BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_C13 (1083 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=... 42 0.036 UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyosteli... 41 0.048 UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein;... 41 0.064 UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=... 41 0.064 UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain... 40 0.084 UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1;... 40 0.11 UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/M... 40 0.11 UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|... 40 0.11 UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thalian... 40 0.15 UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, wh... 40 0.15 UniRef50_O60879 Cluster: Protein diaphanous homolog 2; n=26; Eut... 40 0.15 UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1;... 39 0.19 UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox ca... 39 0.19 UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; ... 39 0.19 UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA... 39 0.26 UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; ... 39 0.26 UniRef50_A7RXK9 Cluster: Predicted protein; n=2; Nematostella ve... 39 0.26 UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas ... 39 0.26 UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, wh... 39 0.26 UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Re... 38 0.34 UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding pro... 38 0.34 UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter lit... 38 0.34 UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing pro... 38 0.34 UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome s... 38 0.45 UniRef50_Q89X06 Cluster: Blr0521 protein; n=7; Bradyrhizobiaceae... 38 0.45 UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherop... 38 0.45 UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella ve... 38 0.45 UniRef50_Q5AL62 Cluster: Putative uncharacterized protein; n=1; ... 38 0.45 UniRef50_Q64467 Cluster: Glyceraldehyde-3-phosphate dehydrogenas... 38 0.45 UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 ... 38 0.59 UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; ... 38 0.59 UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-depe... 38 0.59 UniRef50_A7DWG3 Cluster: Cell wall glycoprotein GP2; n=4; Chlamy... 38 0.59 UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyos... 38 0.59 UniRef50_Q7PMA5 Cluster: ENSANGP00000031515; n=1; Anopheles gamb... 38 0.59 UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella ve... 38 0.59 UniRef50_A2G6R9 Cluster: Putative uncharacterized protein; n=1; ... 38 0.59 UniRef50_Q95JC9 Cluster: Basic proline-rich protein precursor [C... 38 0.59 UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Hu... 38 0.59 UniRef50_UPI0000F1EA7E Cluster: PREDICTED: similar to LOC495114 ... 37 0.78 UniRef50_Q1IA36 Cluster: Insecticidal toxin, SepC/Tcc class; n=1... 37 0.78 UniRef50_A4T9C9 Cluster: Integral membrane protein-like protein;... 37 0.78 UniRef50_Q9FW12 Cluster: Putative proteophosphoglycan; n=1; Oryz... 37 0.78 UniRef50_Q7XCX5 Cluster: Plus-3 domain containing protein, expre... 37 0.78 UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; ... 37 0.78 UniRef50_A4S1Y9 Cluster: Predicted protein; n=1; Ostreococcus lu... 37 0.78 UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba hist... 37 0.78 UniRef50_A7S5P1 Cluster: Predicted protein; n=1; Nematostella ve... 37 0.78 UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, wh... 37 0.78 UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, wh... 37 0.78 UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1;... 37 0.78 UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi... 37 1.0 UniRef50_Q4SE62 Cluster: Chromosome undetermined SCAF14625, whol... 37 1.0 UniRef50_Q6N0Q5 Cluster: Putative uncharacterized protein precur... 37 1.0 UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel d... 37 1.0 UniRef50_Q69MT2 Cluster: Diaphanous protein-like; n=3; Oryza sat... 37 1.0 UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b... 37 1.0 UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, w... 37 1.0 UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 37 1.0 UniRef50_Q9NZ56 Cluster: Formin-2; n=13; Eumetazoa|Rep: Formin-2... 37 1.0 UniRef50_Q9DEH3 Cluster: Diaphanous homologue; n=13; Eumetazoa|R... 36 1.4 UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burk... 36 1.4 UniRef50_Q948Y7 Cluster: VMP3 protein; n=1; Volvox carteri f. na... 36 1.4 UniRef50_Q1EP07 Cluster: Putative uncharacterized protein; n=1; ... 36 1.4 UniRef50_Q00X46 Cluster: Chromosome 13 contig 1, DNA sequence; n... 36 1.4 UniRef50_Q00TD0 Cluster: Chromosome 17 contig 1, DNA sequence; n... 36 1.4 UniRef50_A4S9A6 Cluster: Predicted protein; n=1; Ostreococcus lu... 36 1.4 UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyosteli... 36 1.4 UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila mel... 36 1.4 UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein ca... 36 1.8 UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; ... 36 1.8 UniRef50_A4FGR9 Cluster: Putative uncharacterized protein; n=1; ... 36 1.8 UniRef50_Q9MAV4 Cluster: F24O1.6; n=10; cellular organisms|Rep: ... 36 1.8 UniRef50_Q9FXA1 Cluster: F14J22.4 protein; n=2; Arabidopsis thal... 36 1.8 UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 36 1.8 UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensi... 36 1.8 UniRef50_Q55DK4 Cluster: Actin-binding protein; n=2; Dictyosteli... 36 1.8 UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: ... 36 1.8 UniRef50_A7EKZ0 Cluster: Putative uncharacterized protein; n=1; ... 36 1.8 UniRef50_A6RH13 Cluster: Predicted protein; n=2; Onygenales|Rep:... 36 1.8 UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomy... 36 1.8 UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n... 36 1.8 UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14;... 36 1.8 UniRef50_Q05858 Cluster: Formin; n=26; Euteleostomi|Rep: Formin ... 36 1.8 UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein;... 36 2.4 UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoe... 36 2.4 UniRef50_Q4T4H8 Cluster: Chromosome 2 SCAF9640, whole genome sho... 36 2.4 UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome sh... 36 2.4 UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: ... 36 2.4 UniRef50_Q9XIE0 Cluster: F23H11.22 protein; n=1; Arabidopsis tha... 36 2.4 UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnolioph... 36 2.4 UniRef50_Q42421 Cluster: Chitinase; n=1; Beta vulgaris subsp. vu... 36 2.4 UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|R... 36 2.4 UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukary... 36 2.4 UniRef50_A4S3R1 Cluster: Predicted protein; n=2; Ostreococcus|Re... 36 2.4 UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; ... 36 2.4 UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; ... 36 2.4 UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, w... 36 2.4 UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus ter... 36 2.4 UniRef50_A6SD70 Cluster: Putative uncharacterized protein; n=1; ... 36 2.4 UniRef50_A4R506 Cluster: Putative uncharacterized protein; n=1; ... 36 2.4 UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precu... 36 2.4 UniRef50_UPI000155D461 Cluster: PREDICTED: similar to Mitogen-ac... 35 3.2 UniRef50_UPI0000DA3CD5 Cluster: PREDICTED: hypothetical protein;... 35 3.2 UniRef50_UPI000049834E Cluster: FH2 domain protein; n=1; Entamoe... 35 3.2 UniRef50_Q4RSI9 Cluster: Chromosome 13 SCAF15000, whole genome s... 35 3.2 UniRef50_Q9E938 Cluster: ICP4 protein; n=2; Gallid herpesvirus 3... 35 3.2 UniRef50_Q6MWG9 Cluster: B1160F02.7 protein; n=3; Oryza sativa|R... 35 3.2 UniRef50_Q41192 Cluster: NaPRP3; n=1; Nicotiana alata|Rep: NaPRP... 35 3.2 UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En... 35 3.2 UniRef50_Q0D806 Cluster: Os07g0192900 protein; n=5; Magnoliophyt... 35 3.2 UniRef50_Q93424 Cluster: Putative uncharacterized protein grl-23... 35 3.2 UniRef50_Q86C16 Cluster: Ah1644 protein; n=7; cellular organisms... 35 3.2 UniRef50_Q5CKJ5 Cluster: Putative uncharacterized protein; n=1; ... 35 3.2 UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: ... 35 3.2 UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; ... 35 3.2 UniRef50_Q6AHS6 Cluster: Protease-1 (PRT1) protein, putative; n=... 35 3.2 UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2... 35 3.2 UniRef50_A6RGJ8 Cluster: Predicted protein; n=1; Ajellomyces cap... 35 3.2 UniRef50_Q03211 Cluster: Pistil-specific extensin-like protein p... 35 3.2 UniRef50_UPI0000F2B52B Cluster: PREDICTED: similar to diaphanous... 35 4.2 UniRef50_UPI0000499326 Cluster: actin binding protein; n=1; Enta... 35 4.2 UniRef50_Q7T318 Cluster: Wiskott-Aldrich syndrome; n=7; Euteleos... 35 4.2 UniRef50_Q7SZN7 Cluster: Enah/Vasp-like a; n=3; Danio rerio|Rep:... 35 4.2 UniRef50_Q2J3C8 Cluster: OmpA/MotB precursor; n=4; Alphaproteoba... 35 4.2 UniRef50_A0R2X6 Cluster: Putative uncharacterized protein; n=2; ... 35 4.2 UniRef50_Q6AWX8 Cluster: Growth-regulating factor 11; n=5; Poace... 35 4.2 UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Exte... 35 4.2 UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; ... 35 4.2 UniRef50_Q0E2B5 Cluster: Os02g0254800 protein; n=4; Eukaryota|Re... 35 4.2 UniRef50_Q00TR5 Cluster: Homology to unknown gene; n=3; Ostreoco... 35 4.2 UniRef50_A3A561 Cluster: Putative uncharacterized protein; n=1; ... 35 4.2 UniRef50_Q4QIK8 Cluster: Putative uncharacterized protein; n=2; ... 35 4.2 UniRef50_A2DC30 Cluster: Formin Homology 2 Domain containing pro... 35 4.2 UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU014... 35 4.2 UniRef50_Q5AL52 Cluster: Putative uncharacterized protein BNI1; ... 35 4.2 UniRef50_Q2H239 Cluster: Putative uncharacterized protein; n=1; ... 35 4.2 UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2... 34 5.5 UniRef50_Q4RLL2 Cluster: Chromosome 10 SCAF15019, whole genome s... 34 5.5 UniRef50_Q9J8C9 Cluster: ORF4 hoar; n=1; Spodoptera exigua MNPV|... 34 5.5 UniRef50_Q9LMQ1 Cluster: F7H2.17 protein; n=2; Arabidopsis thali... 34 5.5 UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sa... 34 5.5 UniRef50_Q01L28 Cluster: OSIGBa0147J02.2 protein; n=7; Oryza sat... 34 5.5 UniRef50_A5B045 Cluster: Putative uncharacterized protein; n=1; ... 34 5.5 UniRef50_Q9VZC2 Cluster: CG15021-PA; n=1; Drosophila melanogaste... 34 5.5 UniRef50_A0NCF4 Cluster: ENSANGP00000030385; n=2; Eukaryota|Rep:... 34 5.5 UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein... 34 5.5 UniRef50_A5DSH8 Cluster: Putative uncharacterized protein; n=1; ... 34 5.5 UniRef50_A3LN86 Cluster: Protein involved in actin organization ... 34 5.5 UniRef50_Q86UP3 Cluster: Zinc finger homeobox protein 4; n=18; E... 34 5.5 UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - ... 34 5.5 UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleos... 34 5.5 UniRef50_UPI0000E4857E Cluster: PREDICTED: similar to cold induc... 34 7.3 UniRef50_UPI00003BF9F1 Cluster: PREDICTED: similar to SCAR CG463... 34 7.3 UniRef50_Q4A2S6 Cluster: Putative membrane protein precursor; n=... 34 7.3 UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|R... 34 7.3 UniRef50_Q6H7U3 Cluster: Putative formin I2I isoform; n=2; Oryza... 34 7.3 UniRef50_Q0JA38 Cluster: Os04g0617200 protein; n=2; Oryza sativa... 34 7.3 UniRef50_Q01DC8 Cluster: Plg protein; n=2; Eukaryota|Rep: Plg pr... 34 7.3 UniRef50_A7QNX2 Cluster: Chromosome chr1 scaffold_135, whole gen... 34 7.3 UniRef50_A5BR16 Cluster: Putative uncharacterized protein; n=1; ... 34 7.3 UniRef50_A5AVJ0 Cluster: Putative uncharacterized protein; n=1; ... 34 7.3 UniRef50_A4S1A8 Cluster: Predicted protein; n=1; Ostreococcus lu... 34 7.3 UniRef50_Q8IMM6 Cluster: CG5514-PB, isoform B; n=3; Drosophila m... 34 7.3 UniRef50_Q5CHL3 Cluster: Hydroxyproline-rich glycoprotein dz-hrg... 34 7.3 UniRef50_Q54H12 Cluster: Actin-binding protein; n=2; Dictyosteli... 34 7.3 UniRef50_Q22715 Cluster: Putative uncharacterized protein; n=3; ... 34 7.3 UniRef50_Q0KI93 Cluster: CG12946-PB, isoform B; n=4; Sophophora|... 34 7.3 UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella ve... 34 7.3 UniRef50_A2D765 Cluster: Putative uncharacterized protein; n=1; ... 34 7.3 UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.2... 34 7.3 UniRef50_Q7SEW0 Cluster: Predicted protein; n=1; Neurospora cras... 34 7.3 UniRef50_Q6CGD7 Cluster: Similarity; n=1; Yarrowia lipolytica|Re... 34 7.3 UniRef50_Q2HEQ9 Cluster: Predicted protein; n=1; Chaetomium glob... 34 7.3 UniRef50_A3LNF1 Cluster: Putative uncharacterized protein; n=1; ... 34 7.3 UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|... 34 7.3 UniRef50_UPI000023D566 Cluster: hypothetical protein FG01858.1; ... 27 8.5 UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; ... 33 9.7 UniRef50_UPI0000E4922C Cluster: PREDICTED: similar to Enabled ho... 33 9.7 UniRef50_UPI00006A2591 Cluster: Wiskott-Aldrich syndrome protein... 33 9.7 UniRef50_UPI0000DC00CB Cluster: SH3 domain binding protein CR16;... 33 9.7 UniRef50_Q4A263 Cluster: Putative membrane protein; n=1; Emilian... 33 9.7 UniRef50_Q2NNS2 Cluster: 1629capsid; n=1; Hyphantria cunea nucle... 33 9.7 UniRef50_A5Z1X1 Cluster: Myristylated membrane protein; n=7; Ran... 33 9.7 UniRef50_Q0AVD5 Cluster: Putative uncharacterized protein; n=2; ... 33 9.7 UniRef50_A6APN4 Cluster: Insecticidal toxin, SepC/Tcc class; n=2... 33 9.7 UniRef50_Q8W5K6 Cluster: Putative uncharacterized protein OSJNBa... 33 9.7 UniRef50_Q5ZA46 Cluster: Putative uncharacterized protein P0501G... 33 9.7 UniRef50_Q5VS40 Cluster: Putative glycine-rich protein; n=3; Ory... 33 9.7 UniRef50_Q3ECQ3 Cluster: Uncharacterized protein At1g54215.1; n=... 33 9.7 UniRef50_Q08194 Cluster: Cysteine-rich extensin-like protein-1; ... 33 9.7 UniRef50_A2X6K1 Cluster: Putative uncharacterized protein; n=3; ... 33 9.7 UniRef50_Q9VEJ1 Cluster: CG5836-PA; n=10; Eumetazoa|Rep: CG5836-... 33 9.7 UniRef50_O45522 Cluster: Putative uncharacterized protein; n=2; ... 33 9.7 UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU074... 33 9.7 UniRef50_Q5KG31 Cluster: Putative uncharacterized protein; n=3; ... 33 9.7 UniRef50_Q92558 Cluster: Wiskott-Aldrich syndrome protein family... 33 9.7 UniRef50_Q99954 Cluster: Submaxillary gland androgen-regulated p... 33 9.7 UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|R... 33 9.7 >UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 516 Score = 41.5 bits (93), Expect = 0.036 Identities = 18/53 (33%), Positives = 20/53 (37%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP+P PPP P P PPP PPP P + PP Sbjct: 64 PPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPP 116 Score = 40.7 bits (91), Expect = 0.064 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P + PP Sbjct: 69 PPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 121 Score = 37.1 bits (82), Expect = 0.78 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P +PPPP P Sbjct: 50 PPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSP 82 Score = 36.7 bits (81), Expect = 1.0 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +2 Query: 899 GXXXXPXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 G P SP P PPP P P PPP PPP P PP Sbjct: 14 GAYATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPS-PPPSPPPPLPPPSPSPP 70 Score = 36.7 bits (81), Expect = 1.0 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P+ PPP PPP P PP Sbjct: 24 PPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSP-PPPLPPPSPSPPSPPPP 75 Score = 36.7 bits (81), Expect = 1.0 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P S +PPPP P Sbjct: 119 PPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPP 151 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 45 PPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSP 77 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 105 PPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSP 137 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P S +P PP P Sbjct: 100 PPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSP 132 Score = 34.3 bits (75), Expect = 5.5 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXX-PPPXPPPXXXPAXAXPP 1072 P P+P PPP P P PPP PPP P PP Sbjct: 82 PPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPP 135 Score = 33.9 bits (74), Expect = 7.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P P P P P P +PPPP Sbjct: 110 PPPSPPPPSPPPSPPPSPSPPSPPPPSPPPP 140 Score = 33.5 bits (73), Expect = 9.7 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P+ PP PPP P+ PP Sbjct: 101 PPSPPPPSPPPPSPPPPSPPPSPPPSPSP---PSPPPPSPPPPSISPSPPPPP 150 >UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1126 Score = 41.1 bits (92), Expect = 0.048 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = +1 Query: 541 PPPXPXPAXPX----PXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P PA P P P P S G PPPP P GG P Sbjct: 547 PPPPPPPAPPVSGGGPPPPPPPPPPSSGGGPPPPPPPPSSGGPPPP 592 Score = 35.1 bits (77), Expect = 3.2 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP G PPP P P P P S G PPPP P GG P Sbjct: 555 PPVSGGGP---PPPPPPPPPSSGGGPPPPPPPPSSGGPPPPPPP--PGGMKKP 602 >UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 1102 Score = 40.7 bits (91), Expect = 0.064 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP A PPP P P P P P G APPPP P G P Sbjct: 571 PPSPAAAPPPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPP 623 Score = 37.5 bits (83), Expect = 0.59 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP GA PPP P P+ P P G PPPP P G P Sbjct: 585 PPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSGPPPPP 637 >UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 2873 Score = 40.7 bits (91), Expect = 0.064 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P + PP Sbjct: 2677 PPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPP 2729 Score = 39.9 bits (89), Expect = 0.11 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P PP Sbjct: 2529 PPSPPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPP 2581 Score = 38.3 bits (85), Expect = 0.34 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P PT PPP PPP P + PP Sbjct: 2259 PPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPT--PPPSPPPPSPPPPSPPP 2309 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P S +PPPP P Sbjct: 2551 PPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSP 2583 Score = 38.3 bits (85), Expect = 0.34 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP PA + PP Sbjct: 2719 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPP--PPSPPPPSPPPPLPPAPSPPP 2769 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P P P +PPPP P +P Sbjct: 2676 PPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSP 2717 Score = 36.7 bits (81), Expect = 1.0 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PP P P PPP PPP P + PP Sbjct: 2682 PPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPP 2734 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 217 PPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPP 249 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P + PP Sbjct: 2269 PPSPPPPSPPPPTPPPSPPPPPPTPPPSPP--PPSPPPPSPPPPSPPPPSQPP 2319 Score = 35.9 bits (79), Expect = 1.8 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PP P PP Sbjct: 2686 PPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 2738 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P+ P P P P S +PPPP P Sbjct: 2690 PPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSP 2722 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 207 PPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSP 239 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 220 PPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSP 252 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 1175 PPPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSP 1207 Score = 35.5 bits (78), Expect = 2.4 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P+ P P P P S PPP P +P Sbjct: 2537 PPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSP 2578 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P PP Sbjct: 2734 PPSPPPPSPPPPSPPPPSPPPPSPPPPLP---PAPSPPPSPPPPSPPPSPPPP 2783 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXG 651 PPP P P+ P P P P S PPPP P G Sbjct: 231 PPPPPPPSPPPPSPPPPP--PPSPPPPPPPPLPTPTG 265 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P S +PPPP P Sbjct: 2753 PPPSPPPPLPPAPSPPPSPPPPSPPPSPPPPSP 2785 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PPP P P P P P P PPPP P GG Sbjct: 1186 PPPPPSPPPPSPPPPL----PPPPSPPPPPPLPLIPGG 1219 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXS-XGXAPPPPXP 639 PPP P P+ P P P P S +PPPP P Sbjct: 2709 PPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 2742 Score = 34.3 bits (75), Expect = 5.5 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +1 Query: 538 FP-PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 FP PP P P P P P P +PPPP P Sbjct: 202 FPSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPP 236 Score = 34.3 bits (75), Expect = 5.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P S PPP P Sbjct: 2748 PPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSP 2780 Score = 33.9 bits (74), Expect = 7.3 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P +PPPP P +P Sbjct: 2529 PPSPPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSP 2569 Score = 33.9 bits (74), Expect = 7.3 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P +PPPP P Sbjct: 2533 PPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSP 2565 Score = 33.9 bits (74), Expect = 7.3 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXS-XGXAPPPPXP 639 PPP P P P P P P S +PPPP P Sbjct: 2694 PPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSP 2727 Score = 33.9 bits (74), Expect = 7.3 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P+ P P P P +PPPP P Sbjct: 2700 PPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSP 2732 Score = 33.9 bits (74), Expect = 7.3 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXS-XGXAPPPPXP 639 PPP P P P P P P S +PPPP P Sbjct: 2704 PPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSP 2737 Score = 33.9 bits (74), Expect = 7.3 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPX-SXGXAPPPPXP 639 PPP P P P P P P S +PPPP P Sbjct: 2743 PPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSP 2776 Score = 33.5 bits (73), Expect = 9.7 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPP 1072 P P P PPP P P PP P PPP P+ PP Sbjct: 203 PSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPP 256 Score = 33.5 bits (73), Expect = 9.7 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P P P PP P P TP Sbjct: 222 PPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPTP 263 Score = 33.5 bits (73), Expect = 9.7 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +1 Query: 541 PPPXPX-PAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P + +PPPP P Sbjct: 2258 PPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPP 2291 Score = 33.5 bits (73), Expect = 9.7 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PP P + PP Sbjct: 2534 PPSPPP-SPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPPP 2585 Score = 33.5 bits (73), Expect = 9.7 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = +2 Query: 929 PXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P PPP P P PPP PPP P + PP Sbjct: 2668 PSPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPP 2715 Score = 33.5 bits (73), Expect = 9.7 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAP-PPPXPXXXGGXXTP 666 PPP P P P P P P AP PPP P +P Sbjct: 2738 PPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSP 2780 >UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain binding protein; n=2; Mus musculus|Rep: PREDICTED: similar to SH3 domain binding protein - Mus musculus Length = 455 Score = 40.3 bits (90), Expect = 0.084 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P P P G PPPP P TP Sbjct: 6 PPPPPPPPPPPPPPPLGAPPPPPLGAPPPPPPPGPPVSTDTP 47 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P APPPP P Sbjct: 5 PPPPPPPPPPPPPPPPLGAPPPPPLGAPPPPPP 37 >UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-dz1 protein precursor - Volvox carteri f. nagariensis Length = 1009 Score = 39.9 bits (89), Expect = 0.11 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P PP Sbjct: 221 PPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 38.3 bits (85), Expect = 0.34 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P PP Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P+P PPP P P PPP PPP P PP Sbjct: 209 PPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPP 261 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 216 PPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P+P PPP P P PPP PPP P PP Sbjct: 224 PPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P+ PP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P+ PPP PPP P PP Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPP 697 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P + PP Sbjct: 659 PPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPP 711 Score = 37.5 bits (83), Expect = 0.59 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P S PPPP P Sbjct: 656 PPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 36.7 bits (81), Expect = 1.0 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P PP Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 920 SPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 +P P PPP P P PPP PPP P PP Sbjct: 208 NPPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPP 258 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPP 684 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPP 686 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +2 Query: 899 GXXXXPXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 G P SP P P P P P PPP PPP P PP Sbjct: 206 GYNPPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 35.9 bits (79), Expect = 1.8 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P P P P P PPP PPP P PP Sbjct: 226 PPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 225 PPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPP 257 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 230 PPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPP 262 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPP 264 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 676 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 657 PPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPP 689 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 659 PPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 660 PPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 663 PPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 665 PPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPP 697 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 668 PPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPP 700 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 670 PPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPP 702 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPP 685 Score = 33.9 bits (74), Expect = 7.3 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P P P P P PPP PPP P PP Sbjct: 214 PPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P+ P P P P PPPP P Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPP 260 Score = 33.5 bits (73), Expect = 9.7 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTPH 669 PPP P P P P P PPPP P PH Sbjct: 661 PPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPH 703 >UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/Metazoa group|Rep: Cytokinesis protein sepA - Emericella nidulans (Aspergillus nidulans) Length = 1790 Score = 39.9 bits (89), Expect = 0.11 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = +1 Query: 541 PPPXPXP---AXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P A P P P P G PPPP P GG P Sbjct: 1039 PPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGP 1083 Score = 37.5 bits (83), Expect = 0.59 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 4/57 (7%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPX----PXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP GA PPP P P P P P P G PPPP P G P Sbjct: 1042 PPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGGFGGPPP 1098 Score = 36.7 bits (81), Expect = 1.0 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP G PPP P P P P G PPPP P G P Sbjct: 1059 PPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPPPPPPPGGAFGVP 1111 >UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|Rep: Protein diaphanous - Drosophila melanogaster (Fruit fly) Length = 1091 Score = 39.9 bits (89), Expect = 0.11 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP G PPP P A P P P G PPPP P GG P Sbjct: 517 PPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPP 569 Score = 33.9 bits (74), Expect = 7.3 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP G PPP P P P P G PPPP P Sbjct: 529 PPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 >UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thaliana|Rep: Gb|AAD23008.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 1289 Score = 39.5 bits (88), Expect = 0.15 Identities = 32/137 (23%), Positives = 33/137 (24%), Gaps = 4/137 (2%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTPHXXXXXX 687 PP + PPP P P P P G PPPP P GG P Sbjct: 999 PPPPFSHVSSIPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMH 1058 Query: 688 XXXXXXXXXXXXXXXXXXXXXPXXG----XPPPXXRXLXPXXXXXXXXXXXXXXXXXXXX 855 P G PPP R P Sbjct: 1059 GGAPPPPPPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMH 1118 Query: 856 XXXXXPPPPXXRRGXXP 906 PPPP R G P Sbjct: 1119 GGAPPPPPPPMRGGAPP 1135 Score = 37.1 bits (82), Expect = 0.78 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 484 PXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXT 663 P G PP PPP P P P P G APPPP P G Sbjct: 977 PGYGSPPPPPPPPPSYGSPPPPPPPPFSHVSSIPPPPPPPPMHGGAPPPPPPPPMHGGAP 1036 Query: 664 P 666 P Sbjct: 1037 P 1037 Score = 37.1 bits (82), Expect = 0.78 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 5/58 (8%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSX-----GXAPPPPXPXXXGGXXTP 666 PP RG PPP A P P P P G APPPP P GG P Sbjct: 1079 PPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMHGGAPPPPPPPMRGGAPPP 1136 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P S G PPPP P G P Sbjct: 943 PPPPPPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPGYGSPPP 984 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP + PPP P P P P G PPPP P G P Sbjct: 945 PPPPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPGYGSPPPPPPPPPSYGSPPP 997 Score = 35.1 bits (77), Expect = 3.2 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP A PPP + P P P P S G PPPP P G P Sbjct: 924 PPFSNAHSVLSPPPPSYGSPPPPPPP-----PPSYGSPPPPPPPPPSYGSPPP 971 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP + PPP P P P P S G PPPP P Sbjct: 958 PPPPPPPSYGSPPPPPPPPPGYGSPPPPPPPPPSYGSPPPPPPP 1001 Score = 34.3 bits (75), Expect = 5.5 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 5/58 (8%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSX-----GXAPPPPXPXXXGGXXTP 666 PP RG PPP A P P P P G APPPP P G P Sbjct: 1091 PPMRGGAPPPPPPPMRGGAPPPPPPPMHGGAPPPPPPPMRGGAPPPPPPPGGRGPGAP 1148 Score = 33.9 bits (74), Expect = 7.3 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +1 Query: 493 GXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 G PP G PPP P P P P G PPPP G P Sbjct: 1132 GAPPPPPPPGGRGPGAPPPPPPPGGRAPGPPPPPGPRPPGGGPPPPPMLGARGAAVDP 1189 >UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_43, whole genome shotgun sequence - Paramecium tetraurelia Length = 1401 Score = 39.5 bits (88), Expect = 0.15 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPP-PPXPXXXGG 654 PP GA PPP P P P P P P G APP PP P GG Sbjct: 876 PPPPGAKTGSAPPPPPPPGGPRPPGP-----PPPPGGAPPLPPGPRPPGG 920 Score = 37.5 bits (83), Expect = 0.59 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 5/58 (8%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPX-----PXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP G+ PPP P P P P P P G PPPP P G P Sbjct: 813 PPPGGSKTLPRPPPPPPPPPPPGGKSAPPPPPPPPPPGGKGAPPPPPPPPPPGSKTGP 870 >UniRef50_O60879 Cluster: Protein diaphanous homolog 2; n=26; Eutheria|Rep: Protein diaphanous homolog 2 - Homo sapiens (Human) Length = 1101 Score = 39.5 bits (88), Expect = 0.15 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 2/60 (3%) Frame = +1 Query: 493 GXXXXPPXRGAXXFFFPPPXPXPAXPX--PXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 G PP G PPP P P P P P P G PPPP P GG P Sbjct: 550 GPPAAPPLPGVGP---PPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPP 606 >UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative lectin protein precursor - Emiliania huxleyi virus 86 Length = 1994 Score = 39.1 bits (87), Expect = 0.19 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P S +PPPP P Sbjct: 216 PPPSPAPPPPSPLPPPPLPPPPSPAPSPPPPPP 248 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 Query: 920 SPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPPG 1075 SP P PPP P P PPP PPP P PPG Sbjct: 489 SPPPPTPPPSPPPPPPSPPPSPFLPPPSLPPP--PPPSPPPPSAPPIPLPPG 538 Score = 33.5 bits (73), Expect = 9.7 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 P P P P P P P P PPPP P +P Sbjct: 202 PSPPPPPPSPFPPSPPPSPAPPPPSPLPPPPLPPPPSPAPSP 243 >UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox carteri|Rep: Pherophorin-S precursor - Volvox carteri Length = 599 Score = 39.1 bits (87), Expect = 0.19 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P PP Sbjct: 246 PPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 39.1 bits (87), Expect = 0.19 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P PP Sbjct: 250 PPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P S PPPP P Sbjct: 230 PPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPP 262 Score = 37.5 bits (83), Expect = 0.59 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P S PPPP P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 286 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXP-TXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P + PPP PPP P PP Sbjct: 218 PPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPP 271 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P PPPP P Sbjct: 245 PPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSP 277 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P PPPP P Sbjct: 269 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P S +PPPP P Sbjct: 226 PPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPP 258 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P+ PP Sbjct: 231 PPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPP--PPPPPPPPPPPSPPPPP 281 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 240 PPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPP 272 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 285 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 287 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 289 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 290 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 259 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 260 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 261 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 263 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 264 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 266 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 268 PPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXP 1069 P P P PPP P P PPP PPP P P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYP 305 >UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; Coccidioides immitis|Rep: Putative uncharacterized protein - Coccidioides immitis Length = 1705 Score = 39.1 bits (87), Expect = 0.19 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 4/57 (7%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPX----PXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP F PPP P P P P P P G APPPP P G P Sbjct: 983 PPPPPLPGFSGPPPPPPPPLPGFSGGPPPPPPPPLPGFSGGAPPPPPPPMPGAPIPP 1039 >UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to CG33556-PA - Strongylocentrotus purpuratus Length = 1472 Score = 38.7 bits (86), Expect = 0.26 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXX---PXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP GA PPP P P P P P P G PPPP P GG P Sbjct: 430 PPGVGAP----PPPPPPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFPGGVPPP 481 Score = 34.3 bits (75), Expect = 5.5 Identities = 22/82 (26%), Positives = 22/82 (26%), Gaps = 4/82 (4%) Frame = +1 Query: 541 PPPXPXP----AXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTPHXXXXXXXXXXXXX 708 PPP P P A P P P P PPPP P G P Sbjct: 424 PPPPPLPPGVGAPPPPPPPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFPGGVPPPPP 483 Query: 709 XXXXXXXXXXXXXXPXXGXPPP 774 P G PPP Sbjct: 484 LPGGAPPPPPPPPFPGGGVPPP 505 >UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; Chlamydomonadales|Rep: Pherophorin-C2 protein precursor - Chlamydomonas reinhardtii Length = 853 Score = 38.7 bits (86), Expect = 0.26 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P + PP Sbjct: 428 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 480 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P + PP Sbjct: 205 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP 257 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P+ PP Sbjct: 290 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 342 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P+ PP Sbjct: 396 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 448 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P + PP Sbjct: 505 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP 557 Score = 36.7 bits (81), Expect = 1.0 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P + PP Sbjct: 224 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP-PPPSPPPPSPPPPSPPP 275 Score = 36.7 bits (81), Expect = 1.0 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P+ PP Sbjct: 242 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP-PPPSPPPPPPPSPPPPP 293 Score = 36.7 bits (81), Expect = 1.0 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P+ PP Sbjct: 299 PPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP-PPPSPPPPPPPSPPPPP 350 Score = 36.7 bits (81), Expect = 1.0 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P+ PP Sbjct: 405 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP-PPPSPPPPPPPSPPPPP 456 Score = 36.7 bits (81), Expect = 1.0 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PP P P PPP PPP P + PP Sbjct: 433 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 485 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 218 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 250 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 223 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 255 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 228 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 260 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P+ PP Sbjct: 234 PPSPPPP-PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPP 285 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 241 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 273 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 246 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 278 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P PPPP P Sbjct: 255 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 287 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 275 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 307 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 293 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 325 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 298 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 330 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 311 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 343 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP--PXPPPXXXPAXAXPP 1072 P SP P PPP P P+ PP P PPP P + PP Sbjct: 312 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 366 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 332 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 364 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P+ PP Sbjct: 335 PPSPPPP-PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 386 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P+ PP Sbjct: 343 PPSPPPP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 394 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 355 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 387 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP--PXPPPXXXPAXAXPP 1072 P SP P PPP P P+ PP P PPP P + PP Sbjct: 356 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 410 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 376 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 408 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P + PP Sbjct: 379 PPSPPPP-PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 430 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 409 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 441 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP--PXPPPXXXPAXAXPP 1072 P SP P PPP P P+ PP P PPP P+ PP Sbjct: 410 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPP 464 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P PPPP P Sbjct: 428 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 460 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P PPPP P Sbjct: 436 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 468 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 446 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 478 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P+ PP Sbjct: 449 PPSPPPP-PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 500 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P+ PP Sbjct: 457 PPSPPPP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 508 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 469 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 501 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP--PXPPPXXXPAXAXPP 1072 P SP P PPP P P+ PP P PPP P + PP Sbjct: 470 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 524 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 490 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 522 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 518 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 550 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 523 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 555 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P + PP Sbjct: 260 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP---PPPSPPPPSPPPPSPPP 309 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P + PP Sbjct: 322 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP---PPPSPPPPSPPPPSPPP 371 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P + PP Sbjct: 366 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP---PPPSPPPPSPPPPSPPP 415 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P + PP Sbjct: 480 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP---PPPSPPPPSPPPPSPPP 529 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 213 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 245 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 257 PPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 289 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P+ PPP PPP P + PP Sbjct: 281 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSP-PPPSPPPPSPPPPSPPP 332 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 283 PPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSP 315 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/53 (32%), Positives = 20/53 (37%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P+P PPP P P+ PPP PPP P + PP Sbjct: 325 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP-PPPSPPPPSPPPPSPPP 376 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 350 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 382 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/53 (32%), Positives = 20/53 (37%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P+P PPP P P+ PPP PPP P + PP Sbjct: 369 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP-PPPSPPPPSPPPPSPPP 420 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P+ PPP PPP P + PP Sbjct: 374 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPP 425 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +2 Query: 914 PXSPTPXGPP-PXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PP P P P PPP PPP P+ PP Sbjct: 387 PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 440 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 404 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 436 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/53 (32%), Positives = 20/53 (37%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P+P PPP P P+ PPP PPP P + PP Sbjct: 439 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP-PPPSPPPPSPPPPSPPP 490 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 464 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 496 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/53 (32%), Positives = 20/53 (37%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P+P PPP P P+ PPP PPP P + PP Sbjct: 483 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP-PPPSPPPPSPPPPSPPP 534 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P+ PPP PPP P + PP Sbjct: 488 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPP 539 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 513 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 545 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/53 (30%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P+P P P P P PPP PPP P + PP Sbjct: 187 PGIPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 239 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P S PPP P Sbjct: 307 PPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 339 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P S PPP P Sbjct: 346 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 378 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P S PPP P Sbjct: 460 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 492 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P+P PPP P P PPP PPP P + PP Sbjct: 276 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP-PPPSPPPPSPPPPSPPP 327 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXS-XGXAPPPPXP 639 PPP P P+ P P P P S +PPPP P Sbjct: 390 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 423 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXS-XGXAPPPPXP 639 PPP P P+ P P P P S +PPPP P Sbjct: 504 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 537 Score = 33.9 bits (74), Expect = 7.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P P P P P P PPPP Sbjct: 264 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 294 Score = 33.9 bits (74), Expect = 7.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P P P P P P PPPP Sbjct: 321 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 351 Score = 33.9 bits (74), Expect = 7.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P P P P P P PPPP Sbjct: 365 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 395 Score = 33.9 bits (74), Expect = 7.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P P P P P P PPPP Sbjct: 419 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 449 Score = 33.9 bits (74), Expect = 7.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P P P P P P PPPP Sbjct: 479 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 509 Score = 33.9 bits (74), Expect = 7.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P P P P P P +PPPP Sbjct: 528 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 558 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P +PPPP P Sbjct: 237 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 268 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P +PPPP P Sbjct: 263 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 294 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P +PPPP P Sbjct: 281 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 312 Score = 33.5 bits (73), Expect = 9.7 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P +PPPP P Sbjct: 289 PPPPPPPSPPPPSPPPPSPPPPPP-PSPPPPSP 320 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P +PPPP P Sbjct: 320 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 351 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P +PPPP P Sbjct: 338 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 369 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P +PPPP P Sbjct: 364 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 395 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P +PPPP P Sbjct: 382 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 413 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P +PPPP P Sbjct: 418 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 449 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P +PPPP P Sbjct: 452 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 483 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P +PPPP P Sbjct: 478 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 509 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P +PPPP P Sbjct: 496 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 527 >UniRef50_A7RXK9 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 534 Score = 38.7 bits (86), Expect = 0.26 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +1 Query: 484 PXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 P PP G PPP P P P P P S G PPPP P Sbjct: 367 PPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 418 Score = 36.3 bits (80), Expect = 1.4 Identities = 23/69 (33%), Positives = 24/69 (34%) Frame = +1 Query: 460 RGXAXXXXPXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 RG A P PP + PPP A P P P G APPPP P Sbjct: 331 RGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSM--GMAPPPVGGAAPPPPPP 388 Query: 640 XXXGGXXTP 666 GG P Sbjct: 389 PPVGGPPPP 397 Score = 33.5 bits (73), Expect = 9.7 Identities = 27/97 (27%), Positives = 27/97 (27%) Frame = +1 Query: 484 PXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXT 663 P G PP RGA PPP A P P P G APPPP P Sbjct: 311 PSRGAAPPPPSRGAPP---PPPSRGSAPPPP--------PARMGTAPPPPPPSRSSQRPP 359 Query: 664 PHXXXXXXXXXXXXXXXXXXXXXXXXXXXPXXGXPPP 774 P P G PPP Sbjct: 360 PPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPP 396 >UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas vaginalis G3|Rep: Diaphanous, putative - Trichomonas vaginalis G3 Length = 620 Score = 38.7 bits (86), Expect = 0.26 Identities = 22/58 (37%), Positives = 23/58 (39%) Frame = +1 Query: 493 GXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 G PP GA PPP P P P P P + G PPPP P GG P Sbjct: 509 GVPPAPPLPGAGV---PPPPPPPGAGAPPPP----PPPAGGAPPPPPPPPPKGGAPPP 559 Score = 38.7 bits (86), Expect = 0.26 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = +1 Query: 484 PXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 P G PP GA PPP P PA P P P G APPPP P Sbjct: 517 PGAGVPPPPPPPGAGA---PPPPPPPAGGAPPPP---PPPPPKGGAPPPPPP 562 Score = 34.7 bits (76), Expect = 4.2 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPX-PXXXGGXXTP 666 PP G PPP P P P P P G PPP P GG P Sbjct: 537 PPPAGGAPPPPPPPPPKGGAPPPPPPPARAPPPPAGTPPPPAAAPAPAGGLVKP 590 >UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_77, whole genome shotgun sequence - Paramecium tetraurelia Length = 1215 Score = 38.7 bits (86), Expect = 0.26 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P+ P P S APPPP P GG P Sbjct: 676 PPPPPPPSRNGAPPPPPPPPPPSKTGAPPPPPPPRIGGAPPP 717 Score = 37.1 bits (82), Expect = 0.78 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P S APPPP P Sbjct: 647 PPPLPNTQVPPPPPPPPPPPPPSKNGAPPPPPP 679 Score = 35.1 bits (77), Expect = 3.2 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P G PPPP P G P Sbjct: 677 PPPPPPSRNGAPPPPPPPPPPSKTGAPPPPPPPRIGGAPPPP 718 Score = 34.3 bits (75), Expect = 5.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P G APPPP P Sbjct: 688 PPPPPPPPPPSKTGAPPPPPPPRIGGAPPPPPP 720 Score = 33.5 bits (73), Expect = 9.7 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +1 Query: 541 PPPXPXP---AXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P G PPPP P Sbjct: 645 PPPPPLPNTQVPPPPPPPPPPPPPSKNGAPPPPPPP 680 Score = 33.5 bits (73), Expect = 9.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P S APPPP P Sbjct: 661 PPPPPPPPSKNGAPPPPPPPPPSRNGAPPPPPP 693 >UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Rep: Zgc:162320 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 412 Score = 38.3 bits (85), Expect = 0.34 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P + G PPPP P GG P Sbjct: 168 PPPSAPPPAPASGPPPPPGPPPAPGPPPPPPPPPPSGGGAPP 209 Score = 37.5 bits (83), Expect = 0.59 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PPP P PA P P P P G P PP P GG Sbjct: 183 PPPGPPPA-PGPPPPPPPPPPSGGGAPPAPPPPSGGGG 219 >UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding protein; n=1; Magnetospirillum magneticum AMB-1|Rep: RTX toxins and related Ca2+-binding protein - Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) Length = 1274 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P APPPP P Sbjct: 285 PPPPPPPSPPAPAPPPPPPAPPPPPPAPPPPAP 317 Score = 37.1 bits (82), Expect = 0.78 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P + PPPP P Sbjct: 273 PPPPPPPPPPPPPPPPPPPSPPAPAPPPPPPAP 305 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 280 PPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAP 312 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P APPPP P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPSPPAPAPPPPPP 303 Score = 34.3 bits (75), Expect = 5.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P APPPP P Sbjct: 278 PPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPP 310 >UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter litoralis HTCC2594|Rep: Autotransporter - Erythrobacter litoralis (strain HTCC2594) Length = 1819 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P + APPPP P Sbjct: 1418 PPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPP 1450 Score = 37.9 bits (84), Expect = 0.45 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P P P + PPPP P G P Sbjct: 1422 PPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPISSGTGLFP 1463 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PPP P P P P P P PPPP P G Sbjct: 1421 PPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPISSG 1458 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 1409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTP 1441 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 1419 PPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPP 1451 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 920 SPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 +PT PPP P P PPP PPP P PP Sbjct: 1403 TPTGTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPP 1453 >UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing protein; n=2; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1139 Score = 38.3 bits (85), Expect = 0.34 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +1 Query: 511 PXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 P GA PPP P P P P + G PPPP P G P Sbjct: 577 PPPGAAGLVPPPPPPPPPGASLVPPPPPPPPGAAGLVPPPPPPPPGAGGIPP 628 Score = 35.9 bits (79), Expect = 1.8 Identities = 19/61 (31%), Positives = 20/61 (32%) Frame = +1 Query: 484 PXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXT 663 P G PP PPP P P P P + G PPPP P G Sbjct: 542 PPPGLVPPPPPPPPGASLVPPPPPPPPGAPGLVPSPP--PGAAGLVPPPPPPPPPGASLV 599 Query: 664 P 666 P Sbjct: 600 P 600 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXG 651 PP GA PPP P P P P G PPPP P G Sbjct: 591 PPPPGAS--LVPPPPPPPPGAAGLVPPPPPPPPGAGGIPPPPPPPGAG 636 Score = 35.1 bits (77), Expect = 3.2 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +1 Query: 484 PXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 P G PP G PP P P P P P + G PPPP Sbjct: 631 PPPGAGIPPPPPGVPGIPPPPGAPGLPPPPPGVPGIPPPPGAPGLPPPPP 680 Score = 33.5 bits (73), Expect = 9.7 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPA--XPXPXXPXXXXXPXSXGXAPPPP 633 PP GA PPP P P P P P + G PPPP Sbjct: 618 PPPPGAGGIPPPPPPPGAGIPPPPPGVPGIPPPPGAPGLPPPPP 661 >UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10 SCAF15019, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 579 Score = 37.9 bits (84), Expect = 0.45 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P P + G PPPP P G P Sbjct: 363 PPPPPPPGFLGPPPPPPPPLPGNTGAPPPPPPPPPLPGGGPP 404 Score = 37.1 bits (82), Expect = 0.78 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P P G PPPP P G P Sbjct: 393 PPPPPLPGGGPPPPPPPPPPPGLPGAGPPPPPPPPGCGPPPP 434 Score = 33.5 bits (73), Expect = 9.7 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PP G PPP P P P P G PPPP P G Sbjct: 366 PPPPGFLGPPPPPPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPPPPPPG 414 >UniRef50_Q89X06 Cluster: Blr0521 protein; n=7; Bradyrhizobiaceae|Rep: Blr0521 protein - Bradyrhizobium japonicum Length = 745 Score = 37.9 bits (84), Expect = 0.45 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 484 PXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXT 663 P PP A PPP P PA P P P PPPP P T Sbjct: 90 PRPAAPPPPPPPPAARPAPPPPPPPPAAPKQPSPPPAAAPQQHAPTPPPPAPPAARPAPT 149 Query: 664 P 666 P Sbjct: 150 P 150 >UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherophorin - Volvox carteri f. nagariensis Length = 606 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P+ PP Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 257 Score = 37.5 bits (83), Expect = 0.59 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P S PPPP P Sbjct: 206 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPP 238 Score = 37.5 bits (83), Expect = 0.59 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P S PPPP P Sbjct: 218 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPP 250 Score = 37.5 bits (83), Expect = 0.59 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P S PPPP P Sbjct: 230 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSP 262 Score = 37.1 bits (82), Expect = 0.78 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 237 PPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPP 269 Score = 36.7 bits (81), Expect = 1.0 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P+P PPP P P PP PPP P A PP Sbjct: 236 PPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAPPP 288 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P PPPP P Sbjct: 209 PPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 241 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P PPPP P Sbjct: 221 PPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 253 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P PP Sbjct: 214 PPSPPPP-PPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPP 265 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 P P P P P P P P S PPPP P Sbjct: 239 PSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSP 271 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P S PPPP P Sbjct: 248 PPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPP 280 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P P P P P+ PPP PPP P PP Sbjct: 207 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 259 Score = 33.9 bits (74), Expect = 7.3 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P +PPPP P Sbjct: 246 PPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPP 278 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P PPPP P Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 236 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P PPPP P Sbjct: 217 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 248 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P PPPP P Sbjct: 229 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 >UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1027 Score = 37.9 bits (84), Expect = 0.45 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 532 FFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXG 651 F+F P P P P P P G APPPP P G Sbjct: 411 FYFSGPPPPPPPPGGVPPPPPPPPPGMGGAPPPPPPPPPG 450 Score = 37.5 bits (83), Expect = 0.59 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP G PPP P P P P G PPPP P GG P Sbjct: 434 PPGMGGAP---PPPPPPPPGMGGGPPPPPPPPPGPGGGPPPPPPPPGGGPPGP 483 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP G PPP P P P P G PPPP P G P Sbjct: 432 PPPPGMGGAPPPPPPPPPGMGGGPPPPPPPPPGPGGGPPPPPPPPGGGPPGPP 484 Score = 34.7 bits (76), Expect = 4.2 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +1 Query: 493 GXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 G PP G PPP P P P P G PPPP P G P Sbjct: 415 GPPPPPPPPGGVP---PPPPPPPPGMGGAPPPPPPPPPGMGGGPPPPPPPPPGPGGGP 469 Score = 34.3 bits (75), Expect = 5.5 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P G PPPP P G P Sbjct: 429 PPPPPPPGMGGAPPPPPPPPPGMGGGPPPPPPPPPGPGGGPP 470 Score = 33.5 bits (73), Expect = 9.7 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P G PPPP P GG P Sbjct: 430 PPPPPPGMGGAPPPPPPPPPGMGGGPPPPPPPPPGPGGGPPP 471 >UniRef50_Q5AL62 Cluster: Putative uncharacterized protein; n=1; Candida albicans|Rep: Putative uncharacterized protein - Candida albicans (Yeast) Length = 115 Score = 37.9 bits (84), Expect = 0.45 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 532 FFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 F PPP P P P P P P S PPPP P Sbjct: 13 FQIPPPPPPPPQPPPPPPQPPPPPPSLLPQPPPPPP 48 >UniRef50_Q64467 Cluster: Glyceraldehyde-3-phosphate dehydrogenase, testis-specific; n=287; cellular organisms|Rep: Glyceraldehyde-3-phosphate dehydrogenase, testis-specific - Mus musculus (Mouse) Length = 440 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P APPPP P Sbjct: 57 PPPPPPPPPPPPPPPPPQIEPDKFEEAPPPPPP 89 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPA 1057 P P P PPP P P PPP PPP PA Sbjct: 58 PPPPPPPPPPPPPPPPQIEPDKFEEAPPPPPPPPPPPPPPPPPLQKPA 105 >UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 precursor; n=2; Chlamydomonas reinhardtii|Rep: Hydroxyproline-rich glycoprotein GAS31 precursor - Chlamydomonas reinhardtii Length = 647 Score = 37.5 bits (83), Expect = 0.59 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P S PPPP P Sbjct: 243 PPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 275 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 241 PPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPP 273 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 247 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 279 Score = 33.5 bits (73), Expect = 9.7 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 920 SPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 SP+P PPP P P PPP PPP PP Sbjct: 236 SPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPP 286 >UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C5 protein precursor - Chlamydomonas reinhardtii Length = 541 Score = 37.5 bits (83), Expect = 0.59 Identities = 18/53 (33%), Positives = 20/53 (37%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P+ PPP PPP P + PP Sbjct: 188 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSP-PPPSPPPPSPPPPSPPP 239 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P PPPP P Sbjct: 183 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 215 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P + PP Sbjct: 206 PPSPPPP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP 257 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 218 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 250 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 223 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 255 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 177 PPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSP 209 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P+ PPP PPP P + PP Sbjct: 183 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP-PPPSPPPPSPPPPSPPP 234 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 185 PPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 217 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 213 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 245 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P S PPP P Sbjct: 209 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 241 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P+P PPP P P PPP PPP P + PP Sbjct: 178 PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP-PPPSPPPPSPPPPSPPP 229 Score = 34.3 bits (75), Expect = 5.5 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P+ PPP PPP P PP Sbjct: 175 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPS--PPPPPPPSPPPPSPPPP 225 Score = 33.9 bits (74), Expect = 7.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P P P P P P +PPPP Sbjct: 228 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 258 Score = 33.5 bits (73), Expect = 9.7 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 P RGA PPP P P+ P P P P +PPPP P Sbjct: 168 PVTRGAS----PPPPPPPS-PPPPPPPSPPPPSPPPPSPPPPPP 206 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P +PPPP P Sbjct: 191 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSP 222 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P +PPPP P Sbjct: 196 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 227 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P +PPPP P Sbjct: 201 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 232 >UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family; n=2; Ostreococcus tauri|Rep: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family - Ostreococcus tauri Length = 872 Score = 37.5 bits (83), Expect = 0.59 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P SP+P PP P P+ PP P PPP P + PPG A Sbjct: 502 PPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSA 558 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/53 (30%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P+ PPP PPP P + PP Sbjct: 545 PSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPP 597 Score = 35.9 bits (79), Expect = 1.8 Identities = 17/58 (29%), Positives = 19/58 (32%) Frame = +2 Query: 899 GXXXXPXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 G P SP P PPP P P+ PP PPP + PP Sbjct: 556 GSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPPPPVVVVPSSPP 613 Score = 35.5 bits (78), Expect = 2.4 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P+ P P P S +PPPP G P Sbjct: 520 PPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARP 561 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P S +PPPP P Sbjct: 501 PPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSP 533 Score = 33.9 bits (74), Expect = 7.3 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP A PPP P P P P P P PP P P Sbjct: 554 PPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPP 597 >UniRef50_A7DWG3 Cluster: Cell wall glycoprotein GP2; n=4; Chlamydomonas reinhardtii|Rep: Cell wall glycoprotein GP2 - Chlamydomonas reinhardtii Length = 1226 Score = 37.5 bits (83), Expect = 0.59 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P PTP PPP P P PPP PPP P + PP Sbjct: 954 PPPPTPPSPPPPSPPPPVLSPPPSPPPPSPPPPA-PPPPSPPPPVPPPPSPPP 1005 Score = 35.5 bits (78), Expect = 2.4 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P+ PP PPP PA A PP Sbjct: 975 PPSPPPPSPPPPAPPPPSPPPPVPPP------PSPPPPSPPPPSPPPAAASPP 1021 Score = 35.1 bits (77), Expect = 3.2 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 4/60 (6%) Frame = +2 Query: 914 PXSPTPXGPPPXX----PXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPPGXA 1081 P SP P PPP P P PPP PPP P + PP A Sbjct: 959 PPSPPPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAA 1018 Score = 33.9 bits (74), Expect = 7.3 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP PPP P P P P P P P PP P Sbjct: 963 PPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPP 1006 Score = 33.9 bits (74), Expect = 7.3 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P + PP P P Sbjct: 994 PPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPP 1026 >UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyostelium discoideum|Rep: Formin homology protein A - Dictyostelium discoideum (Slime mold) Length = 1218 Score = 37.5 bits (83), Expect = 0.59 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P G PPPP P GG P Sbjct: 679 PPPPPPPPMTGGGPPPPPPPPPMTGGGPPPPPPPPGGGPPPP 720 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P G PPPP P G P Sbjct: 692 PPPPPPPPPMTGGGPPPPPPPPGGGPPPPPPPPGAKAGGPPP 733 Score = 34.3 bits (75), Expect = 5.5 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P G PPPP P GG P Sbjct: 667 PPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPPMTGGGPPP 708 Score = 34.3 bits (75), Expect = 5.5 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P + G PPPP P G P Sbjct: 680 PPPPPPPMTGGGPPPPPPPPPMTGGGPPPPPPPPGGGPPPPP 721 >UniRef50_Q7PMA5 Cluster: ENSANGP00000031515; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000031515 - Anopheles gambiae str. PEST Length = 235 Score = 37.5 bits (83), Expect = 0.59 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPPG 1075 P P P PPP P T PPP PPP P PPG Sbjct: 113 PLIPPPPPPPPPPPPLLPAPEPLLFAPPAIDPLTPPPPPPPPPLLPPPPPPPPG 166 >UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 620 Score = 37.5 bits (83), Expect = 0.59 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P S PPPP P Sbjct: 432 PPPPPPPPCPVPCPPPPPPPPPSPPPPPPPPCP 464 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 421 PPPCPVPCPPPPPPPPPPPCPVPCPPPPPPPPP 453 >UniRef50_A2G6R9 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 420 Score = 37.5 bits (83), Expect = 0.59 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PP P A P P P P S G APPPP P GG Sbjct: 319 PPAPAAAAPPPPPPPL---PKSTGSAPPPPPPSGGGG 352 >UniRef50_Q95JC9 Cluster: Basic proline-rich protein precursor [Contains: Proline-rich peptide SP-A (PRP-SP-A); Proline-rich peptide SP-B (PRP-SP-B); Parotid hormone (PH-Ab)]; n=10; Eukaryota|Rep: Basic proline-rich protein precursor [Contains: Proline-rich peptide SP-A (PRP-SP-A); Proline-rich peptide SP-B (PRP-SP-B); Parotid hormone (PH-Ab)] - Sus scrofa (Pig) Length = 676 Score = 37.5 bits (83), Expect = 0.59 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +1 Query: 484 PXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXT 663 P G P GA PPP P P P P P P PPPP P G Sbjct: 64 PGDGPEQGPAPPGARPPPGPPP-PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 122 Query: 664 P 666 P Sbjct: 123 P 123 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P P P GPPP P P PP PPP P PPG A Sbjct: 80 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 136 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P P P GPPP P P PP PPP P PPG A Sbjct: 101 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 157 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P P P GPPP P P PP PPP P PPG A Sbjct: 122 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 178 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P P P GPPP P P PP PPP P PPG A Sbjct: 143 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 199 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P P P GPPP P P PP PPP P PPG A Sbjct: 164 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 220 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P P P GPPP P P PP PPP P PPG A Sbjct: 185 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 241 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P P P GPPP P P PP PPP P PPG A Sbjct: 206 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPLGPPPPGPA 262 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P P P GPPP P P PP PPP P PPG A Sbjct: 227 PPGPPPPGPPPPGPAPPGARPPPGPPPLGPPPPGPAPPGARPPPGPPPPGPPPPGPA 283 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P P P GPPP P P PP PPP P PPG A Sbjct: 248 PPGPPPLGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 304 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P P P GPPP P P PP PPP P PPG A Sbjct: 269 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 325 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P P P GPPP P P PP PPP P PPG A Sbjct: 290 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 346 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P P P GPPP P P PP PPP P PPG A Sbjct: 311 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 367 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P P P GPPP P P PP PPP P PPG A Sbjct: 332 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 388 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P P P GPPP P P PP PPP P PPG A Sbjct: 353 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 409 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P P P GPPP P P PP PPP P PPG A Sbjct: 465 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 521 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P P P GPPP P P PP PPP P PPG A Sbjct: 486 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 542 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P P P GPPP P P PP PPP P PPG A Sbjct: 507 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 563 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P P P GPPP P P PP PPP P PPG A Sbjct: 528 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 584 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P P P GPPP P P PP PPP P PPG A Sbjct: 549 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 605 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P P P GPPP P P PP PPP P PPG A Sbjct: 570 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 626 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP-PXPPPXXXPAXAXPPGXA 1081 P P P GPPP P P PP PPP P PPG A Sbjct: 591 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 647 Score = 36.3 bits (80), Expect = 1.4 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP A PPP P P P P P G PPPP P Sbjct: 621 PPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPPPGP 664 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 104 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 144 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 125 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 165 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 146 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 186 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 167 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 207 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 188 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 228 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 209 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 249 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 230 PPPPGPPPPGPAPPGARPPPGPPPLGPPPPGPAPPGARPPP 270 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 272 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 312 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 293 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 333 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 314 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 354 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 335 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 375 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 356 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 396 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 377 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 417 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 447 PPPPGPPSPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 487 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 468 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 508 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 489 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 529 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 510 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 550 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 531 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 571 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 552 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 592 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 573 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 613 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 594 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 634 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PPPP P G P Sbjct: 615 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 655 Score = 33.9 bits (74), Expect = 7.3 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPX---PAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP A PPP P P P P P P PPPP P G P Sbjct: 236 PPPGPAPPGARPPPGPPPLGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 291 >UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Human herpesvirus 4|Rep: Epstein-Barr nuclear antigen 2 - Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) Length = 487 Score = 37.5 bits (83), Expect = 0.59 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P S PPPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 99 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPP 95 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 97 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 96 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 98 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 100 >UniRef50_UPI0000F1EA7E Cluster: PREDICTED: similar to LOC495114 protein; n=2; Danio rerio|Rep: PREDICTED: similar to LOC495114 protein - Danio rerio Length = 904 Score = 37.1 bits (82), Expect = 0.78 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 4/57 (7%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPX----PXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP G PPP P P P P P P G A PPP P GG P Sbjct: 308 PPVPGLGSAPPPPPPPPPPGPAGLFSPPPPPPPPPPGFAGLASPPPPPPPPGGLSIP 364 >UniRef50_Q1IA36 Cluster: Insecticidal toxin, SepC/Tcc class; n=1; Pseudomonas entomophila L48|Rep: Insecticidal toxin, SepC/Tcc class - Pseudomonas entomophila (strain L48) Length = 990 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXG 651 PP PPP P P P P P G PPPP P G Sbjct: 704 PPPPSGMRLPPPPPPPGMGTPPPPPPGMGLPPPPPGLRPPPPGPGASG 751 >UniRef50_A4T9C9 Cluster: Integral membrane protein-like protein; n=1; Mycobacterium gilvum PYR-GCK|Rep: Integral membrane protein-like protein - Mycobacterium gilvum PYR-GCK Length = 335 Score = 37.1 bits (82), Expect = 0.78 Identities = 21/61 (34%), Positives = 22/61 (36%) Frame = +1 Query: 484 PXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXT 663 P G PP G +PPP P P P P G PPPP P GG Sbjct: 14 PQGGYPPPPPSEGG----YPPPPPEGGYPPPPPAGGYQQPPPGGAYPPPPGP---GGYPP 66 Query: 664 P 666 P Sbjct: 67 P 67 >UniRef50_Q9FW12 Cluster: Putative proteophosphoglycan; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative proteophosphoglycan - Oryza sativa subsp. japonica (Rice) Length = 742 Score = 37.1 bits (82), Expect = 0.78 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P G A PPP P Sbjct: 27 PPPPPHPPPPPPLEPAPPSTPQLRGEASPPPPP 59 >UniRef50_Q7XCX5 Cluster: Plus-3 domain containing protein, expressed; n=7; Magnoliophyta|Rep: Plus-3 domain containing protein, expressed - Oryza sativa subsp. japonica (Rice) Length = 1706 Score = 37.1 bits (82), Expect = 0.78 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P G A PPP P Sbjct: 27 PPPPPHPPPPPPLEPAPPSTPQLRGEASPPPPP 59 >UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C3 protein precursor - Chlamydomonas reinhardtii Length = 443 Score = 37.1 bits (82), Expect = 0.78 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P +PPPP P Sbjct: 235 PPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSP 267 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 225 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 257 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 226 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 258 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 227 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 259 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 230 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSP 262 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP R PP P P P P P P PPPP P Sbjct: 213 PPFRDRPVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 256 Score = 33.5 bits (73), Expect = 9.7 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +2 Query: 920 SPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 SP+P PPP P P PPP PPP P PP Sbjct: 222 SPSP--PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPP 270 Score = 33.5 bits (73), Expect = 9.7 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PPP P P P P P P PP P P G Sbjct: 237 PPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKG 274 >UniRef50_A4S1Y9 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 1065 Score = 37.1 bits (82), Expect = 0.78 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPPGXA 1081 P SP P PPP P P PPP PPP P+ PP A Sbjct: 525 PPSPPP-SPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPPPHFA 579 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = +2 Query: 920 SPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 +PTP PPP P P PPP PPP P+ PP Sbjct: 476 TPTP-SPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPP 525 >UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba histolytica|Rep: Diaphanous protein - Entamoeba histolytica Length = 1209 Score = 37.1 bits (82), Expect = 0.78 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAX--PXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP GA PPP P + P P P P G PPPP P G P Sbjct: 589 PPPPGASSIPPPPPPPGASSVPPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPPPP 643 Score = 35.9 bits (79), Expect = 1.8 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 4/57 (7%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXP----XPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP GA PPP P P P P P P G PPPP P G P Sbjct: 601 PPPPGASSV--PPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPP 655 >UniRef50_A7S5P1 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1254 Score = 37.1 bits (82), Expect = 0.78 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTPH 669 PPP P P P P S G PPPP P G + H Sbjct: 511 PPPPPPPGGSVPPPPPLPGGTCSSGPPPPPPPPTSIGPKPSGH 553 >UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_31, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 37.1 bits (82), Expect = 0.78 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P P G PPP P GG P Sbjct: 330 PPPPPPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLPGGARPP 371 Score = 34.3 bits (75), Expect = 5.5 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P P PPPP P G P Sbjct: 317 PPPLPNSQAPPPPPPPPPPPPIPGQQNPPPPPPPPLPGQQAP 358 Score = 34.3 bits (75), Expect = 5.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P P G PPPP P G P Sbjct: 344 PPPPPPPPLPGQQAP-PPPPPLPGGARPPPPPPPPFGNAPPP 384 >UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 37.1 bits (82), Expect = 0.78 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP A PPP P P P P P P PPPP P Sbjct: 273 PPAPSAKGGAPPPPPPPPPPPPPPPPPPKGVPPPPRGPPPPPPP 316 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PPP P P P P P P G PPPP G Sbjct: 285 PPPPPPPPPPPPPPPPKGVPPPPRGPPPPPPPKAPISG 322 >UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1; Solanum tuberosum|Rep: Chitin-binding lectin 1 precursor - Solanum tuberosum (Potato) Length = 323 Score = 37.1 bits (82), Expect = 0.78 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P +PPPP P Sbjct: 174 PPPPPPPSPPPPSPPPPSPSPPPPPASPPPPPP 206 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 155 PPPPPSPPPPSPPSPPPPSPPPPPPPSPPPPSP 187 Score = 33.9 bits (74), Expect = 7.3 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPPGXA 1081 P P P PPP P P+ PPP P P PA PP A Sbjct: 153 PPPPPPPSPPPPSPPSPPPPSPPPPPPPSPPPPSP-PPPSPSPPPPPASPPPPPPA 207 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P +PPPP P Sbjct: 161 PPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSP 192 >UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi|Rep: formin-like 2 - Xenopus tropicalis Length = 1054 Score = 36.7 bits (81), Expect = 1.0 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P + PPPP P Sbjct: 534 PPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPP 566 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P P P PPPP G +P Sbjct: 538 PPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAPPLPGSASP 579 >UniRef50_Q4SE62 Cluster: Chromosome undetermined SCAF14625, whole genome shotgun sequence; n=7; Euteleostomi|Rep: Chromosome undetermined SCAF14625, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 496 Score = 36.7 bits (81), Expect = 1.0 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP RG PPP P PA P + APPPP P G P Sbjct: 280 PPGRGGAP---PPPPPPPARGSRGAPPPPPPSRAPASAPPPPPPTRPGSLGAP 329 Score = 34.7 bits (76), Expect = 4.2 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PP RG+ PPP P A P P S G PPPP P GG Sbjct: 293 PPARGSRGAP-PPPPPSRAPASAPPPPPPTRPGSLGA-PPPPPPTTRGG 339 >UniRef50_Q6N0Q5 Cluster: Putative uncharacterized protein precursor; n=2; Rhodopseudomonas palustris|Rep: Putative uncharacterized protein precursor - Rhodopseudomonas palustris Length = 225 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P S APPPP P G +P Sbjct: 92 PPPPPPTPPPPPQQSPAGPPASSQTAPPPPPPPIGGRPPSP 132 >UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel domain; n=1; Sinorhizobium medicae WSM419|Rep: Outer membrane autotransporter barrel domain - Sinorhizobium medicae WSM419 Length = 864 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXG 651 PPP P P P P P P PPPP P G Sbjct: 499 PPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPG 535 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 486 PPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPP 518 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 488 PPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPP 520 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P PPPP P Sbjct: 497 PPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPP 529 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 Query: 920 SPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPPG 1075 SP P PPP P P PPP PPP P PPG Sbjct: 485 SPPPP-PPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPG 535 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 487 PPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPP 519 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 489 PPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPP 521 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 491 PPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPP 523 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 494 PPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPP 526 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 496 PPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPP 528 Score = 35.1 bits (77), Expect = 3.2 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = +2 Query: 899 GXXXXPXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXP 1069 G P P P PPP P P PPP PPP P P Sbjct: 482 GGVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSP 538 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXP 1069 P P P PPP P P PPP PPP P+ P Sbjct: 490 PPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITP 541 Score = 34.3 bits (75), Expect = 5.5 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P P Sbjct: 486 PPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSP 538 Score = 34.3 bits (75), Expect = 5.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P S PPPP P Sbjct: 490 PPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPP 522 Score = 34.3 bits (75), Expect = 5.5 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P P PPPP P TP Sbjct: 500 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITP 541 >UniRef50_Q69MT2 Cluster: Diaphanous protein-like; n=3; Oryza sativa|Rep: Diaphanous protein-like - Oryza sativa subsp. japonica (Rice) Length = 788 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PPP P P P P P APPPP P G Sbjct: 265 PPPPPPPPPPPPMPPRTDNASTQAAPAPPPPLPRAGNG 302 >UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b; n=6; cellular organisms|Rep: Cytokinesis defect protein 1, isoform b - Caenorhabditis elegans Length = 1437 Score = 36.7 bits (81), Expect = 1.0 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 2/59 (3%) Frame = +1 Query: 484 PXXGXXXXPPXRGAXXFFF--PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 P G PP G PPP P P P P G PPPP P GG Sbjct: 721 PITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGG 779 >UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_104, whole genome shotgun sequence - Paramecium tetraurelia Length = 1152 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P A P P P G PPPP P G P Sbjct: 633 PPPPPMKAGPPPPPPPPGVPRPPGGPPPPPPPPGSKAGGPPP 674 Score = 33.9 bits (74), Expect = 7.3 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +1 Query: 541 PPPXPXPAXPXPXX--PXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P S PPPP P Sbjct: 643 PPPPPPPGVPRPPGGPPPPPPPPGSKAGGPPPPPP 677 Score = 33.5 bits (73), Expect = 9.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P APPPP P Sbjct: 603 PPPPPPPPPPVKSAPLPPPPPPPKIAAPPPPPP 635 >UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 349 Score = 36.7 bits (81), Expect = 1.0 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 920 SPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 SP P PPP P P PPP PPP P PP Sbjct: 28 SPPPPPPPPPPPAPRVAGFSYPQTFMASPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 923 PTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P PPP P P PPP PPP P PP Sbjct: 31 PPPPPPPPPAPRVAGFSYPQTFMASPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 33.9 bits (74), Expect = 7.3 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 532 FFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 F PP P P P P P P PPPP P Sbjct: 52 FMASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 33.5 bits (73), Expect = 9.7 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P PPP P P PPP PPP P PP Sbjct: 25 PGFSPPPPPPPPPPPAPRVAGFSYPQTFMASPPPPPPPPPPPPPPPPPPPPPP 77 Score = 33.5 bits (73), Expect = 9.7 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P PPP PPP P PP Sbjct: 29 PPPPPPPPPPPAPRVAGFSYPQTFMASPPPPPPPPPPPPPPPPPPPPPPPPPP 81 >UniRef50_Q9NZ56 Cluster: Formin-2; n=13; Eumetazoa|Rep: Formin-2 - Homo sapiens (Human) Length = 1865 Score = 36.7 bits (81), Expect = 1.0 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +1 Query: 484 PXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 P G PP GA PPP P P P P P G PPP P Sbjct: 1334 PGVGIPPPPPLPGAG---IPPPPPLPGMGIPPAPAPPLPPPGTGIPPPPLLP 1382 >UniRef50_Q9DEH3 Cluster: Diaphanous homologue; n=13; Eumetazoa|Rep: Diaphanous homologue - Gallus gallus (Chicken) Length = 1253 Score = 36.3 bits (80), Expect = 1.4 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP G PPP P P P P P G PPPP P GG P Sbjct: 703 PPLPGGAAAVLPPPPPLPGGTIPPPP-----PLFGGAVPPPP-PLPGGGAGPP 749 >UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burkholderia|Rep: Hemagglutinin domain protein - Burkholderia mallei (Pseudomonas mallei) Length = 373 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 92 PPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSP 124 Score = 33.5 bits (73), Expect = 9.7 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P P P P PP P TP Sbjct: 95 PPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTP 136 >UniRef50_Q948Y7 Cluster: VMP3 protein; n=1; Volvox carteri f. nagariensis|Rep: VMP3 protein - Volvox carteri f. nagariensis Length = 687 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P + PP Sbjct: 594 PPSPPPPSPPPPNPPPPSPPPPNPPPPSPP--PPSPPPPSPPPPNPPPPSPPP 644 Score = 35.9 bits (79), Expect = 1.8 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P PP Sbjct: 624 PPSPPPPSPPPPNPPPPSPPPPSPRPPTPP--PPSPPPPRPPPRPPPTRRSPP 674 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/53 (30%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P+P P P P P PPP PPP P + PP Sbjct: 572 PDPPSPNPPSPDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPP 624 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/53 (30%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P+P P P P P PPP PPP P + PP Sbjct: 577 PNPPSPDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPP 629 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPPGXA 1081 P SP P PPP P P PP P P P PP A Sbjct: 509 PPSPRPPNPPPRPPSPRPPPRPPPRPSSPRPPPPDPSPPPPSPPSPPTSPSPPDPA 564 >UniRef50_Q1EP07 Cluster: Putative uncharacterized protein; n=1; Musa acuminata|Rep: Putative uncharacterized protein - Musa acuminata (Banana) Length = 390 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P P P P P P G PPPP Sbjct: 169 PPPEPAPPTPEPPPPPGPEPPPPPGPEPPPP 199 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 188 PPPPPGPEPPPPPAPEPPPPPAPEPPPPPPPKP 220 Score = 33.9 bits (74), Expect = 7.3 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +1 Query: 541 PPPXPXPAXPXP-XXPXXXXXPXSXGXAPPPP 633 PPP P PA P P P P G PPPP Sbjct: 160 PPPEPEPAPPPPEPAPPTPEPPPPPGPEPPPP 191 Score = 33.9 bits (74), Expect = 7.3 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP A PPP P P P P P P PP P P Sbjct: 169 PPPEPAPPTPEPPPPPGPEPPPPPGPEPPPPPAPEPPPPPAPEP 212 >UniRef50_Q00X46 Cluster: Chromosome 13 contig 1, DNA sequence; n=5; root|Rep: Chromosome 13 contig 1, DNA sequence - Ostreococcus tauri Length = 1990 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SPTP PPP P P+ PP PPP P A PP Sbjct: 803 PPSPTPPLPPPPSPFPPPSPSPSPPPPSPPP-PSPPPPSPPPPSPFPPPAPPP 854 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +1 Query: 538 FPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 FPPP P P+ P P P P S PPPP P Sbjct: 817 FPPPSPSPSPPPPSPPPPSPPPPS----PPPPSP 846 Score = 34.3 bits (75), Expect = 5.5 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P+ PPP P P P PP Sbjct: 782 PPSPPPPNPPPLPSPPPPSPPPPSPTPPLPPPPSPFPPPSPSPSPPPPSPPPP 834 Score = 34.3 bits (75), Expect = 5.5 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P S +PPPP P Sbjct: 802 PPPSPTPPLPPPPSP---FPPPSPSPSPPPPSP 831 >UniRef50_Q00TD0 Cluster: Chromosome 17 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 17 contig 1, DNA sequence - Ostreococcus tauri Length = 281 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 114 PPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSP 146 >UniRef50_A4S9A6 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 4076 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P + PP Sbjct: 2072 PPSPPPPSPPPSPPPPSPPPPSPPPPPSPP--PPSPPPPSPPPPSPPPPSPPP 2122 Score = 35.5 bits (78), Expect = 2.4 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PPP P P P P P S +PPPP P G Sbjct: 88 PPPPPSPPPPPSPPPPPSPPPPSPPPSPPPPSPPPPPG 125 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P + PP Sbjct: 2077 PPSPPPSPPPPSPPPPSPPPPPSPPPPSPP--PPSPPPPSPPPPSPPPPSPPP 2127 Score = 34.3 bits (75), Expect = 5.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P S P PP P Sbjct: 2071 PPPSPPPPSPPPSPPPPSPPPPSPPPPPSPPPP 2103 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P +PPPP P Sbjct: 2084 PPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSP 2115 >UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1074 Score = 36.3 bits (80), Expect = 1.4 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 541 PPPXPXPAXPX-----PXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PPP P P P P P P S G APPPP P G Sbjct: 569 PPPSPSPPPPISGGGAPPPPPPPPPPPSGGGAPPPPPPPPPSG 611 >UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila melanogaster|Rep: Protein cappuccino - Drosophila melanogaster (Fruit fly) Length = 1059 Score = 36.3 bits (80), Expect = 1.4 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 8/61 (13%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXX-------PXXXXXPXSXGXAPPPPXP-XXXGGXXT 663 PP F PPP P P P P P P G APPPP P GG Sbjct: 489 PPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGI 548 Query: 664 P 666 P Sbjct: 549 P 549 Score = 33.9 bits (74), Expect = 7.3 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP F PP P P P P P + G PPPP P G P Sbjct: 488 PPPPPPLHAFVAPPPPPPPPPPPPPPL-----ANYGAPPPPPPPPPGSGSAPP 535 >UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein cappuccino; n=1; Apis mellifera|Rep: PREDICTED: similar to Protein cappuccino - Apis mellifera Length = 1007 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P G PPPP P Sbjct: 458 PPPPPPPPPPPPPPPPTQSSAAGGGPPPPPPPP 490 >UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; Danio rerio|Rep: Putative uncharacterized protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 428 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP G PPP P P P P + G PPPP P Sbjct: 325 PPPPGNMGVLPPPPPPRPGNMGVPPPPPPPPPGNMGVPPPPPPP 368 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP G PPP P P P + APPPP P GG P Sbjct: 367 PPPPGNMCIPPPPPPPPGYTGSSLPPPAPPPPQNASMAPPPPPPPPLGGKFLP 419 Score = 33.9 bits (74), Expect = 7.3 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP G PP P P P P + G PPPP P Sbjct: 297 PPPPGTNTTMTAPPPPPPPGNMSVPPPPPPPPGNMGVLPPPPPP 340 >UniRef50_A4FGR9 Cluster: Putative uncharacterized protein; n=1; Saccharopolyspora erythraea NRRL 2338|Rep: Putative uncharacterized protein - Saccharopolyspora erythraea (strain NRRL 23338) Length = 373 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PPP P P P P P P PPPP P G Sbjct: 264 PPPPPPPPTPEPVPPPPIPPPPPVPAPPPPPEPAPVPG 301 >UniRef50_Q9MAV4 Cluster: F24O1.6; n=10; cellular organisms|Rep: F24O1.6 - Arabidopsis thaliana (Mouse-ear cress) Length = 70 Score = 35.9 bits (79), Expect = 1.8 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP R F PPP P P P P P P G PPPP P Sbjct: 5 PPHRHPPPFHHPPP-PRPPPPEPRPP-----PPPPGPQPPPPPP 42 >UniRef50_Q9FXA1 Cluster: F14J22.4 protein; n=2; Arabidopsis thaliana|Rep: F14J22.4 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 494 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P P P P P P S +PPPP Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPP 92 >UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 2146 Score = 35.9 bits (79), Expect = 1.8 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 520 GAXXFFFPPPXPXPAXPXPXXPXXXXXPXS-XGXAPPPPXP 639 G F PPP P P P P P P S +PPPP P Sbjct: 873 GLSCFPSPPPSPPPPSPPPPSPLPSPPPPSPPSPSPPPPSP 913 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P S PPPP P Sbjct: 930 PPSPPPPPPVPSPPPPSPPPPSPPPLPPPPPP 961 Score = 33.9 bits (74), Expect = 7.3 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXS---XGXAPPPPXP 639 PPP P P+ P P P P S +PPPP P Sbjct: 890 PPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSP 925 >UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein; n=2; Dictyostelium discoideum|Rep: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein - Dictyostelium discoideum (Slime mold) Length = 243 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 923 PTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P PPP P P PPP PPP P PP Sbjct: 57 PLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 103 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXP 1069 P P P PPP P P PPP PPP P P Sbjct: 57 PLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 >UniRef50_Q55DK4 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1561 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P G PPPP P G P Sbjct: 1037 PPPPPISGAPPPPPPPPPPMKGGAGPPPPPPPPGKLGAKKPP 1078 >UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: Formin B - Trypanosoma brucei TREU927 Length = 1004 Score = 35.9 bits (79), Expect = 1.8 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +1 Query: 541 PPPXPXPAX---PXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P P P G PPPP P G P Sbjct: 500 PPPPPPPGGKLPPPPPPPGKAPPPPPGGKLPPPPPPGGKGAPPPP 544 >UniRef50_A7EKZ0 Cluster: Putative uncharacterized protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 1373 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P G PPPP P G P Sbjct: 1294 PPPMPSAGAPGGPPPPPPPPPPGMGAPPPPPMPPMGGAPAAP 1335 >UniRef50_A6RH13 Cluster: Predicted protein; n=2; Onygenales|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 307 Score = 35.9 bits (79), Expect = 1.8 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXP-XSXGXAPPPPXPXXXGGXXTP 666 PPP P P+ P P P P S PPPP P TP Sbjct: 43 PPPSPSPSNPPPPQPSTPRPPSPSNPQPPPPPSPSSQAPGPTP 85 >UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomyces capsulatus NAm1|Rep: Cytokinesis protein sepA - Ajellomyces capsulatus NAm1 Length = 1670 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 538 FPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 FPPP P P P P G PPPP P G P Sbjct: 952 FPPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPP 994 >UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n=1; Owenia fusiformis|Rep: Uncharacterized proline-rich protein - Owenia fusiformis Length = 141 Score = 35.9 bits (79), Expect = 1.8 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +2 Query: 920 SPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPPGXA 1081 +P P PPP P P PPP PPP P PP A Sbjct: 8 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRA 61 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 >UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14; Mammalia|Rep: Wiskott-Aldrich syndrome protein - Homo sapiens (Human) Length = 502 Score = 35.9 bits (79), Expect = 1.8 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 4/57 (7%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAX----PXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP RG PPP P PA P P P P PPPP P G P Sbjct: 361 PPGRGG-----PPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAP 412 >UniRef50_Q05858 Cluster: Formin; n=26; Euteleostomi|Rep: Formin - Gallus gallus (Chicken) Length = 1213 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTPH 669 PPP P P P P P G PPPP TPH Sbjct: 655 PPPPPPPPPPPPPPPPPFSDSSLPGLVPPPPPLPTGPTSVTPH 697 >UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 394 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 273 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPP 279 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLP 283 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 923 PTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P PPP P P PPP PPP P PP Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPP 285 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXP 1069 P P P PPP P P PPP PPP P + P Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLP 290 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPP 280 >UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: diaphanous protein - Entamoeba histolytica HM-1:IMSS Length = 1176 Score = 35.5 bits (78), Expect = 2.4 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP GA PPP P P P P P G PPPP P G P Sbjct: 608 PPPPGASSI--PPPPPPPGMPG--MPPPPPPPGMPGMPPPPPPPGMPGMPPPP 656 Score = 33.9 bits (74), Expect = 7.3 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 4/62 (6%) Frame = +1 Query: 493 GXXXXPPXRGAXXFFFPPPXPX----PAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXX 660 G PP G PPP P P P P P P PPPP P G Sbjct: 639 GMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPPGMPGMPP 698 Query: 661 TP 666 P Sbjct: 699 PP 700 Score = 33.5 bits (73), Expect = 9.7 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP G PPP P P P P P G PPPP P G P Sbjct: 620 PPPPGMPGM--PPPPPPPGMPG--MPPPPPPPGMPGMPPPPPPPGMPGMPPPP 668 >UniRef50_Q4T4H8 Cluster: Chromosome 2 SCAF9640, whole genome shotgun sequence; n=3; Clupeocephala|Rep: Chromosome 2 SCAF9640, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1536 Score = 35.5 bits (78), Expect = 2.4 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG+ G C G G G G G GGG Sbjct: 1162 GGGGGGSTTTGGGGCGGSGSGGGGGGGGGGGGG 1194 >UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 3 SCAF14700, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1204 Score = 35.5 bits (78), Expect = 2.4 Identities = 19/53 (35%), Positives = 21/53 (39%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP GA PPP P P+ P P + G PPPP P G P Sbjct: 617 PPALGAMGAPPPPPPPPPSAAGLPPPPPPPLPGA-GPPPPPPPPLPGAGPPPP 668 Score = 35.1 bits (77), Expect = 3.2 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP GA PPP P P P P P S G PPPP P Sbjct: 645 PPLPGAG----PPPPPPPPLPGAGPPPPPPPPLS-GAGPPPPPP 683 Score = 33.5 bits (73), Expect = 9.7 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPX--PXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP G PPP P PA P P + G PPPP P G P Sbjct: 601 PPALGGVPPPPPPPPPPPALGAMGAPPPPPPPPPSAAGLPPPPPPPLPGAGPPPP 655 Score = 33.5 bits (73), Expect = 9.7 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP A PPP P P P P P + G PPPP P G P Sbjct: 631 PPPPSAAGLPPPPPPPLPGA-GPPPPPPPPLPGA-GPPPPPPPPLSGAGPPPP 681 >UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: All3916 protein - Anabaena sp. (strain PCC 7120) Length = 383 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 326 PPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPP 358 Score = 34.3 bits (75), Expect = 5.5 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P+ PPP P P PPP PPP P PP Sbjct: 312 PPPPSDPPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPP 364 Score = 34.3 bits (75), Expect = 5.5 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P P PPP P P P P PPP P PP Sbjct: 322 PDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRPPP 374 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P P P P P P PPPP Sbjct: 346 PPPPPDPPPPPPPDPPPPPDPPPPDRPPPPP 376 >UniRef50_Q9XIE0 Cluster: F23H11.22 protein; n=1; Arabidopsis thaliana|Rep: F23H11.22 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 929 Score = 35.5 bits (78), Expect = 2.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P G PPPP P G P Sbjct: 395 PPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKP 435 >UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnoliophyta|Rep: Extensin protein-like - Arabidopsis thaliana (Mouse-ear cress) Length = 470 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P +PPPP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 >UniRef50_Q42421 Cluster: Chitinase; n=1; Beta vulgaris subsp. vulgaris|Rep: Chitinase - Beta vulgaris subsp. vulgaris Length = 439 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 98 PPPPPTPRPPPPRPPTPRPPPPPTPRPPPPPTP 130 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP--PXPPPXXXPAXAXPP 1072 P PTP PPP P P PP P PPP P PP Sbjct: 64 PRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPPPPRPPTPRPPP 118 Score = 33.9 bits (74), Expect = 7.3 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P PTP PPP P PT PPP PP P PP Sbjct: 99 PPPPTPRPPPPRPPTPRPPPPPTPRPPPP---PTPRPPPPSPPTPRPPPPPPP 148 >UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|Rep: H0315A08.9 protein - Oryza sativa (Rice) Length = 168 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 923 PTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P PPP P P PPP PPP P PP Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 >UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukaryota|Rep: Predicted membrane protein - Ostreococcus tauri Length = 1449 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P P P P PT PPP PPP P+ PP Sbjct: 836 PSSPPPPSPSP--PPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPP 886 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P+P PPP P P PPP PPP P + PP Sbjct: 839 PPPPSP-SPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPP 890 Score = 33.9 bits (74), Expect = 7.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P P+ P P P P PPPP Sbjct: 806 PPPPPPPSPPPPPNPPTPPSPPPPPSPPPPP 836 Score = 33.5 bits (73), Expect = 9.7 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P P P PPP P P Sbjct: 801 PPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPP 842 Score = 33.5 bits (73), Expect = 9.7 Identities = 16/53 (30%), Positives = 20/53 (37%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P +P+P PPP P P P P PPP P+ + PP Sbjct: 851 PPAPSPP-PPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPP 902 >UniRef50_A4S3R1 Cluster: Predicted protein; n=2; Ostreococcus|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 700 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P AP PP P Sbjct: 534 PPPPPPPPPPPPPPPPGGHAPPDENAAPSPPNP 566 >UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; Trypanosoma cruzi|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 603 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PPP P P P P P P G APPPP P G Sbjct: 383 PPPPPPPPPPPPPPP-----PPPAGKAPPPPIPPPPPG 415 >UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; Trypanosoma brucei|Rep: Putative uncharacterized protein - Trypanosoma brucei Length = 576 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 529 PPPPPPPKAPPPKGPPPKVAPPPPPPPPPPPAP 561 Score = 33.5 bits (73), Expect = 9.7 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP +G PPP P P P P P P PPPP P Sbjct: 519 PPQKGGV----PPPPPPP--PPPKAPPPKGPPPKVAPPPPPPPP 556 >UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_115, whole genome shotgun sequence - Paramecium tetraurelia Length = 1084 Score = 35.5 bits (78), Expect = 2.4 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 5/58 (8%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXX-----PXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP G PPP P P P P P P G PPPP P G P Sbjct: 556 PPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPPPPPGGMPPPP 613 >UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus terreus NIH2624|Rep: Predicted protein - Aspergillus terreus (strain NIH 2624) Length = 313 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PPP P P P P P P G PPPP P G Sbjct: 143 PPPPPPPPPPPPPPPPMAGPPPPPG--PPPPHPPPPAG 178 Score = 33.5 bits (73), Expect = 9.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 929 PXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPPGXA 1081 P GPPP P P PPP PPP P A PP A Sbjct: 136 PVGPPPPPPPPPPPPPPPPPPPPMAGPP---PPPGPPPPHPPPPAGPPPVA 183 >UniRef50_A6SD70 Cluster: Putative uncharacterized protein; n=1; Botryotinia fuckeliana B05.10|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 1648 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +1 Query: 511 PXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXG 651 P +G F PPP P P P P P G PPPP P G Sbjct: 995 PGQGPPGFNGPPPPPPP--PPPPGMNAPVAPGFGGPPPPPPPPPPPG 1039 >UniRef50_A4R506 Cluster: Putative uncharacterized protein; n=1; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 536 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 434 PPPPPPPPPPPPSPPAPPPPPPPPVITPPPPPP 466 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 436 PPPPPPPPPPSPPAPPPPPPPPVITPPPPPPTP 468 >UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precursor; n=1; Volvox carteri|Rep: Sulfated surface glycoprotein 185 precursor - Volvox carteri Length = 485 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 244 PPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPP 276 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P PP Sbjct: 245 PPSPRPPSPPPPSPSPPPPPPPPPPPPPPP--PPSPPPPPPPPPPPPPPPPPP 295 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 254 PPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPP 286 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 260 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 292 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 261 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 293 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 262 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 294 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 265 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSP 297 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXP 1069 P P+P PPP P P PPP PPP P P Sbjct: 253 PPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPP 304 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P+P P P P P PPP PPP P PP Sbjct: 248 PRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPP 300 Score = 34.3 bits (75), Expect = 5.5 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXG-XAPPPPXP 639 PPP P P P P P P S PPPP P Sbjct: 283 PPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPPSP 316 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P+ P P P P PPPP P Sbjct: 253 PPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPP 284 Score = 33.5 bits (73), Expect = 9.7 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 920 SPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 SP P PPP P P PPP P P P PP Sbjct: 259 SPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPP 309 >UniRef50_UPI000155D461 Cluster: PREDICTED: similar to Mitogen-activated protein kinase kinase kinase 7 interacting protein 3; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to Mitogen-activated protein kinase kinase kinase 7 interacting protein 3 - Ornithorhynchus anatinus Length = 639 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P A P P P P PPPP P Sbjct: 154 PPPQPAAAAPQPGLPGPSPPPAPPAPPPPPPPP 186 >UniRef50_UPI0000DA3CD5 Cluster: PREDICTED: hypothetical protein; n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 311 Score = 35.1 bits (77), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 668 CGVXXPPXXXGXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 C V P G GGGG G G G G G G GGG Sbjct: 171 CSVRVPGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 213 >UniRef50_UPI000049834E Cluster: FH2 domain protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: FH2 domain protein - Entamoeba histolytica HM-1:IMSS Length = 1212 Score = 35.1 bits (77), Expect = 3.2 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP GA PPP P P P P P G PPPP P G P Sbjct: 639 PPPPGASSV--PPPPPPPG--MPGMPPPPPPPGMPGMPPPPPLPGMPGMPPPP 687 >UniRef50_Q4RSI9 Cluster: Chromosome 13 SCAF15000, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 13 SCAF15000, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 307 Score = 35.1 bits (77), Expect = 3.2 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAP--PPPXPXXXGGXXTP 666 PP +FPPP P P P P P P P PPP P +P Sbjct: 161 PPSPPLSPPYFPPPPPLPPPPFPLFPLFPPPPPPPPPPPFSPPPPPSPPPSLFSP 215 >UniRef50_Q9E938 Cluster: ICP4 protein; n=2; Gallid herpesvirus 3|Rep: ICP4 protein - Gallid herpesvirus 3 (Marek's disease virus type 2) Length = 2033 Score = 35.1 bits (77), Expect = 3.2 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 920 SPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 SPTP PPP P P PPP PPP P PP Sbjct: 221 SPTPPTPPPLSPPPPTPPPLSPPPPTPP--PLSPPPPTPPPHTPPPHGSPP 269 >UniRef50_Q6MWG9 Cluster: B1160F02.7 protein; n=3; Oryza sativa|Rep: B1160F02.7 protein - Oryza sativa subsp. japonica (Rice) Length = 906 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP PA P P P G PPPP P Sbjct: 322 PPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPP 354 >UniRef50_Q41192 Cluster: NaPRP3; n=1; Nicotiana alata|Rep: NaPRP3 - Nicotiana alata (Winged tobacco) (Persian tobacco) Length = 151 Score = 35.1 bits (77), Expect = 3.2 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P+ P P P P +PPPP P Sbjct: 82 PPPPSPSPPPPSPPPPSPSPPPPSPSPPPPSP 113 >UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En/Spm sub-class; n=2; Oryza sativa|Rep: Transposon protein, putative, CACTA, En/Spm sub-class - Oryza sativa subsp. japonica (Rice) Length = 209 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +1 Query: 484 PXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 P PP A PPP P P P P +PPPP P Sbjct: 53 PPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPP 104 >UniRef50_Q0D806 Cluster: Os07g0192900 protein; n=5; Magnoliophyta|Rep: Os07g0192900 protein - Oryza sativa subsp. japonica (Rice) Length = 509 Score = 35.1 bits (77), Expect = 3.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PPP P PA P P P PPPP P G Sbjct: 158 PPPPPLPASSEPVDPSAASLPPLPPPPPPPPKPANIAG 195 >UniRef50_Q93424 Cluster: Putative uncharacterized protein grl-23; n=5; Bilateria|Rep: Putative uncharacterized protein grl-23 - Caenorhabditis elegans Length = 385 Score = 35.1 bits (77), Expect = 3.2 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = -2 Query: 668 CGVXXPPXXXGXG---GGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 C PP G G GGG G C G G G G G GGG Sbjct: 52 CAPPPPPPACGGGCGGGGGGCGGGGGGCGGGGGCGGGGGGCGGGGG 97 Score = 33.9 bits (74), Expect = 7.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -2 Query: 668 CGVXXPPXXXGXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 C PP G G GG G C G G G G G GG Sbjct: 109 CAPPPPPPACGGGCGGGGGGCGGGCGGGGGGGCGGGGGGGCGG 151 >UniRef50_Q86C16 Cluster: Ah1644 protein; n=7; cellular organisms|Rep: Ah1644 protein - Drosophila melanogaster (Fruit fly) Length = 1644 Score = 35.1 bits (77), Expect = 3.2 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P P G APPPP P G P Sbjct: 271 PPPPPPPMAPAAPPPPP---PPINGAAPPPPPPPMINGGALP 309 Score = 35.1 bits (77), Expect = 3.2 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP PA P P P P + PPPP P GG P Sbjct: 274 PPPPMAPAAPPPPPP-----PINGAAPPPPPPPMINGGALPP 310 >UniRef50_Q5CKJ5 Cluster: Putative uncharacterized protein; n=1; Cryptosporidium hominis|Rep: Putative uncharacterized protein - Cryptosporidium hominis Length = 996 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P P P P P P S PPPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPLPPSQHLLPPPP 439 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 410 PPPPPPPPPPPPPPPPPPLPPSQHLLPPPPPLP 442 >UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: Formin, putative - Leishmania major Length = 1300 Score = 35.1 bits (77), Expect = 3.2 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP G PPP P P P P P P G PPPP G P Sbjct: 654 PPPTGGPKQPPPPPPPPPPPPPPPPP-----PPRMGNGPPPPPGKGASGAAAP 701 >UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 634 Score = 35.1 bits (77), Expect = 3.2 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PP A PPP P P P P P + PPPP Sbjct: 537 PPPPSAPGAGIPPPPPVPGNAPPPPPPPPPPPGAGAPPPPPP 578 Score = 33.9 bits (74), Expect = 7.3 Identities = 22/61 (36%), Positives = 23/61 (37%) Frame = +1 Query: 484 PXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXT 663 P G PP G PPP P P P P P G APPPP GG + Sbjct: 543 PGAGIPPPPPVPGNAPPPPPPPPPPPGAGAPPPPP----PPGPGLAPPPP---KAGGSSS 595 Query: 664 P 666 P Sbjct: 596 P 596 Score = 33.5 bits (73), Expect = 9.7 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 493 GXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 G PP PPP P A P P P P G PPPP P Sbjct: 534 GEAPPPPSAPGAGIPPPPPVPGNAPPPPPPP---PPPPGAGAPPPPPPP 579 >UniRef50_Q6AHS6 Cluster: Protease-1 (PRT1) protein, putative; n=58; Pneumocystis carinii|Rep: Protease-1 (PRT1) protein, putative - Pneumocystis carinii Length = 947 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P PA P P P + PPPP P Sbjct: 791 PPPAPAPAPPAPPPPPAPAPAPAPPPPPPPPPP 823 Score = 34.3 bits (75), Expect = 5.5 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP A PPP P PA P P P P PPPP P Sbjct: 778 PPPAPAPAPPAPPPPPAPA-PAPPAPPPPPAPAPAPAPPPPPPP 820 Score = 33.9 bits (74), Expect = 7.3 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PP A PPP P PA P P P P APPPP Sbjct: 752 PPPAPAPAPPAPPPPPAPA-PAPPAPPPPPAPAPAPPAPPPP 792 Score = 33.9 bits (74), Expect = 7.3 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PP A PPP P PA P P P P APPPP Sbjct: 765 PPPAPAPAPPAPPPPPAPA-PAPPAPPPPPAPAPAPPAPPPP 805 >UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2; Coccidioides|Rep: Proline-and threonine-rich protein - Coccidioides posadasii Length = 281 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPPP P Sbjct: 101 PPPPPPPPPPPPPAPTTTQAPQYPPPPPPPPPP 133 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 538 FPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 +PPP P P P P P PPPP P Sbjct: 123 YPPPPPPPPPPAPTTSKAAPPPPPPPPPPPPPAP 156 >UniRef50_A6RGJ8 Cluster: Predicted protein; n=1; Ajellomyces capsulatus NAm1|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 757 Score = 35.1 bits (77), Expect = 3.2 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 665 GVXXPPXXXGXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGG 507 G PP G GGGG P G G G G G G GG P GG Sbjct: 347 GGGGPPGRGGGGGGGGGPPEGGG-GSDGAPGRGGGGGGPPGGGGGGGGPPGGG 398 Score = 34.3 bits (75), Expect = 5.5 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 665 GVXXPPXXXGXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGG 507 G PP G GGGG G G G G G GGG R GG Sbjct: 390 GGGGPPGGGGGGGGGPPGGGGGGPPGSGGGGGGGGGPPEGGGGSDGAPGRGGG 442 Score = 33.9 bits (74), Expect = 7.3 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = -2 Query: 665 GVXXPPXXXGXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGGXXXSPXX 486 G PP G GGG G G G G G G GGG GG +P Sbjct: 380 GGGGPPGGGGGGGGPPGGGGGGGGGPPGGGGGGPPGSGGGGGGGGGPPEGGGGSDGAPGR 439 Query: 485 G 483 G Sbjct: 440 G 440 Score = 33.5 bits (73), Expect = 9.7 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -2 Query: 665 GVXXPPXXXGXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGGXXXSPXX 486 G PP G GGGG P G G G G G G GG P GG P Sbjct: 409 GGGGPPGSGGGGGGGGGPPEGGG-GSDGAPGRGGGGGGGGG------PPGGGGGGGGPPG 461 Query: 485 G 483 G Sbjct: 462 G 462 >UniRef50_Q03211 Cluster: Pistil-specific extensin-like protein precursor; n=2; Nicotiana|Rep: Pistil-specific extensin-like protein precursor - Nicotiana tabacum (Common tobacco) Length = 426 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP + A PPP P+ P P P P PPPP P Sbjct: 160 PPDQSAKQPPQPPPAKQPSPPPPPPPVKAPSPSPAKQPPPPPPP 203 >UniRef50_UPI0000F2B52B Cluster: PREDICTED: similar to diaphanous 1; n=1; Monodelphis domestica|Rep: PREDICTED: similar to diaphanous 1 - Monodelphis domestica Length = 1186 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PP G+ PPP P P P P P S G PPPP Sbjct: 599 PPLPGSISIP-PPPPPPPPLPVLPPPSPLPLPGSTGIPPPPP 639 >UniRef50_UPI0000499326 Cluster: actin binding protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: actin binding protein - Entamoeba histolytica HM-1:IMSS Length = 986 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXX-PXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P P + G PPPP P G P Sbjct: 502 PPPPPPGTQPIPGVPPPPPGVPGATGVPPPPPPPGMPGAPPPP 544 >UniRef50_Q7T318 Cluster: Wiskott-Aldrich syndrome; n=7; Euteleostomi|Rep: Wiskott-Aldrich syndrome - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 479 Score = 34.7 bits (76), Expect = 4.2 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = +1 Query: 484 PXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 P PP GA PPP P P P P S APPPP P GG Sbjct: 353 PSQSHKPPPPPMGACA---PPPPPPPPPPPSSSGNFSSSPVS--SAPPPPPPSGGGG 404 >UniRef50_Q7SZN7 Cluster: Enah/Vasp-like a; n=3; Danio rerio|Rep: Enah/Vasp-like a - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 387 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P PP P P GG P Sbjct: 187 PPAPPPPPGPPPPGPPPPGPPPPVTGPPPTPPPLPAGGGPAP 228 >UniRef50_Q2J3C8 Cluster: OmpA/MotB precursor; n=4; Alphaproteobacteria|Rep: OmpA/MotB precursor - Rhodopseudomonas palustris (strain HaA2) Length = 651 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 547 PXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 P P PA P P P P + APPPP P Sbjct: 97 PPPRPAAPPPPPPPRAEPPAAPRAAPPPPPP 127 >UniRef50_A0R2X6 Cluster: Putative uncharacterized protein; n=2; Mycobacterium|Rep: Putative uncharacterized protein - Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) Length = 377 Score = 34.7 bits (76), Expect = 4.2 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +1 Query: 484 PXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP----XPXXXG 651 P G PP G +PPP P P P P G PPPP P G Sbjct: 13 PDGGYPPPPPPDGG----YPPPPPPDGGYPPAQPGGFGPPPQGGYPPPPPPGGYPPPPQG 68 Query: 652 GXXTP 666 G P Sbjct: 69 GFPPP 73 >UniRef50_Q6AWX8 Cluster: Growth-regulating factor 11; n=5; Poaceae|Rep: Growth-regulating factor 11 - Oryza sativa subsp. japonica (Rice) Length = 269 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -2 Query: 653 PPXXXGXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKK 534 PP G GGGG G G AG G GGG+K Sbjct: 15 PPGGGGGGGGGEEEEDSSLAVGEAAVGVGEAGGGGGGGEK 54 >UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Extensin - Volvox carteri Length = 464 Score = 34.7 bits (76), Expect = 4.2 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P P P P P P +PPPP Sbjct: 332 PPPSPPPPSPPPPRPSPSPPPPRSSPSPPPP 362 Score = 33.9 bits (74), Expect = 7.3 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P +PPPP P Sbjct: 314 PPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRP 346 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P +PPPP P Sbjct: 310 PPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSP 341 >UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-V1 protein precursor - Volvox carteri f. nagariensis Length = 590 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P S PPPP P Sbjct: 205 PPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPP 236 Score = 34.3 bits (75), Expect = 5.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P S P PP P Sbjct: 228 PPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPP 260 Score = 33.5 bits (73), Expect = 9.7 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +2 Query: 914 PXSPTPXGPP-PXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P+P PP P P P PPP PPP P PP Sbjct: 210 PPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPP 263 Score = 33.5 bits (73), Expect = 9.7 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P S PPPP P Sbjct: 217 PPPSPPP-PPSPPPPPPPPPPPSPPPPPPPPPP 248 Score = 33.5 bits (73), Expect = 9.7 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P +PPPP P Sbjct: 231 PPPPPPPSPPPPPPPPPPPSPPPP-PSPPPPSP 262 >UniRef50_Q0E2B5 Cluster: Os02g0254800 protein; n=4; Eukaryota|Rep: Os02g0254800 protein - Oryza sativa subsp. japonica (Rice) Length = 741 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGG 507 G GGGG G G G G G G GGG+ + A GG Sbjct: 528 GGGGGGGGGGGRGGAGGDGGGGAGGDGAGGGGGRGRGRARGGGG 571 >UniRef50_Q00TR5 Cluster: Homology to unknown gene; n=3; Ostreococcus|Rep: Homology to unknown gene - Ostreococcus tauri Length = 1931 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P S +PPPP P Sbjct: 1829 PPPSPPPSPPPPSPP--PSPPPSPPPSPPPPSP 1859 >UniRef50_A3A561 Cluster: Putative uncharacterized protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein - Oryza sativa subsp. japonica (Rice) Length = 468 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGG 507 G GGGG G G G G G G GGG+ + A GG Sbjct: 386 GGGGGGGGGGGRGGAGGDGGGGAGGDGAGGGGGRGRGRARGGGG 429 >UniRef50_Q4QIK8 Cluster: Putative uncharacterized protein; n=2; Leishmania|Rep: Putative uncharacterized protein - Leishmania major Length = 352 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P G PPPP P Sbjct: 293 PPPPPGPPPPHLTAPFRETVPPPPGPPPPPPPP 325 >UniRef50_A2DC30 Cluster: Formin Homology 2 Domain containing protein; n=1; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1128 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P A P P P + PPPP P G P Sbjct: 597 PPPPPVGAPPPPPPPPPPPPGVAAAAPPPPPPPPGLAGLVPP 638 >UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU01431.1; n=2; Sordariomycetes|Rep: Putative uncharacterized protein NCU01431.1 - Neurospora crassa Length = 1817 Score = 34.7 bits (76), Expect = 4.2 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 1/64 (1%) Frame = +2 Query: 887 AXAXGXXXXPXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAX 1066 A A P P P PPP P PPP PPP P A Sbjct: 1023 APAAASGPPPPPPPPPPPPPPPGFLPGAPAPIPGAGGPPPPPPPPPPPPPPPGGLPGAAP 1082 Query: 1067 P-PG 1075 P PG Sbjct: 1083 PMPG 1086 Score = 33.5 bits (73), Expect = 9.7 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 923 PTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P PPP P P PPP PPP A PP Sbjct: 1062 PPPPPPPPPPPPPGGLPGAAPPMPGAGGPPPPPPPPPPPPMPGMAGMPPP 1111 Score = 33.5 bits (73), Expect = 9.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P A P P P G PPPP P Sbjct: 1099 PPPMPGMAGMPPPPPPPPPMPGMPGMPPPPPPP 1131 >UniRef50_Q5AL52 Cluster: Putative uncharacterized protein BNI1; n=1; Candida albicans|Rep: Putative uncharacterized protein BNI1 - Candida albicans (Yeast) Length = 1732 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P S PPPP P Sbjct: 1052 PPPPPPPPPPPPPLPPILGGNNSSAAPPPPPPP 1084 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P S PPPP P Sbjct: 1053 PPPPPPPPPPPPLPPILGGNNSSAAPPPPPPPP 1085 >UniRef50_Q2H239 Cluster: Putative uncharacterized protein; n=1; Chaetomium globosum|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 904 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/49 (34%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +1 Query: 493 GXXXXPPXR--GAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 G PP + A ++ P P PA P P P P G PPPP Sbjct: 311 GPPSYPPAQYPPAPGYYAPGAAPPPAPPPPSYPPGTYPPQQYGLPPPPP 359 >UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2/cappuccino; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to formin 1,2/cappuccino - Nasonia vitripennis Length = 1271 Score = 34.3 bits (75), Expect = 5.5 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPX---PXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP R PPP P P P P P S PPPP P G P Sbjct: 545 PPSRPEMLASLPPPPPPPPMPGIMQPPPPPPMPGMMSGPPPPPPPMPEMMSGPPPP 600 >UniRef50_Q4RLL2 Cluster: Chromosome 10 SCAF15019, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 10 SCAF15019, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1225 Score = 34.3 bits (75), Expect = 5.5 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PP PPP P A P P P P PPPP Sbjct: 702 PPPISVQKVIPPPPPPKAAPPPPPPPKAATPPPPKAVTPPPP 743 >UniRef50_Q9J8C9 Cluster: ORF4 hoar; n=1; Spodoptera exigua MNPV|Rep: ORF4 hoar - Spodoptera exigua MNPV Length = 724 Score = 34.3 bits (75), Expect = 5.5 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 535 FFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 F P P P P P P P P + PPPP P Sbjct: 375 FTPSPSPSPPPPSPPQPVVRTIPPNPVSPPPPPPP 409 >UniRef50_Q9LMQ1 Cluster: F7H2.17 protein; n=2; Arabidopsis thaliana|Rep: F7H2.17 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 1006 Score = 34.3 bits (75), Expect = 5.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P P P P P P PPPP Sbjct: 385 PPPTPVPCSPPPPPPIPVPCPPPPSPPPPPP 415 >UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sativa|Rep: OSJNBb0018A10.6 protein - Oryza sativa (Rice) Length = 909 Score = 34.3 bits (75), Expect = 5.5 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P +P+P PPP P P PPP PP PA PP Sbjct: 447 PPAPSPPAPPPPPPVPSPSGPPPPPPPPAPSPPA--PPPPPPAPSPPAPPPPP 497 Score = 34.3 bits (75), Expect = 5.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P S PPPP P Sbjct: 467 PPPPPPPPAPSPPAPPPPPPAPSPPAPPPPPPP 499 Score = 33.9 bits (74), Expect = 7.3 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P PPPP P Sbjct: 456 PPPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAP 488 Score = 33.9 bits (74), Expect = 7.3 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P + PP P P Sbjct: 458 PPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSP 490 Score = 33.5 bits (73), Expect = 9.7 Identities = 15/53 (28%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P P+P P P P P PP PPP P+ PP Sbjct: 442 PAPPSPPAPSPPAPPPPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPP 494 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P+ P P P P PPPP P Sbjct: 444 PPSPPAPSPPAPPPPPPVPSPSGPPPPPPPPAP 476 >UniRef50_Q01L28 Cluster: OSIGBa0147J02.2 protein; n=7; Oryza sativa|Rep: OSIGBa0147J02.2 protein - Oryza sativa (Rice) Length = 915 Score = 34.3 bits (75), Expect = 5.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P+ P P P P + PPPP P Sbjct: 485 PPRPPAPSPPAPPPPPAAPSPPAPSPPPPPPCP 517 >UniRef50_A5B045 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 410 Score = 34.3 bits (75), Expect = 5.5 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = +1 Query: 484 PXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 P G PP GA PPP A P P P + G APPPP Sbjct: 305 PFHGVAPPPPTYGAA----PPPPTYGAAPPPPTYGAAPPPPTYGAAPPPP 350 >UniRef50_Q9VZC2 Cluster: CG15021-PA; n=1; Drosophila melanogaster|Rep: CG15021-PA - Drosophila melanogaster (Fruit fly) Length = 420 Score = 34.3 bits (75), Expect = 5.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 P P P P+ P P P + G PPPP P Sbjct: 197 PKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPP 229 >UniRef50_A0NCF4 Cluster: ENSANGP00000030385; n=2; Eukaryota|Rep: ENSANGP00000030385 - Anopheles gambiae str. PEST Length = 61 Score = 34.3 bits (75), Expect = 5.5 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P P S PPPP P GG P Sbjct: 21 PPPVQPPLPPPPPPPVQ---PSSPTPPPPPPAPSSSGGRSGP 59 >UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein), putative; n=1; Filobasidiella neoformans|Rep: Cytokinesis protein sepa (Fh1/2 protein), putative - Cryptococcus neoformans (Filobasidiella neoformans) Length = 1776 Score = 34.3 bits (75), Expect = 5.5 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXG-XAPPPPXP 639 PP P P P P P P + G APPPP P Sbjct: 1088 PPPPPPPPPPPPPPPPPPPPGAIGLTAPPPPPP 1120 >UniRef50_A5DSH8 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 1940 Score = 34.3 bits (75), Expect = 5.5 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = +1 Query: 451 KXXRGXAXXXXPXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPP 630 K G A P P G+ P P P P P P P G PPP Sbjct: 1231 KVTGGVASLLPPPPPPPLPPLHYGSQNSLAPGPPPPPPPPPPPPPGLSVGSNIAGPPPPP 1290 Query: 631 PXP 639 P P Sbjct: 1291 PPP 1293 >UniRef50_A3LN86 Cluster: Protein involved in actin organization and endocytosis; n=2; Saccharomycetales|Rep: Protein involved in actin organization and endocytosis - Pichia stipitis (Yeast) Length = 1373 Score = 34.3 bits (75), Expect = 5.5 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP F PP P P P P P P G PPPP P Sbjct: 1278 PPIPVGGPSSFAPPPPPPPPPPPGPPPIPNAP--FGAPPPPPPP 1319 >UniRef50_Q86UP3 Cluster: Zinc finger homeobox protein 4; n=18; Eukaryota|Rep: Zinc finger homeobox protein 4 - Homo sapiens (Human) Length = 3567 Score = 34.3 bits (75), Expect = 5.5 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPPGXA 1081 P P P PP PT PPP PPP P PP A Sbjct: 1963 PPPPLPPAPPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPPPSA 2018 >UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - Homo sapiens (Human) Length = 1419 Score = 34.3 bits (75), Expect = 5.5 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXP-XXXXXPXSXGXAPPPP 633 PP A PPP P P P P P P G APPPP Sbjct: 914 PPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPPGLAPPPP 956 Score = 33.5 bits (73), Expect = 9.7 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTPH 669 PP P P P P P P S G PPPP P P+ Sbjct: 901 PPLPPPPPPPPPLPP----PSSAGPPPPPPPPPLPNSPAPPN 938 >UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleostomi|Rep: Protein enabled homolog - Mus musculus (Mouse) Length = 802 Score = 34.3 bits (75), Expect = 5.5 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = +2 Query: 899 GXXXXPXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXP-TXXPPPXPPPXXXPAXAXPP 1072 G P +P P P P P P T PPP PPP P A PP Sbjct: 537 GLVLGPPAPPPPPPLPSGPAYASALPPPPGPPPPPPLPSTGPPPPPPPPPPLPNQAPPP 595 >UniRef50_UPI0000E4857E Cluster: PREDICTED: similar to cold inducible RNA-binding protein beta; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to cold inducible RNA-binding protein beta - Strongylocentrotus purpuratus Length = 577 Score = 33.9 bits (74), Expect = 7.3 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGG 507 G GGG A G G G AG G GGG+++ R GG Sbjct: 285 GRGGGAAASTQYGEESYGGGARGGAAGRGGGGGREEFGQSRGGG 328 >UniRef50_UPI00003BF9F1 Cluster: PREDICTED: similar to SCAR CG4636-PA; n=1; Apis mellifera|Rep: PREDICTED: similar to SCAR CG4636-PA - Apis mellifera Length = 589 Score = 33.9 bits (74), Expect = 7.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P P P PPPP P G P Sbjct: 436 PPPTPDPTPPRPISPPCNIPP----PPPPPPPPPVANGPSPP 473 >UniRef50_Q4A2S6 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 430 Score = 33.9 bits (74), Expect = 7.3 Identities = 17/52 (32%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +2 Query: 920 SPTPXGPPPXXPXXXXXXXXXXXXXXXXXXP-TXXPPPXPPPXXXPAXAXPP 1072 SP P PPP P P + PPP PPP P + PP Sbjct: 129 SPVPSPPPPPSPFAPEPSPPPPMPPPPTPPPPSPSPPPLPPPPWSPDPSPPP 180 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PP P P P P P P S +PPPP Sbjct: 152 PPPPTPPPPSPSPPPLPPPPWSPDPSPPPP 181 >UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|Rep: OmpA family protein - Caulobacter crescentus (Caulobacter vibrioides) Length = 449 Score = 33.9 bits (74), Expect = 7.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 532 FFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 F PPP P P P P P P PPPP Sbjct: 303 FASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 >UniRef50_Q6H7U3 Cluster: Putative formin I2I isoform; n=2; Oryza sativa|Rep: Putative formin I2I isoform - Oryza sativa subsp. japonica (Rice) Length = 881 Score = 33.9 bits (74), Expect = 7.3 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P G APPP P Sbjct: 359 PPPPPPPPPPPPPRPPPPPPPIKKG-APPPAPP 390 >UniRef50_Q0JA38 Cluster: Os04g0617200 protein; n=2; Oryza sativa (japonica cultivar-group)|Rep: Os04g0617200 protein - Oryza sativa subsp. japonica (Rice) Length = 149 Score = 33.9 bits (74), Expect = 7.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P P P P P P PPPP Sbjct: 19 PPPLPPPPHPSPPLPLPTPPPPPPSPPPPPP 49 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P +PPPP P Sbjct: 18 PPPPLPPPPHPSPPLPLPTPPPPPPSPPPPPP 49 >UniRef50_Q01DC8 Cluster: Plg protein; n=2; Eukaryota|Rep: Plg protein - Ostreococcus tauri Length = 3738 Score = 33.9 bits (74), Expect = 7.3 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P+ P P P P PPPP P Sbjct: 5 PPPPAPPSPPPPPSPPPPPSPAPPSPPPPPPSP 37 >UniRef50_A7QNX2 Cluster: Chromosome chr1 scaffold_135, whole genome shotgun sequence; n=4; Magnoliophyta|Rep: Chromosome chr1 scaffold_135, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 673 Score = 33.9 bits (74), Expect = 7.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P P P S G PP P P P Sbjct: 77 PPPTPPPPSPSPPPPPPP--PPSSGSGPPKPPPPSHSNSSPP 116 >UniRef50_A5BR16 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 196 Score = 33.9 bits (74), Expect = 7.3 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P PPP P Sbjct: 28 PPPSPSPSPPPPPSPSPPPSPPPPSSPPPPQRP 60 Score = 33.5 bits (73), Expect = 9.7 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P P P P P+ PP PPP P PP Sbjct: 14 PLSPPPPPPSPSPPPPPSPSPSPPPPPSPSPPPSPPPPSSPPPPQRPRPLTPP 66 >UniRef50_A5AVJ0 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 427 Score = 33.9 bits (74), Expect = 7.3 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 3/66 (4%) Frame = +2 Query: 893 AXGXXXXPXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXP---PPXPPPXXXPAXA 1063 A G P P P PPP P P P PP PPP Sbjct: 301 APGAPPRPLPPPPQAPPPPPPPPQGLPPGATIANPPRGPPPPMPGTLPPPPPPMGNGPRP 360 Query: 1064 XPPGXA 1081 PPG A Sbjct: 361 MPPGGA 366 >UniRef50_A4S1A8 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 388 Score = 33.9 bits (74), Expect = 7.3 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXP 1069 P SP P PPP P P PPP PPP P+ P Sbjct: 119 PPSPPP-SPPPSPPPSPPPSPPPNPPPSPPPSPPPSPPPSPPPSPPPSPPVP 169 Score = 33.5 bits (73), Expect = 9.7 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P+ P Sbjct: 99 PPSPPP-SPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSP 150 Score = 33.5 bits (73), Expect = 9.7 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P+ P Sbjct: 103 PPSPPP-SPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSPPPSP 154 Score = 33.5 bits (73), Expect = 9.7 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P+ P Sbjct: 107 PPSPPP-SPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSPPPSPPPSP 158 Score = 33.5 bits (73), Expect = 9.7 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P+ P Sbjct: 111 PPSPPP-SPPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSPPPSPPPSPPPSP 162 Score = 33.5 bits (73), Expect = 9.7 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PPP PPP P+ P Sbjct: 115 PPSPPP-SPPPSPPPSPPPSPPPSPPPNPPPSPPPSPPPSPPPSPPPSPPPSP 166 >UniRef50_Q8IMM6 Cluster: CG5514-PB, isoform B; n=3; Drosophila melanogaster|Rep: CG5514-PB, isoform B - Drosophila melanogaster (Fruit fly) Length = 1150 Score = 33.9 bits (74), Expect = 7.3 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP A PPP P P P P P PPPP P Sbjct: 413 PPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAP 456 >UniRef50_Q5CHL3 Cluster: Hydroxyproline-rich glycoprotein dz-hrgp; n=8; Cryptosporidium|Rep: Hydroxyproline-rich glycoprotein dz-hrgp - Cryptosporidium hominis Length = 328 Score = 33.9 bits (74), Expect = 7.3 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 535 FFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 F PPP P P P P P P S PP P G P Sbjct: 226 FPPPPPPPPPPPPPSPPPQSPPPQSPPSLPPYPVSGSQGSMPMP 269 >UniRef50_Q54H12 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1220 Score = 33.9 bits (74), Expect = 7.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P G PPPP P G P Sbjct: 594 PPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMGGKGGPPP 635 Score = 33.5 bits (73), Expect = 9.7 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP G PPP P P P P G PPPP GG P Sbjct: 587 PPMMGGGP---PPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMGGKGGPPPP 636 >UniRef50_Q22715 Cluster: Putative uncharacterized protein; n=3; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 866 Score = 33.9 bits (74), Expect = 7.3 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 532 FFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 FF PPP P P P P P PP P GG P Sbjct: 63 FFIPPPVPNGFIPPPPGPGGIPPPPPMFAGGIPPPPPMMGGIPPP 107 >UniRef50_Q0KI93 Cluster: CG12946-PB, isoform B; n=4; Sophophora|Rep: CG12946-PB, isoform B - Drosophila melanogaster (Fruit fly) Length = 630 Score = 33.9 bits (74), Expect = 7.3 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP A PPP P P P P + G PPPP P Sbjct: 488 PPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 531 >UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 370 Score = 33.9 bits (74), Expect = 7.3 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P PA P P P P PPPP P Sbjct: 296 PPPPPYPA-PTPYPPPPPPYPEQVPPPPPPPPP 327 >UniRef50_A2D765 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 450 Score = 33.9 bits (74), Expect = 7.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP PA P P P APPPP P Sbjct: 321 PPPAAKPAPPPPRAAAPPPPPPPAAAAPPPPPP 353 >UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.220; n=1; Neurospora crassa|Rep: Putative uncharacterized protein 15E6.220 - Neurospora crassa Length = 1992 Score = 33.9 bits (74), Expect = 7.3 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P + PPPP P Sbjct: 1950 PPPPPPPPPPTEDPPPPPPPPPAEAPPPPPPTP 1982 >UniRef50_Q7SEW0 Cluster: Predicted protein; n=1; Neurospora crassa|Rep: Predicted protein - Neurospora crassa Length = 580 Score = 33.9 bits (74), Expect = 7.3 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP F PP P P P P P +PPPP P Sbjct: 366 PPVSPVVVVFPAPPTSPPTSPLPPLPPLQPPPPPPPSSPPPPPP 409 >UniRef50_Q6CGD7 Cluster: Similarity; n=1; Yarrowia lipolytica|Rep: Similarity - Yarrowia lipolytica (Candida lipolytica) Length = 800 Score = 33.9 bits (74), Expect = 7.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP A P P P P APPPP P Sbjct: 218 PPPPTQAAPPVPGVPSTTHRPPPPAQAPPPPPP 250 >UniRef50_Q2HEQ9 Cluster: Predicted protein; n=1; Chaetomium globosum|Rep: Predicted protein - Chaetomium globosum (Soil fungus) Length = 438 Score = 33.9 bits (74), Expect = 7.3 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGG 507 G GGGG G G G G G G GGG+ R GG Sbjct: 363 GGGGGGGGRGGGGGGGGRGGGGGGRGGGGGGGGRGGGGGGRGGG 406 >UniRef50_A3LNF1 Cluster: Putative uncharacterized protein; n=1; Pichia stipitis|Rep: Putative uncharacterized protein - Pichia stipitis (Yeast) Length = 442 Score = 33.9 bits (74), Expect = 7.3 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTPH 669 P P PA P P P P + P PP P G PH Sbjct: 240 PAPPAPPAPPAPPAPPAPPAPPAPPAPPAPPAPPAPGEPAPPH 282 >UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|Rep: Formin-like protein 1 - Homo sapiens (Human) Length = 1100 Score = 33.9 bits (74), Expect = 7.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P A P P P P G PPPP P Sbjct: 558 PPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPP 590 >UniRef50_UPI000023D566 Cluster: hypothetical protein FG01858.1; n=1; Gibberella zeae PH-1|Rep: hypothetical protein FG01858.1 - Gibberella zeae PH-1 Length = 231 Score = 27.1 bits (57), Expect(2) = 8.5 Identities = 13/43 (30%), Positives = 13/43 (30%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPP 1042 P P P PPP P PPP PPP Sbjct: 119 PPPPPPPPPPPPSYLRPPMIWPQSLPLGPNRSPFGRPPPPPPP 161 Score = 25.4 bits (53), Expect(2) = 8.5 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 1022 PPPXPPPXXXPAXAXPPG 1075 PPP PPP P PG Sbjct: 193 PPPPPPPPPPPPPPRTPG 210 >UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; n=2; Danio rerio|Rep: PREDICTED: similar to formin 2 - Danio rerio Length = 1465 Score = 33.5 bits (73), Expect = 9.7 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXS--XGXAPPPPXP 639 PP F PPP A P P P P G APPPP P Sbjct: 934 PPPPPLPGFVPPPPVVGKAPPPPPLPGMVPPPPPPLPGMAPPPPPP 979 >UniRef50_UPI0000E4922C Cluster: PREDICTED: similar to Enabled homolog (Drosophila); n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to Enabled homolog (Drosophila) - Strongylocentrotus purpuratus Length = 439 Score = 33.5 bits (73), Expect = 9.7 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 541 PPPXPX--PAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PP P PA P P P + G PPPP P GG Sbjct: 221 PPAVPAAPPAPAAPPAPPAPPAPPAGGGPPPPPPPPAIGG 260 >UniRef50_UPI00006A2591 Cluster: Wiskott-Aldrich syndrome protein (WASp).; n=1; Xenopus tropicalis|Rep: Wiskott-Aldrich syndrome protein (WASp). - Xenopus tropicalis Length = 451 Score = 33.5 bits (73), Expect = 9.7 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPX---PAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP R PPP P P P P P + G APPPP P Sbjct: 340 PPSRSTPPI--PPPTARSGGPPPPPPPPPSIPAPPPTSGPAPPPPPP 384 >UniRef50_UPI0000DC00CB Cluster: SH3 domain binding protein CR16; n=1; Rattus norvegicus|Rep: SH3 domain binding protein CR16 - Rattus norvegicus Length = 456 Score = 33.5 bits (73), Expect = 9.7 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP-XXXGGXXTP 666 PPP P P P P P + PPPP P G TP Sbjct: 319 PPPPPPPPPPPPLPTYASCSPRAAVAPPPPPLPGSSNSGSETP 361 >UniRef50_Q4A263 Cluster: Putative membrane protein; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein - Emiliania huxleyi virus 86 Length = 403 Score = 33.5 bits (73), Expect = 9.7 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P SP P PPP P P PP PPP P+ P Sbjct: 146 PSSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPPPSSPPSPPPSP 198 >UniRef50_Q2NNS2 Cluster: 1629capsid; n=1; Hyphantria cunea nucleopolyhedrovirus|Rep: 1629capsid - Hyphantria cunea nuclear polyhedrosis virus (HcNPV) Length = 539 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P + PPPP P Sbjct: 240 PPPPTPPPPPPNMPPPPPPPPNMPPPPPPPPP 271 >UniRef50_A5Z1X1 Cluster: Myristylated membrane protein; n=7; Ranavirus|Rep: Myristylated membrane protein - Rana grylio virus 9506 Length = 323 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P + P PP P Sbjct: 264 PPPPPKPTPPTPHTPLTPLTPPTPPTPPTPPTP 296 >UniRef50_Q0AVD5 Cluster: Putative uncharacterized protein; n=2; Syntrophomonas wolfei subsp. wolfei str. Goettingen|Rep: Putative uncharacterized protein - Syntrophomonas wolfei subsp. wolfei (strain Goettingen) Length = 166 Score = 33.5 bits (73), Expect = 9.7 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 538 FPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 FPPP P P P P P P PPPP P Sbjct: 99 FPPPIP-PRPPVPPCPPTPPRPPVPPCPPPPPCP 131 >UniRef50_A6APN4 Cluster: Insecticidal toxin, SepC/Tcc class; n=2; Vibrio harveyi|Rep: Insecticidal toxin, SepC/Tcc class - Vibrio harveyi HY01 Length = 378 Score = 33.5 bits (73), Expect = 9.7 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P P + G PPPP P G P Sbjct: 82 PPPPPPPRMAPPPPP-----PPAGGMPPPPPPPMGGGAPPPP 118 >UniRef50_Q8W5K6 Cluster: Putative uncharacterized protein OSJNBa0079B05.10; n=4; Oryza sativa|Rep: Putative uncharacterized protein OSJNBa0079B05.10 - Oryza sativa (Rice) Length = 1269 Score = 33.5 bits (73), Expect = 9.7 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPPGXA 1081 P P P PPP P PPP PPP P PP A Sbjct: 600 PSPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPA 655 >UniRef50_Q5ZA46 Cluster: Putative uncharacterized protein P0501G08.18; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein P0501G08.18 - Oryza sativa subsp. japonica (Rice) Length = 109 Score = 33.5 bits (73), Expect = 9.7 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGG 507 G GGGG P C G G G A G GG + AP GG Sbjct: 41 GGGGGGYEPAAVAACARCGGGGPGRARAGGGG--HEAAAPAVGG 82 >UniRef50_Q5VS40 Cluster: Putative glycine-rich protein; n=3; Oryza sativa|Rep: Putative glycine-rich protein - Oryza sativa subsp. japonica (Rice) Length = 174 Score = 33.5 bits (73), Expect = 9.7 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGG 507 G GGGG G G G G AG G GGG K GG Sbjct: 44 GGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGG 87 >UniRef50_Q3ECQ3 Cluster: Uncharacterized protein At1g54215.1; n=1; Arabidopsis thaliana|Rep: Uncharacterized protein At1g54215.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 169 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P P P P P G PPPP Sbjct: 49 PPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 >UniRef50_Q08194 Cluster: Cysteine-rich extensin-like protein-1; n=4; Nicotiana tabacum|Rep: Cysteine-rich extensin-like protein-1 - Nicotiana tabacum (Common tobacco) Length = 209 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P +PPPP P Sbjct: 96 PPPRPRPCPSPPPPPQPRPRPSPPPPSPPPPAP 128 >UniRef50_A2X6K1 Cluster: Putative uncharacterized protein; n=3; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 134 Score = 33.5 bits (73), Expect = 9.7 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGGXXXSPXXGXXXXAXP 462 G GGGG G G G G G G GGG GG P G + P Sbjct: 48 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPPWNGGYYPSGP 106 >UniRef50_Q9VEJ1 Cluster: CG5836-PA; n=10; Eumetazoa|Rep: CG5836-PA - Drosophila melanogaster (Fruit fly) Length = 787 Score = 33.5 bits (73), Expect = 9.7 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP G PPP A P P G APPPP P Sbjct: 723 PPIPGTLPPLIPPPPGTSAPPMPPWGGGAYSGWGGGYAPPPPPP 766 >UniRef50_O45522 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 241 Score = 33.5 bits (73), Expect = 9.7 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 538 FPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 + PP P P P P P P PPPP P Sbjct: 83 YVPPAPLPPPPPPASPCCGPSPVPAPCCPPPPAP 116 >UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU07438.1; n=1; Neurospora crassa|Rep: Putative uncharacterized protein NCU07438.1 - Neurospora crassa Length = 636 Score = 33.5 bits (73), Expect = 9.7 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 5/65 (7%) Frame = +1 Query: 460 RGXAXXXXPXXGXXXXPPXRGAXXFFFPPPXPXPA-----XPXPXXPXXXXXPXSXGXAP 624 R A P PP PPP P PA P P P P AP Sbjct: 433 RSPAPPQAPPLPTSNAPPPPPLPATQAPPPPPLPATSAPPPPPPAPPAPPAPPLPAAHAP 492 Query: 625 PPPXP 639 PPP P Sbjct: 493 PPPPP 497 Score = 33.5 bits (73), Expect = 9.7 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +1 Query: 484 PXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXT 663 P PP A PP P P P P S G PPPP P G Sbjct: 464 PLPATSAPPPPPPAPPAPPAPPLPAAHAPPPPPPMPPMPAPSGGAPPPPPPPPPGGMGGV 523 Query: 664 P 666 P Sbjct: 524 P 524 >UniRef50_Q5KG31 Cluster: Putative uncharacterized protein; n=3; Basidiomycota|Rep: Putative uncharacterized protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 464 Score = 33.5 bits (73), Expect = 9.7 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP R A PP P A P P P G APPPP P Sbjct: 286 PPGRPAAPPSAPPSAPS-APPPPPPPPPPVRSDGTGVAPPPPPP 328 >UniRef50_Q92558 Cluster: Wiskott-Aldrich syndrome protein family member 1; n=22; Euteleostomi|Rep: Wiskott-Aldrich syndrome protein family member 1 - Homo sapiens (Human) Length = 559 Score = 33.5 bits (73), Expect = 9.7 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +2 Query: 920 SPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPPGXA 1081 SPTP PPP P P PPP PP A A PP A Sbjct: 321 SPTPPPPPPPLPSALSTSSLRASMTSTPPPPVP-PPPPPPATALQAPAVPPPPA 373 >UniRef50_Q99954 Cluster: Submaxillary gland androgen-regulated protein 3 homolog A precursor; n=10; Eutheria|Rep: Submaxillary gland androgen-regulated protein 3 homolog A precursor - Homo sapiens (Human) Length = 134 Score = 33.5 bits (73), Expect = 9.7 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = +1 Query: 460 RGXAXXXXPXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 RG P PP F PPP P P P P P G PP P P Sbjct: 24 RGPRGPYPPGPLAPPPPPRFPFGTGFVPPPHPPPYGPG-RFPPPLSPPYGPGRIPPSPPP 82 Query: 640 XXXGGXXTPH 669 G H Sbjct: 83 PYGPGRIQSH 92 >UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|Rep: Inverted formin-2 - Mus musculus (Mouse) Length = 1273 Score = 33.5 bits (73), Expect = 9.7 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 6/55 (10%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPX------PXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PP G+ PPP P P P P P P S PPPP P G Sbjct: 481 PPLPGSGTISPPPPPPPPPLPGTGAVSPPPPPPLPSLPDSHKTQPPPPPPPPLPG 535 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 408,269,075 Number of Sequences: 1657284 Number of extensions: 6111901 Number of successful extensions: 95750 Number of sequences better than 10.0: 199 Number of HSP's better than 10.0 without gapping: 22398 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69646 length of database: 575,637,011 effective HSP length: 102 effective length of database: 406,594,043 effective search space used: 104901263094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -