPP 771 P PP P PPPP PPPP P Sbjct: 59 PYPHPHPPPPSPYPHPHQPPPPPHVLPPPPPTP 91 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPP 771 PP P PPP P PPPP P Sbjct: 44 PPPPHFSPPHQPPPSPYPHPHPPPPSP 70 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 694 PXPGGXGXXXPPPPPXXXXXPPPPP 768 P P PPPPP PPPP Sbjct: 23 PVPPPPSHISPPPPPFSPPHHPPPP 47 >At5g03160.1 68418.m00264 DNAJ heat shock N-terminal domain-containing protein similar to P58 protein, Bos primigenius taurus, PIR:A56534; similar to p58 (GI:1353270) {Homo sapiens}; contains Pfam PF00226: DnaJ domain; contains Pfam PF00515: TPR Domain Length = 482 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 6/40 (15%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGG------XXXPXPPGXGGXFXXWG 672 GGGGGGG GGGGG PG GG F +G Sbjct: 442 GGGGGGGYNPFHGGGGGGQQYTFHFEGGFPGGGGGFGGFG 481 >At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / heat shock transcription factor 7 (HSTF7) identical to heat shock factor protein 7 (HSF7) SP:Q9T0D3 from [Arabidopsis thaliana] Length = 377 Score = 32.3 bits (70), Expect = 0.55 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 776 CGGGGGGGXXXXXGGGGG 723 CG GGGGG GGGGG Sbjct: 33 CGAGGGGGGSGGGGGGGG 50 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 32.3 bits (70), Expect = 0.55 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPPP P PPPPP Sbjct: 13 PPPPPSFRSIPRPPPPP 29 Score = 28.3 bits (60), Expect = 9.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPPP P PPPP Sbjct: 12 PPPPPPSFRSIPRPPPP 28 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P PP P PPPP PPPPPPP Sbjct: 85 PEPEHYPPPPYHHYITPSPPPPRP--LPPPPPPP 116 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPP 771 P PP P PPPP P PPPP Sbjct: 74 PPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPP 106 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPPP PPP P P Sbjct: 69 PPPPPPPQSLPPPSPSP 85 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P PP PPPP P PPPP Sbjct: 73 PPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPP 106 >At3g13225.1 68416.m01660 WW domain-containing protein contains Pfam profile PF00397: WW domain Length = 863 Score = 32.3 bits (70), Expect = 0.55 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPP 771 P + P P PPPPP P PPPP Sbjct: 510 PPGEEWIPPPPSESEDVPPPPPDSYSEPIPPPP 542 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPP 771 PP PG PPPP PPPPP Sbjct: 508 PPPPGEEWI---PPPPSESEDVPPPPP 531 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 32.3 bits (70), Expect = 0.55 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPP---PPPXXXFXFXXAGXPASXFPP 828 P PP P PPPPP PPPP PPP P PP Sbjct: 495 PPPVHSPPPPS--PIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPP 547 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP---PPPP 774 P PP P PPPP PPP PPPP Sbjct: 512 PPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPP 548 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPP--PPPPP 774 P PP P PPPPP PP PPPP Sbjct: 522 PPVYSPPPPPPVYSP--PPPPPVHSPPPPVHSPPPP 555 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPP---PPPPP 774 P PP PPPP PP PPPPP Sbjct: 555 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPP 591 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP---PPPP 774 P PP PPPP PPP PPPP Sbjct: 562 PVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPP 598 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP---PPPP 774 P PP PPPP PPP PPPP Sbjct: 569 PVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPP 605 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPP---PPP 774 P PP PPPP PPPP PPP Sbjct: 591 PVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPP 627 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPP---PPP 774 P PP PPPP PPPP PPP Sbjct: 598 PVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPP 634 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP---PPPP 774 P PP PPPP PPP PPPP Sbjct: 628 PVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPP 664 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 5/22 (22%) Frame = +1 Query: 724 PPPPPXXXXXPP-----PPPPP 774 PPPPP PP PPPPP Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPP 514 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 GGGGGGG GGGG G GG Sbjct: 114 GGGGGGGDTGAGAGGGGYGGGGDTGAGG 141 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGGXFXXWGXT 666 GGGGG G GGGGG GG + G T Sbjct: 102 GGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDT 137 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 GGGGGG GGGGG G GG Sbjct: 101 GGGGGGYGGGTPGGGGGGGGDTGAGAGG 128 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 31.9 bits (69), Expect = 0.73 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXG 693 G GGGGG GGGGG PP G Sbjct: 61 GMGGGGGGGGGSGGGGGGRGGGPPRGG 87 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 GG GGGG GGGG P GG Sbjct: 60 GGMGGGGGGGGGSGGGGGGRGGGPPRGG 87 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 31.9 bits (69), Expect = 0.73 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPPXXXFXF 792 PPPPP PPPPPPP + F Sbjct: 105 PPPPPP----PPPPPPPSSTWDF 123 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 31.9 bits (69), Expect = 0.73 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPPP PP PPPP Sbjct: 13 PPPPPRLLVLPPLPPPP 29 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 4/27 (14%) Frame = +1 Query: 724 PPPPPX----XXXXPPPPPPPXXXFXF 792 PPPPP PPPPPPP F Sbjct: 12 PPPPPPRLLVLPPLPPPPPPPPPQLPF 38 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 31.9 bits (69), Expect = 0.73 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 685 KXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 K PP P PPP P PPP PP Sbjct: 41 KPPPAPSPSPCPSPPPKPQPKPVPPPACPP 70 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 667 VXPXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 V P P P PPP P P PPP P Sbjct: 23 VAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKP 58 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P + P P PPP P P PP PP Sbjct: 72 PPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPP 105 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 31.9 bits (69), Expect = 0.73 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = -1 Query: 824 GXXXAGXPAXXKXKXXCGGGGGG-----GXXXXXGGGGGXXXPXPPGXGG 690 G G A + CGGGGGG G GGGGG G GG Sbjct: 383 GWGGGGAGAVTQVMQGCGGGGGGGDGGGGQGTGIGGGGGGEQGTGVGGGG 432 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 GGGGGG GGGG G GG Sbjct: 417 GGGGGGEQGTGVGGGGDTCTQVTHGGGG 444 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 25.4 bits (53), Expect(2) = 0.89 Identities = 13/36 (36%), Positives = 13/36 (36%), Gaps = 2/36 (5%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPP--PXXXXXPPPPPPP 774 P PP P PP P PPPPPP Sbjct: 541 PVHSNGPPSAEAAVTSSPLPPLKPLRILSRPPPPPP 576 Score = 24.6 bits (51), Expect(2) = 0.89 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +1 Query: 757 PPPPPPXXXFXFXXAGXPASXFPP 828 PPPPPP + +S PP Sbjct: 601 PPPPPPPPPLQSHRSALSSSPLPP 624 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 31.5 bits (68), Expect = 0.96 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = +1 Query: 694 PXPGGXGXXXPPPPPXXXXXPPPP---PPPXXXFXFXXAGXPASXFPP 828 P P PPPPP PPPP PP P + PP Sbjct: 34 PEPAPLVDLSPPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPP 81 Score = 31.5 bits (68), Expect = 0.96 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPP---PPPXXXFXFXXAGXPASXFPP 828 P PP P PPPPP PPPP PP P + PP Sbjct: 57 PVNLSPPPPPVNLS---PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPP 108 Score = 31.5 bits (68), Expect = 0.96 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPP---PPPXXXFXFXXAGXPASXFPP 828 P PP P PPPPP PPPP PP P + PP Sbjct: 93 PVLLSPPPPPVNLS---PPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPP 144 Score = 31.5 bits (68), Expect = 0.96 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Frame = +1 Query: 691 PPXPGGXGXXX--PPPPPXXXXX--PPPPPPPXXXFXFXXAGXPASXFPPXXXGSXF 849 PP P PPPPP PPPPPPP + + P PP G + Sbjct: 181 PPRPQAAAYYKKTPPPPPYKYGRVYPPPPPPPQAARSYKRSPPPP---PPSKYGRVY 234 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP-----PPPPXXXF 786 P PP P PPPPP PPP PPPP F Sbjct: 120 PVLLSPPPPPV---LLSPPPPPVNLSPPPPPVLLSPPPPPVLF 159 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 4/38 (10%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPP----PPP 774 P PP P PPPPP PPPP PPP Sbjct: 84 PVNLSPPPPPV---LLSPPPPPVNLSPPPPPVNLSPPP 118 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPP 771 PPPPP PPPP P Sbjct: 169 PPPPPTITRSPPPPRP 184 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 4/38 (10%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP----PPPP 774 P P P PPPP PPP PPPP Sbjct: 55 PPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPP 92 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPPXXXFXFXXAGXPAS 816 PPPPP PPPPPPP + P+S Sbjct: 247 PPPPPP----PPPPPPPPPQRLYGENDTPSS 273 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P PP P PPPPP PPPPP Sbjct: 469 PYVYSSPPPP--YVYSSPPPPPYVYSSPPPPP 498 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPP 771 P PP P PPPP PPPPPP Sbjct: 498 PYVYSSPPPPY---VYSSPPPPYVYSSPPPPPP 527 Score = 30.3 bits (65), Expect = 2.2 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 5/62 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPP-----PPPXXXFXFXXAGXPASXFPPXXX 837 P PP P PPPPP PPPP PPP + P S PP Sbjct: 478 PYVYSSPPPPPYV-YSSPPPPPYVYSSPPPPYVYSSPPPPYVYS-SPPPPPPSPPPPCPE 535 Query: 838 GS 843 S Sbjct: 536 SS 537 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 661 VXVXPXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 V P P P PPPP PPPPP Sbjct: 453 VRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPP 488 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/51 (27%), Positives = 15/51 (29%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFP 825 P PP P PPPP P PPP + P P Sbjct: 507 PYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSP 557 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPP 771 PP PPPPP PPPPP Sbjct: 368 PPRRSPPPLQTPPPPPPPPPLAPPPPP 394 Score = 30.3 bits (65), Expect = 2.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 730 PPPXXXXXPPPPPPP 774 PPP PPPPPPP Sbjct: 373 PPPLQTPPPPPPPPP 387 >At5g56140.1 68418.m07003 KH domain-containing protein Length = 315 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGG 723 GGGGGGG GGGGG Sbjct: 10 GGGGGGGSGGGIGGGGG 26 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGG 723 GGGGGG GGGGG Sbjct: 11 GGGGGGSGGGIGGGGGG 27 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP P G PPPP P PPPP Sbjct: 162 PPQPPFAGQGGPPPPYGMRPPYPGPPPP 189 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGGXF 684 G GGGGG GGGGG G GG + Sbjct: 124 GHGGGGGGGGGRGGGGGSGNGEGYGEGGGY 153 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGGXFXXWG 672 G GGGGG GGGGG G G + G Sbjct: 118 GSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGG 151 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGGXF 684 GGGGGGG G G G G GG + Sbjct: 128 GGGGGGGRGGGGGSGNGEGYGEGGGYGGGY 157 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 685 KXPPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXF 786 K P P P PPP PPPPPPP F Sbjct: 267 KSNPIPNLASEFHPSPPP-----PPPPPPPLPAF 295 >At4g03390.1 68417.m00461 leucine-rich repeat transmembrane protein kinase, putative similar to Z. mays leucine-rich repeat transmembrane protein kinase LRRTPK 1, GenBank accession number AF023164 Length = 776 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPPP PPPPPPP Sbjct: 427 PPPPPP---PPPPPPPP 440 >At3g49300.1 68416.m05388 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 86 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 685 KXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 K P G G PPPPP PPPPP Sbjct: 59 KHDPTKPGYGFPPPPPPP---LSPPPPP 83 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPP 765 PP P G PPPP PPPP Sbjct: 251 PPPPPHIGGSAPPPPHMGGSAPPPP 275 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 694 PXPGGXGXXXPPPPPXXXXXPPPPP 768 P P PPPPP PPPP Sbjct: 241 PPPQRPPMGGPPPPPHIGGSAPPPP 265 >At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1 predicted transmembrane domain; Length = 175 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 776 CGGGGGGGXXXXXGGGGG 723 CGGGGGGG GGG G Sbjct: 152 CGGGGGGGGGGLGGGGCG 169 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 776 CGGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 C GGG G GGGGG G GG Sbjct: 142 CSGGGSHGHGCGGGGGGGGGGLGGGGCGG 170 >At1g74720.1 68414.m08658 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1081 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGG 723 GGGGGGG GGGGG Sbjct: 611 GGGGGGGGGPGGGGGGG 627 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 827 GGXXXAGXPAXXKXKXXCGGGGGGGXXXXXGGGGGXXXPXPPGXG 693 GG G K K G GGGG GGGGG G G Sbjct: 23 GGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDG 67 >At5g67060.1 68418.m08455 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 241 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 GGGGGGG GGGG G GG Sbjct: 192 GGGGGGGGRVLIGGGGMTAASGGGGGGG 219 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 2/19 (10%) Frame = +1 Query: 724 PP--PPPXXXXXPPPPPPP 774 PP PPP PPPPPPP Sbjct: 262 PPNRPPPPSSPPPPPPPPP 280 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPP PPPPP P Sbjct: 266 PPPPSSPPPPPPPPPTP 282 >At5g52510.1 68418.m06514 scarecrow-like transcription factor 8 (SCL8) Length = 640 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPG 699 G GGGG GGGGG P PG Sbjct: 4 GFSGGGGGSDFYGGGGGRSIPGGPG 28 >At5g41460.1 68418.m05035 fringe-related protein strong similarity to unknown protein (pir||T13026) similarity to predicted proteins + similar to hypothetical protein GB:AAC23643 [Arabidopsis thaliana] + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 524 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPPXXXFXFXXAGXPAS 816 PPP P PPPPPPP F G AS Sbjct: 97 PPPSP-----PPPPPPPQTGFQHVVFGIAAS 122 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 2/19 (10%) Frame = +1 Query: 724 PPPPPX--XXXXPPPPPPP 774 PPPPP PPPPPPP Sbjct: 37 PPPPPVYSPPISPPPPPPP 55 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 3/20 (15%) Frame = +1 Query: 724 PPP---PPXXXXXPPPPPPP 774 PPP PP PPPPPPP Sbjct: 39 PPPVYSPPISPPPPPPPPPP 58 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 4/40 (10%) Frame = +1 Query: 667 VXPXXXKXPPXPGGXGXXX----PPPPPXXXXXPPPPPPP 774 + P PP P PPPPP PPPPP Sbjct: 47 ISPPPPPPPPPPQSHAAAYKRYSPPPPPSKYGRVYPPPPP 86 Score = 25.0 bits (52), Expect(2) = 3.3 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +3 Query: 960 PXXPPPPPPXXGGXRXRRXXP 1022 P PPPPPP +R P Sbjct: 50 PPPPPPPPPQSHAAAYKRYSP 70 Score = 23.4 bits (48), Expect(2) = 3.3 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +3 Query: 951 FXXPXXPPPPPP 986 + P PPPPPP Sbjct: 43 YSPPISPPPPPP 54 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 GGGG GG GGGGG G GG Sbjct: 130 GGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPP---PPPPP 774 PP P PPPPP PP PPPPP Sbjct: 742 PPPPAPI--YSPPPPPVHSPPPPVHSPPPPP 770 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 3/54 (5%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPP---PPPXXXFXFXXAGXPASXFP 825 P PP PPPP PPPP PPP A P + P Sbjct: 784 PVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPPATSPMANAP 837 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -2 Query: 985 GGGGGGXXGXXKXKPXPXAXKXRKGRGPP 899 GGGGGG K P P A + +K PP Sbjct: 399 GGGGGGSNPSPKPTPTPKAPEPKKEINPP 427 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 3/20 (15%) Frame = +1 Query: 724 PPPPPXXXXXPPP---PPPP 774 PPPPP PPP PPPP Sbjct: 647 PPPPPPVHSPPPPVFSPPPP 666 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP---PPPP 774 P PP PPPP PPP PPPP Sbjct: 659 PVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPP 695 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPP---PPPPP 774 P PP PPPP PP PPPPP Sbjct: 702 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPP 738 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP---PPPP 774 P PP PPPP PPP PPPP Sbjct: 709 PVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPP 745 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPP 768 P + PP P PPPP PPPPP Sbjct: 728 PPPVQSPPPP----PVFSPPPPAPIYSPPPPP 755 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP---PPPP 774 P PP PPPP PPP PPPP Sbjct: 666 PMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPP 702 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPP--PPPPP 774 P PP P PPPPP PP PPPP Sbjct: 753 PPPVHSPPPP----VHSPPPPPVHSPPPPVHSPPPP 784 >At3g08640.1 68416.m01003 alphavirus core protein family contains Pfam profile: PF00944 alphavirus core protein Length = 337 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 776 CGGGGGGGXXXXXGGGGGXXXPXPPGXGGXFXXWG 672 C GGGGGG GGG G G GG F G Sbjct: 59 CAGGGGGGSTGNNGGGSGSG-----GGGGGFGGSG 88 >At2g48160.1 68415.m06031 PWWP domain-containing protein Length = 1366 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAG 804 P G P P PPPPPPP F F G Sbjct: 1216 PQADGSNFQHRPYPSHPHPHPPPPPPPPQHQFSFREPG 1253 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 P PP P PPPPP P PPPP P PP Sbjct: 63 PTVSSPPPPPLDSS---PPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPP 111 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P PP P PPPP PP PPPP Sbjct: 112 PESTNSPPPP--EVFEPPPPPADEDESPPAPPPP 143 Score = 28.3 bits (60), Expect = 9.0 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 6/58 (10%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPP------PPPPPXXXFXFXXAGXPASXFPP 828 P PP P PPP PP PPPPP A P PP Sbjct: 91 PPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPPEQLPP 148 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +1 Query: 640 TTLXXXXVXVXPXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 T L P PP PP P PPPPPP Sbjct: 28 TPLCISECSTCPTICSPPPSKPSPSMSPPPSPSLPLSSSPPPPPP 72 Score = 28.7 bits (61), Expect = 6.8 Identities = 20/64 (31%), Positives = 22/64 (34%), Gaps = 13/64 (20%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPP------PP-------PPXXXFXFXXAGXPASXFPPX 831 PP P PPPPP PPP PP PP F + + P P Sbjct: 56 PPSPSLPLSSSPPPPPPHKHSPPPLSQSLSPPPLITVIHPPPPRFYYFESTPPPPPLSPD 115 Query: 832 XXGS 843 GS Sbjct: 116 GKGS 119 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPP 771 P PP P P PPP PPP P Sbjct: 1138 PQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAP 1170 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPP 771 P + PP P PPPP P PPP Sbjct: 1127 PLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPP 1159 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 GGGGG G GGGGG G GG Sbjct: 153 GGGGGYGGGGGYGGGGGGYGGGGRGGGG 180 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 GGGG GG GGGGG G GG Sbjct: 154 GGGGYGGGGGYGGGGGGYGGGGRGGGGG 181 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -1 Query: 827 GGXXXAGXPAXXKXKXXCGGGGGGGXXXXXGGGGGXXXPXPPGXGGXF 684 GG G GGGGGG GGGGG G G F Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGGGSCYSCGESGHF 194 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 30.3 bits (65), Expect = 2.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 724 PPPPPXXXXXPPPPP 768 PPPPP PPPPP Sbjct: 107 PPPPPPKPQPPPPPP 121 Score = 30.3 bits (65), Expect = 2.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 727 PPPPXXXXXPPPPPP 771 PPPP PPPPPP Sbjct: 107 PPPPPPKPQPPPPPP 121 >At4g14750.1 68417.m02270 calmodulin-binding family protein contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 387 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPPP PPPPPPP Sbjct: 67 PPPPP-----PPPPPPP 78 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP PPPP PPPPPPP Sbjct: 55 PPPACAITLKDSPPPP-----PPPPPPP 77 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPPP PPPPPPP Sbjct: 120 PPPPP-----PPPPPPP 131 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPPP PPPPPPP Sbjct: 151 PPPPP-----PPPPPPP 162 >At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 177 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 PPPPP P PP + F A FPP Sbjct: 124 PPPPPPYPRQVHPQPPAPPPYKFHQKEPVAKSFPP 158 >At2g39250.1 68415.m04820 AP2 domain-containing transcription factor, putative AP2_ARATH Floral homeotic protein APETALA2.(SP:P47927){Arabidopsis thaliana} Length = 222 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPPP PPPPPPP Sbjct: 55 PPPPP-----PPPPPPP 66 >At2g34670.1 68415.m04259 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 561 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 706 GXGXXXPPPPPXXXXXPPPPPPP 774 G PP PP PPPPPP Sbjct: 69 GLSLPLPPSPPPTLPPSPPPPPP 91 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 4/32 (12%) Frame = +1 Query: 691 PPXPGGXGXXX----PPPPPXXXXXPPPPPPP 774 PP PG G PPPPP P PP P Sbjct: 251 PPPPGSMGTNWVSSPPPPPPGNWQPMPSPPAP 282 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +1 Query: 694 PXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPPXXXG 840 P PGG PPPP PPPP + AG P P G Sbjct: 38 PPPGGYPPQGYPPPPHGYPPAAYPPPPG---AYPPAGYPGPSGPRPGFG 83 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 PP PG PPPP P PP P Sbjct: 219 PPPPGHPKRREQPPPPGSKRPTPSPPSP 246 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 PP P P PP PP PP PAS PP Sbjct: 148 PPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPP 193 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 P + PP PG PP P P P PP Sbjct: 225 PKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPP 258 Score = 28.3 bits (60), Expect = 9.0 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPP-PPPPPXXXFXFXXAGXPASXFPP 828 P PP P G PPP PP P PPP P S PP Sbjct: 71 PPPEPSPPSPSLTG---PPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPP 120 >At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 561 Score = 28.7 bits (61), Expect = 6.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 733 PPXXXXXPPPPPPPXXXF 786 PP PPPPPPP F Sbjct: 359 PPLVYSPPPPPPPPPPFF 376 Score = 24.6 bits (51), Expect(2) = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 727 PPPPXXXXXPPPPPP 771 PPPP PPPPPP Sbjct: 365 PPPP-----PPPPPP 374 Score = 23.8 bits (49), Expect(2) = 2.7 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 754 PPPPPPP 774 PPPPPPP Sbjct: 395 PPPPPPP 401 >At5g48385.1 68418.m05980 expressed protein Length = 558 Score = 24.6 bits (51), Expect(2) = 2.7 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 Query: 736 PXXXXXPPPPPPP 774 P PPPPPPP Sbjct: 515 PIMAAQPPPPPPP 527 Score = 23.8 bits (49), Expect(2) = 2.7 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 757 PPPPPPXXXFXFXXA 801 PPPPPP + F A Sbjct: 521 PPPPPPPQTYTFNPA 535 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPP 771 PPPPP PPPP P Sbjct: 165 PPPPPYPSPLPPPPSP 180 Score = 29.5 bits (63), Expect = 3.9 Identities = 20/74 (27%), Positives = 21/74 (28%), Gaps = 1/74 (1%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPP-PPPXXXFXFXXAGXPASXFPPXXXGSXFX*NXQT 867 PP P PPP P P P P P G P S P S Sbjct: 165 PPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPD 224 Query: 868 XPRPLXXXXXGGAP 909 P PL +P Sbjct: 225 SPLPLPGPPPSSSP 238 Score = 28.7 bits (61), Expect = 6.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPPP PPPP P Sbjct: 164 PPPPPPYPSPLPPPPSP 180 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -1 Query: 827 GGXXXAGXPAXXKXKXXCGGGG-GGGXXXXXGGGGGXXXPXPPGXG 693 GG G K + GGGG GGG G GGG G G Sbjct: 94 GGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGG 139 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 827 GGXXXAGXPAXXKXKXXCGGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 GG G K GGG GGG G GG G GG Sbjct: 154 GGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGG 199 >At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (SCL7) Length = 542 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPPPPPP 771 PP P P PP PPPP P Sbjct: 143 PPPPASTAIWSPSPPSPQHPPPPPPQP 169 >At3g08630.1 68416.m01002 expressed protein Length = 339 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -1 Query: 776 CGGGGGGGXXXXXGGGGG 723 C GGGGGG GGG G Sbjct: 59 CAGGGGGGSIGNHGGGSG 76 >At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ boundaries domain protein 18 (LBD18) identical to LOB DOMAIN 18 [Arabidopsis thaliana] GI:17227164; supported by full-length cDNA gi:17227163 Length = 262 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -1 Query: 776 CGGGGGGGXXXXXGGGGG 723 CGGGG G GGGGG Sbjct: 18 CGGGGSSGGGGSSGGGGG 35 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/52 (30%), Positives = 18/52 (34%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 P K PP P PPPP PPP P + + P PP Sbjct: 39 PYEYKSPPPP----VKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPP 86 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/52 (30%), Positives = 18/52 (34%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 P K PP P PPPP PPP P + + P PP Sbjct: 55 PYEYKSPPPP----VKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPP 102 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/38 (36%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 667 VXPXXXKXPPXPGGXGXXXPPP--PPXXXXXPPPPPPP 774 + P + PP P PPP PP PP PPP Sbjct: 319 IKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPP 356 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 667 VXPXXXKXPPXPGGXGXXXPPP--PPXXXXXPPPPPPP 774 V P + PP P PPP PP PP PPP Sbjct: 503 VKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPP 540 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 667 VXPXXXKXPPXPGGXGXXXPPP--PPXXXXXPPPPPPP 774 V P PP P PPP PP PP PPP Sbjct: 453 VKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPP 490 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 667 VXPXXXKXPPXPGGXGXXXPPP---PPXXXXXPPPPPPP 774 V P + PP P PPP PP PP PPP Sbjct: 672 VKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPP 710 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/39 (35%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 667 VXPXXXKXPPXPGGXGXXXPPP---PPXXXXXPPPPPPP 774 + P + PP P PPP PP PP PPP Sbjct: 116 IYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPP 154 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/39 (35%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 667 VXPXXXKXPPXPGGXGXXXPPP---PPXXXXXPPPPPPP 774 + P + PP P PPP PP PP PPP Sbjct: 655 IKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPP 693 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 3/39 (7%) Frame = +1 Query: 667 VXPXXXKXPPXPGGXGXXXPPP---PPXXXXXPPPPPPP 774 + P PP P PPP PP PP PPP Sbjct: 638 IKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPP 676 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 PPPPP PPPPPP + P PP Sbjct: 44 PPPPP-----PPPPPPLYFSYFSLPPPPPPPHLPP 73 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 803 PAXXKXKXXCGGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 P K GGGGGG GG G P P G G Sbjct: 35 PPVPKPPQHGGGGGGGSKPPPHHGGKGGGKPPPHGGKG 72 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 GGGGG GG GG P G GG Sbjct: 46 GGGGGSKPPPHHGGKGGGKPPPHGGKGG 73 >At1g18170.1 68414.m02258 immunophilin / FKBP-type peptidyl-prolyl cis-trans isomerase family protein similar to (Peptidyl-prolyl cis-trans isomerase) (PPiase) (Rotamase) (SP:Q26486) [Spodoptera frugiperda]; contains Pfam profile: PF00254 FKBP-type peptidyl-prolyl cis-trans isomerases Length = 247 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 727 PPPPXXXXXPPPPPPP 774 PP P PPPPPPP Sbjct: 34 PPEPESSSPPPPPPPP 49 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +1 Query: 691 PPXPGGX--GXXXPP-PPPXXXXXPPPPPPP 774 PP P G PP PPP PPPPP P Sbjct: 236 PPLPMAVRKGVAAPPLPPPGTAALPPPPPLP 266 Score = 29.1 bits (62), Expect = 5.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 727 PPPPXXXXXPPPPPPP 774 PPPP PPPPP P Sbjct: 224 PPPPGRAALPPPPPLP 239 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXPPPPPXXXXXPPP--PPP 771 P PP PPPPP PPP PPP Sbjct: 50 PVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPP 84 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 PPPPP PPPPP P PP Sbjct: 42 PPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPP 76 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +1 Query: 691 PPXPGGXGXXXPPPPPXXXXXPP-PPPPP 774 PP P PPPPP PPPPP Sbjct: 43 PPPPYRSPVTIPPPPPVYSRPVAFPPPPP 71 >At5g04290.1 68418.m00422 KOW domain-containing transcription factor family protein Length = 1493 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 767 GGGGGXXXXXGGGGGXXXPXPPGXGGXFXXWG 672 GGG GGGGG G GG WG Sbjct: 1236 GGGSSWGKQDGGGGGSSWGKQDGGGGSGSAWG 1267 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/52 (30%), Positives = 18/52 (34%) Frame = -1 Query: 827 GGXXXAGXPAXXKXKXXCGGGGGGGXXXXXGGGGGXXXPXPPGXGGXFXXWG 672 GG G + G GGGGG GGG G GG + G Sbjct: 115 GGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGG 166 >At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At3g25690, At5g61090 [Arabidopsis thaliana] Length = 681 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPPP P PPPP Sbjct: 326 PPPPPSPEHKAPAPPPP 342 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPP P PPPPP Sbjct: 327 PPPPSPEHKAPAPPPPP 343 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPP P PPPPPP Sbjct: 328 PPPSPEHKAPAPPPPPP 344 >At3g55950.1 68416.m06217 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to cytokinin-regulated kinase 1 [Nicotiana tabacum] gi|10998537|gb|AAG25966 Length = 814 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 P PP PPPPPPP Sbjct: 361 PASPPSQFPLPPPPPPP 377 >At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 147 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 685 KXPPXPGGXGXXXPPPPPXXXXXPPPPPP 771 K PP GG G PPP PPPP Sbjct: 79 KYPPPYGGDGYGGYYPPPYYGNYGTPPPP 107 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 812 AGXPAXXKXKXXCGGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 AG PA K GGGG GGG P GG Sbjct: 249 AGGPAKNGGKGAPAAGGGGAGGGKGAGGGAKGGPGNQNQGG 289 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGGXFXXWG 672 GGGGGG G GGG P G G F G Sbjct: 304 GGGGGGPNAGKKGNGGG--GPMAGGVSGGFRPMG 335 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGGXF 684 GGGGGGG GGG G G GG F Sbjct: 193 GGGGGGGAGSYGGGGAGAG----SGGGGGF 218 >At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 135 Score = 27.1 bits (57), Expect(2) = 4.0 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 724 PPPPPXXXXXPPPPP 768 PPPPP PPP P Sbjct: 41 PPPPPPLSLSPPPSP 55 Score = 21.0 bits (42), Expect(2) = 4.0 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +1 Query: 757 PPPPPP 774 PPPPPP Sbjct: 85 PPPPPP 90 >At3g05470.1 68416.m00599 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 884 Score = 24.6 bits (51), Expect(2) = 4.3 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 Query: 736 PXXXXXPPPPPPP 774 P PPPPPPP Sbjct: 422 PNSQPRPPPPPPP 434 Score = 23.0 bits (47), Expect(2) = 4.3 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +1 Query: 754 PPPPPPPXXXFXFXXAGXPASXFPP 828 P PPPPP AG + PP Sbjct: 426 PRPPPPPPPPQQLQVAGINKTPPPP 450 >At5g53060.1 68418.m06592 KH domain-containing protein Length = 652 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXP 705 GGGGGG GGGGG P Sbjct: 35 GGGGGGNNRYRGGGGGGGGNGRP 57 >At5g46780.2 68418.m05763 VQ motif-containing protein contains PF05678: VQ motif Length = 237 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 667 VXPXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 V P P P P P PPPPPPP Sbjct: 72 VNPPQTNHPKPPNSRLVKVRPAPLTQLNHPPPPPPP 107 >At5g46780.1 68418.m05762 VQ motif-containing protein contains PF05678: VQ motif Length = 237 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 667 VXPXXXKXPPXPGGXGXXXPPPPPXXXXXPPPPPPP 774 V P P P P P PPPPPPP Sbjct: 72 VNPPQTNHPKPPNSRLVKVRPAPLTQLNHPPPPPPP 107 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -1 Query: 773 GGGGGGGXXXXXGG--GGGXXXPXPPGXGG 690 GGGGGGG GG GGG P G G Sbjct: 575 GGGGGGGSDYYGGGGYGGGGYGGAPSGGYG 604 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGG 726 GGGGGGG GGGG Sbjct: 574 GGGGGGGGSDYYGGGG 589 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -1 Query: 773 GGGGGGGXXXXXGG--GGGXXXPXPPGXGG 690 GGGGGGG GG GGG P G G Sbjct: 575 GGGGGGGSDYYGGGGYGGGGYGGAPSGGYG 604 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGG 726 GGGGGGG GGGG Sbjct: 574 GGGGGGGGSDYYGGGG 589 >At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 341 Score = 29.1 bits (62), Expect = 5.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPP 771 PPPPP PPPP P Sbjct: 25 PPPPPPSSSLPPPPLP 40 >At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 388 Score = 29.1 bits (62), Expect = 5.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPP 771 PPPPP PPPP P Sbjct: 25 PPPPPPSSSLPPPPLP 40 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 727 PPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPPXXXGS 843 PPP P PPPPP A P S PP GS Sbjct: 227 PPPQVKQSEPTPPPPPPSIAVKQSAPTP-SPPPPIKKGS 264 Score = 28.7 bits (61), Expect = 6.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPP P PPPPP Sbjct: 256 PPPPIKKGSSPSPPPPP 272 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 727 PPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 PPPP P PPPP AS PP Sbjct: 256 PPPPIKKGSSPSPPPPPPVKKVGALSSSASKPPP 289 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGG--GXXXPXPPGXGG 690 GGGGGGG GGGG G G GG Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSGSGSGSGG 220 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGG 723 GGGGGGG GGG G Sbjct: 95 GGGGGGGGGGGGGGGSG 111 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGG 723 GGGGGGG GG GG Sbjct: 96 GGGGGGGGGGGGGGSGG 112 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = +1 Query: 706 GXGXXXPPPPPXXXXXPPPPPPPXXXFXFXXAGXPASXFPP 828 G PPPPP P PP + AG P + +PP Sbjct: 40 GSSYPYPPPPPPHGYPPVAYPPHG---GYPPAGYPPAGYPP 77 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 28.7 bits (61), Expect = 6.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPPPP P PPPP Sbjct: 31 PPPPPCICICNPGPPPP 47 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 7/37 (18%) Frame = +1 Query: 685 KXPPXPGGXGXXXPPPPPXXXXXPPP-------PPPP 774 K P P PPPPP PPP PPPP Sbjct: 91 KPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPP 127 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGG 723 GGG GGG GGGGG Sbjct: 21 GGGAGGGFGGGAGGGGG 37 >At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, putative strong similarity to L-galactono-1,4-lactone dehydrogenase, Brassica oleracea, Z97060 [gi:2760543], and gi:3986289 from Ipomea batatas Length = 610 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPP 771 PPPPP PPPPPP Sbjct: 44 PPPPPP--PRPPPPPP 57 Score = 28.3 bits (60), Expect = 9.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 712 GXXXPPPPPXXXXXPPPPP 768 G PPPP PPPPP Sbjct: 39 GQTLTPPPPPPPRPPPPPP 57 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 770 GGGGGGXXXXXGGGGGXXXPXPPGXGGXF 684 GGGGGG G GGG G GG + Sbjct: 588 GGGGGGYGGGGGYGGGGGYGGGGGYGGGY 616 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 8/35 (22%) Frame = +1 Query: 694 PXPGGXGXXXPPPPPXXXXXP--------PPPPPP 774 P P PPPPP P PPPPPP Sbjct: 44 PSPSSVHRPYPPPPPLPDFAPQPLLPPPSPPPPPP 78 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 770 GGGGGGXXXXXGGGGG 723 GGGGGG GGGGG Sbjct: 160 GGGGGGRYGSGGGGGG 175 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -1 Query: 773 GGGGG--GGXXXXXGGGGGXXXPXPPGXGG 690 GGGGG GG GGGGG G GG Sbjct: 90 GGGGGHYGGGGGHYGGGGGHYGGGGGGHGG 119 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -1 Query: 773 GGGG--GGGXXXXXGGGGGXXXPXPPGXGG 690 GGGG GGG GGGGG G GG Sbjct: 98 GGGGHYGGGGGHYGGGGGGHGGGGHYGGGG 127 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -1 Query: 773 GGGGG--GGXXXXXGGGGGXXXPXPPGXGG 690 GGGGG GG GGGGG G GG Sbjct: 76 GGGGGHYGGGGGHYGGGGGHYGGGGGGYGG 105 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 8/42 (19%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXP----PPPPXXXXXPPP----PPPP 774 P K PP P P PPPP PPP PPPP Sbjct: 40 PPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 81 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 8/42 (19%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXP----PPPPXXXXXPPP----PPPP 774 P K PP P P PPPP PPP PPPP Sbjct: 56 PPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPP 97 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 8/42 (19%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXP----PPPPXXXXXPPP----PPPP 774 P K PP P P PPPP PPP PPPP Sbjct: 96 PPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 137 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 8/42 (19%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXP----PPPPXXXXXPPP----PPPP 774 P K PP P P PPPP PPP PPPP Sbjct: 112 PPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 153 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 8/42 (19%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXP----PPPPXXXXXPPP----PPPP 774 P K PP P P PPPP PPP PPPP Sbjct: 40 PPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 81 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 8/42 (19%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXP----PPPPXXXXXPPP----PPPP 774 P K PP P P PPPP PPP PPPP Sbjct: 56 PPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPP 97 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 8/42 (19%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXP----PPPPXXXXXPPP----PPPP 774 P K PP P P PPPP PPP PPPP Sbjct: 96 PPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 137 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 8/42 (19%) Frame = +1 Query: 673 PXXXKXPPXPGGXGXXXP----PPPPXXXXXPPP----PPPP 774 P K PP P P PPPP PPP PPPP Sbjct: 112 PPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 153 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 28.7 bits (61), Expect = 6.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 P PPP PPPP PP Sbjct: 99 PSPPPPSQACPPPPLPP 115 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/46 (32%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +1 Query: 643 TLXXXXVXVXPXXXKXPPXPGGXGXXXPPPPPXXXXXPPPP--PPP 774 T+ V P PP P PPP PP P PPP Sbjct: 110 TVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPP 155 >At1g55540.1 68414.m06356 proline-rich family protein contains proline rich extensin domain, INTERPRO:IPR002965 Length = 915 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 770 GGGGGGXXXXXGGGGGXXXPXPPGXGGXF 684 GGGGGG G GG P G G F Sbjct: 840 GGGGGGFGGLGSGTGGFGGFAPQGSSGGF 868 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGG 723 GGG GGG GGGGG Sbjct: 71 GGGSGGGQRSSSGGGGG 87 Score = 28.3 bits (60), Expect = 9.0 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = -1 Query: 827 GGXXXAGXPAXXKXKXXCGGGGGG-GXXXXXGGGGGXXXPXPPGXGG 690 GG G K GGGGGG G GGG G GG Sbjct: 50 GGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGGGG 96 >At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family protein Length = 558 Score = 24.6 bits (51), Expect(2) = 7.5 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 951 FXXPXXPPPPPP 986 F P PPPPPP Sbjct: 256 FAPPTPPPPPPP 267 Score = 22.2 bits (45), Expect(2) = 7.5 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +3 Query: 960 PXXPPPPPPXXGGXRXRRXXP 1022 P PPPP P R ++ P Sbjct: 264 PPPPPPPRPLAKAARAQKSPP 284 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXGG 690 GGGGGGG GG G G GG Sbjct: 172 GGGGGGGSAGGAHGGSGYGGGEGGGAGG 199 >At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 28.3 bits (60), Expect = 9.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPP P PPPPPP Sbjct: 105 PPPFPGPYDSAPPPPPP 121 >At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 28.3 bits (60), Expect = 9.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPP P PPPPPP Sbjct: 105 PPPFPGPYDSAPPPPPP 121 >At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 28.3 bits (60), Expect = 9.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PPP P PPPPPP Sbjct: 105 PPPFPGPYDSAPPPPPP 121 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 5/22 (22%) Frame = +1 Query: 724 PPPP-----PXXXXXPPPPPPP 774 PPPP P PPPPPPP Sbjct: 140 PPPPSKTHEPSRPNTPPPPPPP 161 >At3g46740.1 68416.m05074 chloroplast outer envelope protein, putative similar to chloroplastic outer envelope membrane protein (OEP75) [Pisum sativum] GI:633607; contains Pfam profile PF01103: outer membrane protein, OMP85 family Length = 818 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGG 723 GGGGG G GGGGG Sbjct: 103 GGGGGDGNFGGFGGGGG 119 >At3g18360.1 68416.m02335 VQ motif-containing protein contains PF05678: VQ motif Length = 285 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 724 PPPPPXXXXXPPPPPPP 774 PP PP PPPPPPP Sbjct: 201 PPQPPPHP--PPPPPPP 215 >At3g08530.1 68416.m00990 clathrin heavy chain, putative similar to Swiss-Prot:Q00610 clathrin heavy chain 1 (CLH-17) [Homo sapiens] Length = 1703 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +1 Query: 673 PXXXKXPPXP--GGXGXXXPPPPPXXXXXPPPPPP 771 P PP P GG G PPP PP PP Sbjct: 1660 PLALPAPPMPGMGGGGGYGPPPQMGGMPGMPPMPP 1694 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = -1 Query: 776 CGGGGGGGXXXXXGGGGGXX-XPXPPGXG 693 CGGG G G G GGG P PG G Sbjct: 6 CGGGPGRGGRGFGGRGGGPGFGPGGPGFG 34 >At1g53640.1 68414.m06100 hypothetical protein ; expression supported by MPSS Length = 290 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 827 GGXXXAGXPAXXKXKXXCGGGGGGGXXXXXGGGGG 723 GG K K C GGGG G GGG G Sbjct: 250 GGLVVVSSSEKSKTKGCCCGGGGCGGGGGCGGGCG 284 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 770 GGGGGGXXXXXGGGGGXXXPXPPGXGGXFXXWGXT 666 GGGG G GGGGG G GG G T Sbjct: 783 GGGGCGGGHHGGGGGGCGGCGGGGCGGGGDGGGMT 817 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 5/22 (22%) Frame = +1 Query: 724 PPPPPXXXXXP-----PPPPPP 774 PPPPP P PPPPPP Sbjct: 223 PPPPPPSQPLPRPLLLPPPPPP 244 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 28.3 bits (60), Expect = 9.0 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -1 Query: 773 GGGGGGGXXXXXGGGGGXXXPXPPGXG-GXFXXWG 672 GGGGGGG G GGG G G G F G Sbjct: 116 GGGGGGGFARRGGYGGGRGGYARGGFGRGGFGGGG 150 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,178,948 Number of Sequences: 28952 Number of extensions: 374712 Number of successful extensions: 10837 Number of sequences better than 10.0: 171 Number of HSP's better than 10.0 without gapping: 1118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5949 length of database: 12,070,560 effective HSP length: 82 effective length of database: 9,696,496 effective search space used: 2588964432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -