BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_C13 (1083 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 39 0.008 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 37 0.024 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 37 0.032 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 35 0.098 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 35 0.098 03_01_0515 - 3864796-3865425 35 0.098 02_05_0686 - 30900748-30902167,30903442-30904742 35 0.098 07_03_0309 + 16569201-16569468,16570310-16570534,16570860-16571176 35 0.13 03_01_0023 + 198414-198968 34 0.23 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 34 0.23 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 33 0.30 07_01_0080 + 587674-588510 33 0.30 06_01_0178 + 1386981-1387505 33 0.30 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 33 0.39 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 33 0.39 12_02_0299 - 17051570-17052474,17053542-17053755 33 0.52 08_01_0059 - 394001-394708 33 0.52 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 33 0.52 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 33 0.52 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 33 0.52 02_05_0584 - 30135768-30135790,30136104-30136866 33 0.52 02_04_0400 - 22608519-22608844,22609044-22609122 33 0.52 12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758,417... 32 0.69 10_08_0216 - 15942379-15942852,15942956-15943033 32 0.69 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 32 0.69 07_01_0479 + 3606663-3607448 32 0.69 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 32 0.91 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 32 0.91 12_02_0450 + 19172812-19172920,19173020-19173088,19173168-191732... 31 1.2 07_03_0558 + 19461369-19462448 31 1.2 06_03_0790 - 24636805-24637770 31 1.2 03_02_0765 + 11000724-11002496 31 1.2 12_02_1174 - 26696869-26698191 31 1.6 07_03_1751 - 29215074-29216270 31 1.6 07_03_1136 + 24218601-24218734,24218769-24219906 31 1.6 07_03_0559 + 19475893-19476783 31 1.6 06_02_0125 + 12122812-12122911,12123647-12123993 31 1.6 06_01_0486 - 3455030-3455770 31 1.6 07_03_0890 - 22332768-22333382 31 2.1 03_06_0427 - 33857008-33857137,33857224-33857258,33857966-338580... 31 2.1 03_06_0327 - 33158131-33158315,33158586-33158639,33159149-331591... 31 2.1 02_04_0382 - 22501041-22501279,22501717-22501810 31 2.1 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 31 2.1 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 30 2.8 07_03_0387 - 17536026-17536636,17536772-17537150 30 2.8 07_03_0177 - 14770777-14772045 30 2.8 04_04_1125 + 31085106-31085714 30 2.8 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 30 2.8 01_06_1377 + 36764461-36765339 30 2.8 12_01_0362 - 2746626-2747726,2748358-2748982,2749086-2749156 30 3.7 11_01_0133 + 1121392-1122731,1123417-1123858 30 3.7 10_08_0630 - 19410852-19411235,19411370-19412257,19412440-194129... 30 3.7 10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526,595... 30 3.7 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 30 3.7 09_04_0112 - 14757947-14758972 30 3.7 07_03_0560 + 19479597-19480667 30 3.7 06_03_1042 - 27089563-27089594,27090017-27090577,27090740-27090797 30 3.7 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 30 3.7 04_03_0904 + 20717005-20718087 30 3.7 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 30 3.7 03_05_0919 - 28792790-28792915,28793090-28793155,28794345-287945... 30 3.7 01_01_0570 - 4231100-4232560 30 3.7 09_02_0543 + 10427321-10428315,10428440-10429154 29 4.8 08_02_1084 - 24232968-24234779 29 4.8 06_03_1326 - 29355467-29355817 29 4.8 04_04_0679 + 27214577-27215023 29 4.8 03_05_0732 - 27232299-27232535,27232717-27232746,27233094-272331... 29 4.8 03_05_0364 + 23495069-23495483,23496056-23496136,23496381-234964... 29 4.8 02_04_0021 + 18975992-18976408 29 4.8 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 29 4.8 01_02_0031 + 10364487-10365407 29 4.8 12_01_0840 - 7847239-7847531,7847576-7847675,7848312-7848388,784... 29 6.4 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 29 6.4 10_03_0012 - 7037088-7037282,7037453-7037954,7038079-7038081,704... 29 6.4 08_01_0202 - 1638978-1639571 29 6.4 07_03_1710 - 28903614-28903673,28904982-28905146,28905453-289056... 29 6.4 07_01_0516 - 3850252-3852870 29 6.4 06_02_0127 + 12140843-12140966,12141170-12141567 29 6.4 06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-38... 29 6.4 05_07_0031 - 27183252-27183317,27183542-27184282 29 6.4 04_04_0057 + 22410167-22411330 29 6.4 03_02_0234 + 6625417-6626184,6626314-6626339,6626435-6626531,662... 29 6.4 02_04_0264 - 21393029-21393046,21394249-21394814,21395005-21395623 29 6.4 02_04_0171 + 20581995-20582354,20582509-20583141,20584954-20585058 29 6.4 02_04_0170 + 20576149-20576889 29 6.4 02_02_0240 + 8196140-8198248,8198381-8198650 29 6.4 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 29 6.4 01_06_0146 + 26969011-26969995,26970878-26970930 29 6.4 01_03_0005 + 11568545-11569119,11569179-11569191 29 6.4 01_01_0073 + 555485-556315 29 6.4 01_06_1805 - 39999987-40000169,40000648-40000974,40001724-400020... 27 7.4 06_03_1146 - 28004896-28005554,28005664-28005844 29 8.5 05_04_0303 - 20010761-20011756 29 8.5 04_04_1413 - 33386049-33386339 29 8.5 04_04_0233 + 23801944-23802598,23802914-23803047,23803548-238037... 29 8.5 04_04_0198 + 23502657-23502900,23505228-23505298,23505690-235057... 29 8.5 03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655,904... 29 8.5 02_04_0654 - 24755339-24755408,24755488-24755624,24756243-247563... 29 8.5 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 29 8.5 01_05_0490 + 22672241-22674679 29 8.5 01_01_0995 + 7875273-7875495,7876196-7876274,7876422-7876536,787... 29 8.5 01_01_0715 - 5542648-5543219,5543352-5543544 29 8.5 01_01_1162 - 9253034-9254229,9254387-9254456,9254473-9254567,925... 25 9.4 11_01_0387 + 2922208-2922704,2922956-2923088,2923487-2923549,292... 26 9.7 02_05_1277 - 35408097-35409080 25 9.8 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 38.7 bits (86), Expect = 0.008 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +1 Query: 508 PPXRGAXX-FFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP +GA F PPP P P P P P P PPP P Sbjct: 42 PPPQGAPPPFLAPPPPPPPGPPPPHQPQFNFGPGPPQQQQPPPPP 86 Score = 33.1 bits (72), Expect = 0.39 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +2 Query: 899 GXXXXPXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPPG 1075 G P P GPPP P PPP PPP P PG Sbjct: 17 GFPPQPPPMNPYGPPPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPPHQPQFNFGPG 75 Score = 33.1 bits (72), Expect = 0.39 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +1 Query: 541 PPPXPXP-AXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P P A P P P P APPPP Sbjct: 112 PPPSPPPSAPPPPPPPPTQPPPREAQLAPPPP 143 Score = 29.5 bits (63), Expect = 4.8 Identities = 16/41 (39%), Positives = 19/41 (46%), Gaps = 5/41 (12%) Frame = +1 Query: 532 FFFPPPXPXP-----AXPXPXXPXXXXXPXSXGXAPPPPXP 639 ++ PPP P P + P P P P S APPPP P Sbjct: 89 YYQPPPPPPPYGVNSSQPPPPPPPPPSPPPS---APPPPPP 126 Score = 29.1 bits (62), Expect = 6.4 Identities = 16/55 (29%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXX--PPPXPPPXXXPAXAXPP 1072 P P P GPPP P PPP PPP + PP Sbjct: 54 PPPPPPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMYYQPPPPPPPYGVNSSQPPP 108 Score = 23.4 bits (48), Expect(2) = 9.2 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 914 PXSPTPXGPPPXXP 955 P SP P PPP P Sbjct: 113 PPSPPPSAPPPPPP 126 Score = 23.4 bits (48), Expect(2) = 9.2 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 Query: 1010 PTXXPPPXPPPXXXPAXAXPP 1072 P PPP PP A PP Sbjct: 122 PPPPPPPTQPPPREAQLAPPP 142 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 37.1 bits (82), Expect = 0.024 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P G A PPP P Sbjct: 27 PPPPPHPPPPPPLEPAPPSTPQLRGEASPPPPP 59 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 36.7 bits (81), Expect = 0.032 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PPP P P P P P APPPP P G Sbjct: 265 PPPPPPPPPPPPMPPRTDNASTQAAPAPPPPLPRAGNG 302 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 35.1 bits (77), Expect = 0.098 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PPP P PA P P P PPPP P G Sbjct: 207 PPPPPLPASSEPVDPSAASLPPLPPPPPPPPKPANIAG 244 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 35.1 bits (77), Expect = 0.098 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP PA P P P G PPPP P Sbjct: 322 PPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPP 354 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P PA P P P PPPP GG P Sbjct: 349 PPPPPPPAAPAAPRP-----PGPGPGPPPPPGAAGRGGGGPP 385 Score = 28.7 bits (61), Expect = 8.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXG 651 PPP P P P P G PPPP P G Sbjct: 276 PPPPAGPPPPAPP-PLPPSHHHHHGHHPPPPHPLPPG 311 >03_01_0515 - 3864796-3865425 Length = 209 Score = 35.1 bits (77), Expect = 0.098 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +1 Query: 484 PXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 P PP A PPP P P P P +PPPP P Sbjct: 53 PPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPP 104 Score = 32.7 bits (71), Expect = 0.52 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P PA P P P +PPPP Sbjct: 89 PPPPPPPAASPPPPPPSPPPPSPVKSSPPPP 119 Score = 32.3 bits (70), Expect = 0.69 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +1 Query: 484 PXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 P G PP PPP P P P P P S PPPP P Sbjct: 64 PAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPS----PPPPSP 111 Score = 31.1 bits (67), Expect = 1.6 Identities = 17/55 (30%), Positives = 19/55 (34%), Gaps = 4/55 (7%) Frame = +2 Query: 920 SPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXX----PPPXPPPXXXPAXAXPP 1072 SP P PPP P+ PPP PPP PA + PP Sbjct: 47 SPPPLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPP 101 Score = 30.3 bits (65), Expect = 2.8 Identities = 16/55 (29%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPP--PXXXPAXAXPP 1072 P + P PPP P P PPP PP P P + PP Sbjct: 63 PPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPPSPVKSSPP 117 Score = 29.1 bits (62), Expect = 6.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P A P P P PPPP Sbjct: 90 PPPPPPAASPPPPPPSPPPPSPVKSSPPPPP 120 Score = 28.7 bits (61), Expect = 8.5 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P S + PPP P Sbjct: 89 PPPPPPPAASPPPPPPSPPPPSPVKSSPPPPP 120 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 35.1 bits (77), Expect = 0.098 Identities = 22/61 (36%), Positives = 23/61 (37%) Frame = +1 Query: 484 PXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXT 663 P G PP +G PPP P P P P P P PPPP P GG Sbjct: 340 PPKGPPPPPPAKG------PPPPPPPKGPSPPPPPP---PGGKKGGPPPPPP--KGGASR 388 Query: 664 P 666 P Sbjct: 389 P 389 Score = 34.7 bits (76), Expect = 0.13 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PP + A PPP P A P P P + G PPPP Sbjct: 317 PPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPP 358 Score = 34.7 bits (76), Expect = 0.13 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P A P P P P PPPP P Sbjct: 317 PPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPP 349 Score = 34.3 bits (75), Expect = 0.17 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P A P P P P PPPP P Sbjct: 327 PPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPP 359 Score = 33.5 bits (73), Expect = 0.30 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P PPPP P Sbjct: 326 PPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPP 358 Score = 33.5 bits (73), Expect = 0.30 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PP P P P P P P P PP P GG Sbjct: 336 PPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGG 372 Score = 33.1 bits (72), Expect = 0.39 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP + A PPP P P P P G +PPPP P Sbjct: 330 PPPKAAP----PPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPP 369 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/54 (27%), Positives = 15/54 (27%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPPG 1075 P P PPP P PPP PP P PPG Sbjct: 318 PPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPG 371 >07_03_0309 + 16569201-16569468,16570310-16570534,16570860-16571176 Length = 269 Score = 34.7 bits (76), Expect = 0.13 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -2 Query: 653 PPXXXGXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKK 534 PP G GGGG G G AG G GGG+K Sbjct: 15 PPGGGGGGGGGEEEEDSSLAVGEAAVGVGEAGGGGGGGEK 54 >03_01_0023 + 198414-198968 Length = 184 Score = 33.9 bits (74), Expect = 0.23 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -2 Query: 668 CGVXXPPXXXGXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGG 507 CG P G GGGG G G G G G GGG GG Sbjct: 29 CGSCPSPGGGGGGGGGGGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGG 82 Score = 30.3 bits (65), Expect = 2.8 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGGXXXSPXXG 483 G GGGG G G G G G GGG GG S G Sbjct: 44 GGGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGGG 95 Score = 29.1 bits (62), Expect = 6.4 Identities = 17/59 (28%), Positives = 18/59 (30%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGGXXXSPXXGXXXXAXP 462 G GGGG G G G G +G G GG GG G P Sbjct: 43 GGGGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGGGGGGRCP 101 Score = 28.7 bits (61), Expect = 8.5 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -2 Query: 668 CGVXXPPXXXGXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGG 507 C P G GGGG G G G G +G G GGG GG Sbjct: 27 CQCGSCPSPGGGGGGGGGGGGGG----GGRGGGGGSGGGSGGGGGSGGGGSGGG 76 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 33.9 bits (74), Expect = 0.23 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P G APPP P Sbjct: 359 PPPPPPPPPPPPPRPPPPPPPIKKG-APPPAPP 390 Score = 32.7 bits (71), Expect = 0.52 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PPP P Sbjct: 357 PPPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAP 389 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXG 651 PPP P P P P P P PPPP P G Sbjct: 353 PPPPPPPPPPPPPPPPPPPRP------PPPPPPIKKG 383 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 33.5 bits (73), Expect = 0.30 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPPGXA 1081 P P P PPP P PPP PPP P PP A Sbjct: 600 PSPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPA 655 Score = 32.7 bits (71), Expect = 0.52 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PP G F PPP P P P P P PPPP Sbjct: 552 PPPSGNKPAFSPPPPP-PPPPPPPLPQSNYASSQPPPPPPPP 592 Score = 31.1 bits (67), Expect = 1.6 Identities = 17/57 (29%), Positives = 18/57 (31%), Gaps = 4/57 (7%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXX----PPPXPPPXXXPAXAXPP 1072 P P P PPP P P PPP PPP P + PP Sbjct: 563 PPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPP 619 Score = 29.9 bits (64), Expect = 3.7 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXP-XSXGXAPPPPXPXXXGGXXTP 666 PPP P P+ P P + APPPP P TP Sbjct: 637 PPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPPPRSSSRTP 679 Score = 29.9 bits (64), Expect = 3.7 Identities = 13/42 (30%), Positives = 14/42 (33%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P + PPPP G P Sbjct: 689 PPPPPPPPLPPANRTNGPGVPSAPPPPPPPPPANRSNGPSAP 730 Score = 29.5 bits (63), Expect = 4.8 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP G F PP P P S G PPPP P Sbjct: 653 PPAPGIGNKFPAPPPPPPPPRSSSRTPTGAATSSKGPPPPPPPP 696 Score = 29.1 bits (62), Expect = 6.4 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P PPPP P Sbjct: 544 PPPPPPPPPPPSGNKPAFSPPPPPPPPPPPPLP 576 >07_01_0080 + 587674-588510 Length = 278 Score = 33.5 bits (73), Expect = 0.30 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PP G F PP P P P P P PPPP Sbjct: 79 PPRLGGDGMFRRPPPPPPPPPSSGSPPPPPPPPPPPPPPPPP 120 >06_01_0178 + 1386981-1387505 Length = 174 Score = 33.5 bits (73), Expect = 0.30 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGG 507 G GGGG G G G G AG G GGG K GG Sbjct: 44 GGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGG 87 Score = 31.1 bits (67), Expect = 1.6 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGGXXXSPXXG 483 G GGGG G G G G AG G GGG K GG S G Sbjct: 68 GAGGGGGGGGGKGR--KGGAGGHGGAGGGGGGGGGKGRKGGRGGDGGSGGAG 117 Score = 28.7 bits (61), Expect = 8.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGG 507 G GGGG G G G G G GGG R GG Sbjct: 41 GGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGG 84 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 33.1 bits (72), Expect = 0.39 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXA-PPPPXPXXXG 651 PPP P P P P P P + PPPP P G Sbjct: 425 PPPPPLPPPPPPPPPPPPPLPPNMPPPLPPPPEPELNG 462 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 33.1 bits (72), Expect = 0.39 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P P P P P P PPPP Sbjct: 351 PPPPPPPPPPPPPPPKLNTAPKPPPPPPPPP 381 Score = 32.7 bits (71), Expect = 0.52 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P P P P P PPPP P P Sbjct: 349 PPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVPSNNNLP 390 Score = 28.7 bits (61), Expect = 8.5 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 1010 PTXXPPPXPPPXXXPAXAXPP 1072 P+ PPP PPP P PP Sbjct: 345 PSNAPPPPPPPPPPPPPPPPP 365 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 32.7 bits (71), Expect = 0.52 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP F FP P P P P P P P +PPPP P Sbjct: 252 PPSPPPPAFPFPLP-PWPWAPPPAFPFPHLPPIFSPPSPPPPPP 294 Score = 30.3 bits (65), Expect = 2.8 Identities = 15/52 (28%), Positives = 17/52 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXP 1069 P SP P PP P+ PPP PPP P+ P Sbjct: 286 PPSPPPPPPPAFPFPFPQLPPLPHFPPLPSFYPSPPPPPPPPPPPPPSFPWP 337 Score = 29.1 bits (62), Expect = 6.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP F FP P P P P P PPPP P Sbjct: 289 PPPPPPPAFPFPFPQLPPLPHFPPLPSFYPSPPPPPPPPPPPPP 332 >08_01_0059 - 394001-394708 Length = 235 Score = 32.7 bits (71), Expect = 0.52 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXS-XGXAPPPP 633 PP R PPP P A P P P P + APPPP Sbjct: 6 PPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPP 48 Score = 30.3 bits (65), Expect = 2.8 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P A P P P P APPPP P Sbjct: 3 PPPPPRRAPPPPATP-----PPPPRRAPPPPSP 30 Score = 29.5 bits (63), Expect = 4.8 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +1 Query: 541 PPPXPXP---AXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P A P P P P AP PP P Sbjct: 34 PPPPPTPRPYAPPPPSHPLAPPPPHISPPAPVPPPP 69 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 32.7 bits (71), Expect = 0.52 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P+ P P P P PPPP P Sbjct: 1183 PPPPPLPSGPPPQ-PAPPPLPIQPPPIPPPPVP 1214 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P PA P P P P PPPP P G P Sbjct: 1161 PPSPPPATPPPPPPLSPSLP-----PPPPPPPLPSGPPPQP 1196 Score = 29.5 bits (63), Expect = 4.8 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = +1 Query: 541 PPPXPXPAXPXP----XXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P S A PPP P Sbjct: 1137 PPPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPP 1173 Score = 29.1 bits (62), Expect = 6.4 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +2 Query: 923 PTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPP---XXXPAXAXPP 1072 P P PP P P+ PPP PPP P A PP Sbjct: 1148 PLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPPPQPAPPP 1200 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 32.7 bits (71), Expect = 0.52 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P P PPPP P Sbjct: 89 PPPPPPLLPTPPPPPASISPTPAPPLPPPPAP 120 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 32.7 bits (71), Expect = 0.52 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P S G A PPP P Sbjct: 367 PPPPPPPPPPPPAVTQQQDVKTSCGPAVPPPPP 399 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXP 1054 P P P PPP P P PP PPP P Sbjct: 365 PPPPPPPPPPPPPPAVTQQQDVKTSCGPAVPPPPPPTPPPPPPLLAP 411 >02_05_0584 - 30135768-30135790,30136104-30136866 Length = 261 Score = 32.7 bits (71), Expect = 0.52 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +1 Query: 493 GXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 G PP G+ F FP P P P P P P P S P P P Sbjct: 80 GAGGAPPSAGSGGFPFPLPFPLP-LPAPGSPAAGAPPSSGSSGFPFPMP 127 Score = 28.7 bits (61), Expect = 8.5 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAP-PPPXP 639 PP G+ F FP P P P P P P S P P P P Sbjct: 114 PPSSGSSGFPFPMPSPLP-LPAHGSPAAGAPPSSGSGLPFPLPFP 157 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 32.7 bits (71), Expect = 0.52 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGGXXXSPXXGXXXXAXP 462 G GGGG G G G G G G GGG GG P G P Sbjct: 48 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPPWNGGYYPPGP 106 Score = 32.7 bits (71), Expect = 0.52 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGGXXXSPXXG 483 G GGGG G G G G G G GGG P G P G Sbjct: 56 GGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPPWNGGYYPPGPG 107 Score = 30.3 bits (65), Expect = 2.8 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGGXXXSP 492 G GGGG G G G G G G GGG GG P Sbjct: 47 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYP 95 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGG 67 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGG 69 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGG 72 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGG 74 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 44 GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 76 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 45 GGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGG 77 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 71 Score = 29.1 bits (62), Expect = 6.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -1 Query: 1071 GGXAXAGXXXGGGXGGGXXVGXXXXXXXXXXXXXXXXGXGXXGGGPXGVGEXG 913 GG G GGG GGG G G G GGG G G G Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 86 >12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758, 4171814-4171891,4174482-4174569,4174659-4174850, 4174939-4175802 Length = 493 Score = 32.3 bits (70), Expect = 0.69 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PPP P + P P P + AP PP P GG Sbjct: 149 PPPPPQESTPPPPPPPPPAPVAAAVSAPAPPSPASQGG 186 >10_08_0216 - 15942379-15942852,15942956-15943033 Length = 183 Score = 32.3 bits (70), Expect = 0.69 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -1 Query: 1071 GGXAXAGXXXGGGXGGGXXVGXXXXXXXXXXXXXXXXGXGXXGGGPXGVGEXG 913 GG A +G GGG GGG G G GGG G G G Sbjct: 72 GGAAASGGGGGGGGGGGYGYGAGGGYGQAGGPYYGPYASGGGGGGAGGGGGGG 124 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 32.3 bits (70), Expect = 0.69 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P P P P P S PPPP Sbjct: 600 PPPPPKSTGPGPPRPPPPAMPGSSKTRPPPP 630 Score = 31.9 bits (69), Expect = 0.91 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPP-PPXPXXXGGXXT 663 PPP P P P P P S G PP PP P G T Sbjct: 585 PPPEPSP-PPAPKAAPPPPPPKSTGPGPPRPPPPAMPGSSKT 625 >07_01_0479 + 3606663-3607448 Length = 261 Score = 32.3 bits (70), Expect = 0.69 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXG 651 PPP P P P P G PPPP P G Sbjct: 175 PPPMRPPQMPIPFQRPPGVPPAFPGGPPPPPGPFMRG 211 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 31.9 bits (69), Expect = 0.91 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PP P PA P P P + PPPP P G Sbjct: 323 PPSNPPPAPPPPPPPPSRFNNTTPKPPPPPPPPEPPTG 360 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 31.9 bits (69), Expect = 0.91 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +1 Query: 493 GXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 G PP G PPP P P P G PPPP GG P Sbjct: 1107 GAPPPPPPPGGITGV-PPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAP 1163 Score = 30.3 bits (65), Expect = 2.8 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 8/50 (16%) Frame = +1 Query: 541 PPPXPX------PAXPXPXXPXXXXXPXSX--GXAPPPPXPXXXGGXXTP 666 PPP P PA P P P + G APPPP P GG P Sbjct: 1149 PPPPPVGGLGGPPAPPPPAGFRGGTPPPNAHGGVAPPPPPPRGHGGVGGP 1198 Score = 28.7 bits (61), Expect = 8.5 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P S G PPP P G P Sbjct: 1082 PPLPPPLPPTLGDYGVAPPPPSIGAGAPPPPPPPGGITGVP 1122 >12_02_0450 + 19172812-19172920,19173020-19173088,19173168-19173274, 19173874-19174365 Length = 258 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGG 507 G GGGG G G G G +G G GGG + GG Sbjct: 125 GYGGGGGGYGGGGYSGGGGYGGGGYSGGGGGGGGYQGGGGGYGG 168 >07_03_0558 + 19461369-19462448 Length = 359 Score = 31.5 bits (68), Expect = 1.2 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 1080 AXPGGXAXAGXXXGGGXGGGXXVGXXXXXXXXXXXXXXXXGXGXXGGGPXGVGEXG 913 A GG A G GGG GGG G G GGG G G G Sbjct: 121 AGAGGGAGGGLGGGGGFGGGGGGGLGGGGGHGGGFGAGGGVGGGAGGGVGGGGGFG 176 Score = 29.1 bits (62), Expect = 6.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G AG G GGG Sbjct: 102 GGGGGGGLGGGQGGGFGGGAGAGGGAGGGLGGG 134 >06_03_0790 - 24636805-24637770 Length = 321 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -2 Query: 665 GVXXPPXXXGXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGG 507 GV G GGGG G G G G G G GGG + GG Sbjct: 78 GVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGG 130 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGG 507 G GGGG G G G G G G GGG+ GG Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGG 131 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 101 GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 133 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 102 GGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGG 134 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 104 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGG 136 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 105 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 137 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 106 GGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGG 138 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 107 GGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 139 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 108 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 140 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 110 GGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 142 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 111 GGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 143 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 112 GGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 144 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 113 GGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 145 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 114 GGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGG 146 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 115 GGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGG 147 >03_02_0765 + 11000724-11002496 Length = 590 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G AG G GGG Sbjct: 207 GAGGGGGLGGGAGGGLGGGAGGGGGAGGGLGGG 239 Score = 30.3 bits (65), Expect = 2.8 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGG 507 G GGGG G G G G G G GGG GG Sbjct: 157 GAGGGGGLGGGAGGGLGGGAGGGGGVGGGLGGGAGGGLGSGAGG 200 Score = 30.3 bits (65), Expect = 2.8 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = -1 Query: 1071 GGXAXAGXXXGGGXGGGXXVGXXXXXXXXXXXXXXXXGXGXXGGGPXGVGEXG 913 G A G GGG GGG +G G GGG G G G Sbjct: 195 GSGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAGGGGGAGGGLGGGAGGGGGLG 247 Score = 30.3 bits (65), Expect = 2.8 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -1 Query: 1071 GGXAXAGXXXGGGXGGGXXVGXXXXXXXXXXXXXXXXGXGXXGGGPXG 928 GG A AG GGG GGG G G GGG G Sbjct: 479 GGGAGAGTGGGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGGFGGGKGG 526 Score = 30.3 bits (65), Expect = 2.8 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGGXXXSPXXG 483 G GGG G G G AG G GGGK GG S G Sbjct: 491 GLGGGAGGGGGLGGGAGGGLGGGAGAGGGFGGGKGGGFGGGLGGSSGSGFGG 542 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 632 GGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 GGGG G G G G AG G GGG Sbjct: 37 GGGGGFGGGGGFGGGGGLGGGGGAGGGFGGG 67 Score = 29.5 bits (63), Expect = 4.8 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -1 Query: 1071 GGXAXAGXXXGGGXGGGXXVGXXXXXXXXXXXXXXXXGXGXXGGGPXGVGEXG 913 GG G GGG GGG G G GGG G G G Sbjct: 79 GGGKGGGLGGGGGLGGGGGAGGGFGGGLGHGGGLGGGFGGGKGGGLGGGGGLG 131 Score = 29.5 bits (63), Expect = 4.8 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = -1 Query: 1071 GGXAXAGXXXGGGXGGGXXVGXXXXXXXXXXXXXXXXGXGXXGGGPXG 928 GG AG GGG GGG +G G GGG G Sbjct: 227 GGGGGAGGGLGGGAGGGGGLGGGAGGGLGGGAGGGGGLSGGAGGGLGG 274 Score = 28.7 bits (61), Expect = 8.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -1 Query: 1071 GGXAXAGXXXGGGXGGGXXVGXXXXXXXXXXXXXXXXGXGXXGGGPXG 928 GG A G GGG GGG G G G GGG G Sbjct: 205 GGGAGGGGGLGGGAGGGLGGGAGGGGGAGGGLGGGAGGGGGLGGGAGG 252 >12_02_1174 - 26696869-26698191 Length = 440 Score = 31.1 bits (67), Expect = 1.6 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PP + PPP P P P P P P PPP Sbjct: 142 PPVKPQPPPSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPPP 183 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPPG 1075 P S P PPP P PT PPP PPP PG Sbjct: 182 PPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPPTL-PPPSPPPPPPTVPPRTPG 234 Score = 29.5 bits (63), Expect = 4.8 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P +PPPP P Sbjct: 163 PPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPP 195 Score = 29.1 bits (62), Expect = 6.4 Identities = 16/54 (29%), Positives = 17/54 (31%), Gaps = 3/54 (5%) Frame = +2 Query: 920 SPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPP---PXPPPXXXPAXAXPP 1072 SP P PPP P+ PP P PPP P PP Sbjct: 120 SPVPPPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPPPPPPRPPSVKPP 173 >07_03_1751 - 29215074-29216270 Length = 398 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = -1 Query: 1080 AXPGGXAXAGXXXGGGXGGGXXVGXXXXXXXXXXXXXXXXGXGXXGGGPXGVGEXG 913 A G A G GGG GGG +G G GGG G G G Sbjct: 257 AGGGAGAGGGLGAGGGAGGGGGIGGGAGGGAGAGGGFGGGKGGGFGGGGGGGGGAG 312 Score = 29.9 bits (64), Expect = 3.7 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -1 Query: 1071 GGXAXAGXXXGGGXGGGXXVGXXXXXXXXXXXXXXXXGXGXXGGGPXG 928 GG AG GGG GGG G G GGG G Sbjct: 132 GGGGGAGGGLGGGAGGGAGAGVGGGAGAGGGAGGGGGLGGGAGGGAGG 179 Score = 29.9 bits (64), Expect = 3.7 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = -1 Query: 1071 GGXAXAGXXXGGGXGGGXXVGXXXXXXXXXXXXXXXXGXGXXGGGPXGVGEXG 913 GG A AG GGG GGG G G GGG G G+ G Sbjct: 284 GGGAGAGGGFGGGKGGGFGGGGGGGGGAGAGGGFGGGKGGGFGGG-FGGGKGG 335 Score = 29.5 bits (63), Expect = 4.8 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -1 Query: 1071 GGXAXAGXXXGGGXGGGXXVGXXXXXXXXXXXXXXXXGXGXXGGGPXGVGE 919 GG A AG GGG GGG G G G GG G G+ Sbjct: 348 GGGAGAGGGFGGGKGGGFGGGVGGGHGAGGGGAGGGGGFGGGAGGGIGGGQ 398 Score = 29.1 bits (62), Expect = 6.4 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = -1 Query: 1071 GGXAXAGXXXGGGXGGGXXVGXXXXXXXXXXXXXXXXGXGXXGGGPXGVG 922 GG + G GGG GGG VG G GGG G+G Sbjct: 182 GGGSGGGGGLGGGAGGGAGVGGGAGGGAGGGGGLGGGAGGGAGGG-GGLG 230 Score = 29.1 bits (62), Expect = 6.4 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 1080 AXPGGXAXAGXXXGGGXGGGXXVGXXXXXXXXXXXXXXXXGXGXXGGGPXG 928 A GG A G GGG GGG G G G GGG G Sbjct: 199 AGVGGGAGGGAGGGGGLGGGAGGGAGGGGGLGGGAGGGHGGGGGLGGGAGG 249 Score = 28.7 bits (61), Expect = 8.5 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = -1 Query: 1071 GGXAXAGXXXGGGXGGGXXVGXXXXXXXXXXXXXXXXGXGXXG-GGPXGVGEXG 913 GG A G GGG GGG G G G G GG G G+ G Sbjct: 270 GGGAGGGGGIGGGAGGGAGAGGGFGGGKGGGFGGGGGGGGGAGAGGGFGGGKGG 323 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 31.1 bits (67), Expect = 1.6 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = -2 Query: 653 PPXXXGXGGG-GAXPXXXGXCXXXG-XXGXGXAGXGXGGGKKKXXAP 519 PP G GGG G P G G G G G G GGG + AP Sbjct: 172 PPGGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGLGGGGGEGGAP 218 Score = 29.1 bits (62), Expect = 6.4 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = -2 Query: 632 GGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGGXXXSPXXGXXXXAXP 462 GGGGA P G G G G GG + GG P G P Sbjct: 126 GGGGARPPAPGGGGGGGAPRRVLGGGGGGGALARPPGGGRGGALGRPPGGGGGGGGP 182 >07_03_0559 + 19475893-19476783 Length = 296 Score = 31.1 bits (67), Expect = 1.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G C G G G G GGG Sbjct: 86 GFGGGGGGGLGGGGCEGGGFGGGVGGGSGAGGG 118 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGK 537 G GGG G G G G G G GGGK Sbjct: 150 GVGGGSGTGGGLGGGGGGGFGGGGGGGIGGGGGK 183 >06_02_0125 + 12122812-12122911,12123647-12123993 Length = 148 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -2 Query: 668 CGVXXPPXXXGXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 CG P G GGG G G G G G G GGG Sbjct: 104 CGYGHPGHSGGYGGGYGGGYGGGYGGGGGYGGGGGYGGGHGGG 146 >06_01_0486 - 3455030-3455770 Length = 246 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P +P P PP P P PPP PP P PP Sbjct: 81 PPTPRPPPTPPYVPSPPPYVPPYIPPPTPPYVPPYIPPPTPPYVPPPTPPSPP 133 >07_03_0890 - 22332768-22333382 Length = 204 Score = 30.7 bits (66), Expect = 2.1 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +1 Query: 541 PPPXPX---PAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P + PPPP P Sbjct: 75 PPPPPAEATPPPPPPPPPPERAVPEAADTPPPPPPP 110 >03_06_0427 - 33857008-33857137,33857224-33857258,33857966-33858046, 33858213-33858338,33858410-33858568,33858797-33858934, 33859084-33859155,33859359-33860273 Length = 551 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGG 507 G GGGG G G G G +G G GGG GG Sbjct: 42 GGGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGGSSGGG 85 Score = 29.1 bits (62), Expect = 6.4 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 650 PXXXGXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 P GGGG G G G G G G GGG Sbjct: 34 PLLESDGGGGGGGGGGGSGGGGGGGGGGGGGGGSGGG 70 >03_06_0327 - 33158131-33158315,33158586-33158639,33159149-33159180, 33159275-33159369,33159466-33159539,33159643-33159778, 33159874-33159937,33160017-33160079,33160160-33160299, 33160487-33160627,33160747-33160868,33160947-33161112, 33161194-33161313,33161580-33161651,33161787-33161843, 33162036-33162152,33162231-33162369,33162794-33162900, 33162972-33163081,33163172-33163305,33163397-33163546, 33163635-33163840,33166123-33166818 Length = 1059 Score = 30.7 bits (66), Expect = 2.1 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = +1 Query: 460 RGXAXXXXPXXGXXXXPPXRGAXXFFFPPP--XPXPAXPXPXXPXXXXXPXSXGXAPPP 630 RG G PP R A F +PPP P P P P P G AP P Sbjct: 22 RGDVPGRGGGGGGGGAPPYRPASGFVWPPPGMTPRPGPPQPQYPRPGPPAVVYG-APMP 79 >02_04_0382 - 22501041-22501279,22501717-22501810 Length = 110 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +1 Query: 532 FFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 ++ PPP P P P P P S PPP P GG Sbjct: 53 YYDPPPSPDYYDP-PHSPDYYDPPPSPDYYDPPPSPYYGGG 92 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 30.7 bits (66), Expect = 2.1 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGK 537 G GGGG G G G G G G GGG+ Sbjct: 91 GGGGGGGYGGGGGGGRGGGGGGGGRGGGGRGGGR 124 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 51 GRGGGGGGGGGYGGGGVGGGYGGGGGGYGGGGG 83 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 61 GYGGGGVGGGYGGGGGGYGGGGGGYGGGGRGGG 93 Score = 29.5 bits (63), Expect = 4.8 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -2 Query: 632 GGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGG 507 GGGG G G G G G G GGG + GG Sbjct: 73 GGGGGYGGGGGGYGGGGRGGGGGGGYGGGGGGGRGGGGGGGG 114 Score = 29.5 bits (63), Expect = 4.8 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGGXXXSPXXGXXXXAXPR 459 G GGGG G G G G G G GGG R GG G PR Sbjct: 79 GGGGGGYGGGGRGGGGGGGYGGGGGGGRGGGGG----GGGRGGGGRGGGRDGDWVCPDPR 134 Score = 29.1 bits (62), Expect = 6.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 56 GGGGGGYGGGGVGGGYGGGGGGYGGGGGGYGGG 88 Score = 28.7 bits (61), Expect = 8.5 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -1 Query: 1071 GGXAXAGXXXGGGXGGGXXVGXXXXXXXXXXXXXXXXGXGXXGGGPXGVGEXG 913 GG G GGG GGG G G G GGG G G G Sbjct: 45 GGGGGRGRGGGGGGGGGYGGGGVGGGYGGGGGGYGGGGGGYGGGGRGGGGGGG 97 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 30.3 bits (65), Expect = 2.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P G PPPP P Sbjct: 920 PPPPRPPGAPPPPPP-----PGKPGGPPPPPPP 947 Score = 29.1 bits (62), Expect = 6.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P A P G PPPP P GG P Sbjct: 904 PPPAPS-ATANTASALSPPPPRPPGAPPPPPPPGKPGGPPPP 944 Score = 28.7 bits (61), Expect = 8.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P A P P P P PPPP P Sbjct: 921 PPPRPPGAPPPPPPPGKPGGPP-----PPPPPP 948 >07_03_0387 - 17536026-17536636,17536772-17537150 Length = 329 Score = 30.3 bits (65), Expect = 2.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P P P P P G APPPP P Sbjct: 180 PPLPLPL-PLPPAPVFPRVSTVLGVAPPPPLP 210 >07_03_0177 - 14770777-14772045 Length = 422 Score = 30.3 bits (65), Expect = 2.8 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = -1 Query: 1071 GGXAXAGXXXGGGXGGGXXVGXXXXXXXXXXXXXXXXGXGXXGGGPXGVG 922 GG G GGG GGG G G G GGG G+G Sbjct: 338 GGGLGGGFGKGGGIGGGFGKGGGLGGGGGLGGGGGGGGGGFGGGGGSGIG 387 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 66 GFGGGGGGGGGGGFGGGGGFGGGGGGGLGGGGG 98 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 68 GGGGGGGGGGGFGGGGGFGGGGGGGLGGGGGGG 100 >04_04_1125 + 31085106-31085714 Length = 202 Score = 30.3 bits (65), Expect = 2.8 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +2 Query: 923 PTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPPG 1075 PTP PPP P P P PP PA + P G Sbjct: 60 PTPWTPPPATPTPPTPTPWTPTPATPPPTPATPATPTTPPTPAPAPSTPTG 110 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 30.3 bits (65), Expect = 2.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXG 651 PP P P P P P PPPP P G Sbjct: 280 PPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANG 315 >01_06_1377 + 36764461-36765339 Length = 292 Score = 30.3 bits (65), Expect = 2.8 Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXG--XAPPPP 633 PP + +F PPP P + P P S G APPPP Sbjct: 163 PPPSSSPYYFPPPPPPAYSAPPPPQYGSEQYYRSGGYYSAPPPP 206 >12_01_0362 - 2746626-2747726,2748358-2748982,2749086-2749156 Length = 598 Score = 29.9 bits (64), Expect = 3.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P P PP P Sbjct: 255 PPPSPPHPRPQPPPPGSSDLPTDVAILPSPPHP 287 >11_01_0133 + 1121392-1122731,1123417-1123858 Length = 593 Score = 29.9 bits (64), Expect = 3.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP PA P P S PPPP P Sbjct: 137 PPPPSHPALLPPDATAPPPPPTSVAALPPPPPP 169 >10_08_0630 - 19410852-19411235,19411370-19412257,19412440-19412941, 19413662-19414135,19414982-19415040,19415468-19415629 Length = 822 Score = 29.9 bits (64), Expect = 3.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P S APPPP P Sbjct: 421 PPPAPSQQPQPPPPPSHPTPITSVAPAPPPPPP 453 >10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526, 5956971-5957592 Length = 357 Score = 29.9 bits (64), Expect = 3.7 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXPAXAXPP 1072 P +PT PP P PP PPP PA PP Sbjct: 40 PPAPTVVAPPLPTTPPPAVVAPSPPLPPLTPPPAIVPPALPPPPPLPAIVVPP 92 >09_06_0277 - 21983049-21983080,21983250-21984788,21986619-21986655, 21987612-21987665,21987781-21987893,21988272-21988660, 21988783-21988903,21989245-21989342,21989963-21990153 Length = 857 Score = 29.9 bits (64), Expect = 3.7 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +1 Query: 484 PXXGXXXXPPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 P PP A PPP P P P P P +PPPP Sbjct: 358 PYYSTPILPPYGDAFSPPNPPPPPPPMSPSCLLPPIIPAPTFTYSSPPPP 407 >09_04_0112 - 14757947-14758972 Length = 341 Score = 29.9 bits (64), Expect = 3.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 1010 PTXXPPPXPPPXXXPAXAXPP 1072 P PPP PPP PA PP Sbjct: 93 PEGSPPPPPPPALLPAPPMPP 113 >07_03_0560 + 19479597-19480667 Length = 356 Score = 29.9 bits (64), Expect = 3.7 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGG 507 G GGGG G G G G G GGGK GG Sbjct: 72 GFGGGGGGGLGGGGGFGGGGGAGGGGGLGGGGGKGGGFGGGVGG 115 Score = 29.9 bits (64), Expect = 3.7 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGG 507 G GGGG G G G G G G GGG GG Sbjct: 80 GLGGGGGFGGGGGAGGGGGLGGGGGKGGGFGGGVGGGGGGEGGG 123 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKK 534 G GGG G G G G G G GGGK+ Sbjct: 155 GVGGGSGTGGGLGGGGGGGFGGDGGGGLGGGGGKE 189 >06_03_1042 - 27089563-27089594,27090017-27090577,27090740-27090797 Length = 216 Score = 29.9 bits (64), Expect = 3.7 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +1 Query: 538 FPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 +PPP PA P P P P S G +PP P G TP Sbjct: 58 YPPPPTKPALPAPLPP----TPASPGDSPPSIAP--AGNPPTP 94 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P P APPPP P Sbjct: 1926 PPPHAPPPPPPP--PPVEGKPKPPPHAPPPPPP 1956 >04_03_0904 + 20717005-20718087 Length = 360 Score = 29.9 bits (64), Expect = 3.7 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 P P P P P P P P + P PP P Sbjct: 89 PKPTPPPYTPKPTPPAHTPTPPTYTPTPTPPKP 121 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 29.9 bits (64), Expect = 3.7 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PPP P P P P + PPPP GG Sbjct: 38 PPPPARHRAPSPPRPPPPPPPPTQPAPPPPPPARSGGG 75 >03_05_0919 - 28792790-28792915,28793090-28793155,28794345-28794530, 28794604-28795141,28795290-28795363 Length = 329 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 153 GGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGG 185 >01_01_0570 - 4231100-4232560 Length = 486 Score = 29.9 bits (64), Expect = 3.7 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 1080 AXPGGXAXAGXXXGGGXGGGXXVGXXXXXXXXXXXXXXXXGXGXXGGGPXGVGEXG 913 A GG AG GGG G G VG G GGG G GE G Sbjct: 160 AGGGGGIGAGGGFGGGAGAGGGVG-GGGRFGGGGMGGGGGFGGGAGGGVGGGGELG 214 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 89 GGGGGGGGLGGSGGLGGGGMGGSGGFGGGGGGG 121 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 29.5 bits (63), Expect = 4.8 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +1 Query: 541 PPPXPXPAX-PXPXXPXXXXXPXSXGXA--PPPPXP 639 PPP P PA P P P P A PPPP P Sbjct: 66 PPPGPGPAAAPSPHSPSPSNAPWVAPAADIPPPPPP 101 >08_02_1084 - 24232968-24234779 Length = 603 Score = 29.5 bits (63), Expect = 4.8 Identities = 15/47 (31%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPX---PAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP + PPP P P+ P P P PPPP P Sbjct: 54 PPSQQLPPPSLPPPLPQKQPPSQQLPPPPQQQQPPPQHSLPPPPPLP 100 Score = 28.7 bits (61), Expect = 8.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGGA G G G G G GGG Sbjct: 290 GRGGGGAGSPQVGGNYGGGRGGGPGGGAGGGGG 322 >06_03_1326 - 29355467-29355817 Length = 116 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGK 537 G GGGG G G G G G GGGK Sbjct: 12 GKGGGGGGGGGKGGGGGSGGGGRSGGGGGGGGGK 45 Score = 28.7 bits (61), Expect = 8.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPRXGG 507 G GGGG G G G AG G G GK GG Sbjct: 39 GGGGGGKGGGEGGSGKYGGGYSGGHAGGGGGAGKSGGYHGGGGG 82 >04_04_0679 + 27214577-27215023 Length = 148 Score = 29.5 bits (63), Expect = 4.8 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -1 Query: 1074 PGGXAXAGXXXGGGXGGGXXVGXXXXXXXXXXXXXXXXGXGXXGGGPXGVG 922 PGG A GGG GGG VG G G G G G Sbjct: 61 PGGTAFGFGFGGGGGGGGGGVGGRGGSSGRGGHGGGFGWAGGQGHGGWGAG 111 >03_05_0732 - 27232299-27232535,27232717-27232746,27233094-27233155, 27233975-27234005,27234618-27234713,27234881-27234969, 27235687-27236263 Length = 373 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PPP P P P P PPPP P G Sbjct: 55 PPPPPPPPLPQPQHHHDAVSTDESRTPPPPPPPMGAPG 92 >03_05_0364 + 23495069-23495483,23496056-23496136,23496381-23496449, 23496778-23496883,23497461-23497491 Length = 233 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = -2 Query: 623 GAXPXXXGXCXXXGXXGXGXAGXGXGGGKKKXXAPR 516 G P G G +G G GGGK+ APR Sbjct: 81 GGSPVCSGGATGTGGVAAARSGNGGGGGKRSSRAPR 116 >02_04_0021 + 18975992-18976408 Length = 138 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PP P P P P P P + +PPPP G P Sbjct: 97 PPPPKPK-PTPPPPAPTPKPPAPSPSPPPPKAAGHGVAGDP 136 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 P P P P+ P P P P G P PP P Sbjct: 161 PKPKPKPSPPKP-KPGPKPKPPKPGPKPKPPKP 192 >01_02_0031 + 10364487-10365407 Length = 306 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPP 630 PPP P PA P P P P APPP Sbjct: 170 PPPPPPPALPAPPPPPAPMLP----LAPPP 195 >12_01_0840 - 7847239-7847531,7847576-7847675,7848312-7848388, 7848486-7848738 Length = 240 Score = 29.1 bits (62), Expect = 6.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G GGG Sbjct: 189 GGGGGGGGQGGGAHARGYGQGGGGGGGGGQGGG 221 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 29.1 bits (62), Expect = 6.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 PPP P A P G PPPP P GG P Sbjct: 599 PPPAPS-ATANTASALPPPPPRPPGAPPPPPPPGKPGGPPPP 639 Score = 28.7 bits (61), Expect = 8.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P A P P P P PPPP P Sbjct: 616 PPPRPPGAPPPPPPPGKPGGPP-----PPPPRP 643 >10_03_0012 - 7037088-7037282,7037453-7037954,7038079-7038081, 7040633-7041213 Length = 426 Score = 29.1 bits (62), Expect = 6.4 Identities = 15/47 (31%), Positives = 16/47 (34%), Gaps = 3/47 (6%) Frame = +1 Query: 535 FFPPPXPXPAXPXPXX---PXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 F+PPP P P P P PPPP P G P Sbjct: 72 FYPPPPPSMPGPLPAPYDHHHRGGGPAQPPPPPPPPQPIHAAGEFPP 118 >08_01_0202 - 1638978-1639571 Length = 197 Score = 29.1 bits (62), Expect = 6.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 93 GGGGGGRYGGDRGYGGGGGGYGGGDRGYGGGGG 125 >07_03_1710 - 28903614-28903673,28904982-28905146,28905453-28905638, 28905784-28905927,28906281-28906460,28906559-28907215 Length = 463 Score = 29.1 bits (62), Expect = 6.4 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPP 630 PPP P P P P P + +PPP Sbjct: 56 PPPKPSPTPPPASPPPAPTPPQTRPPSPPP 85 >07_01_0516 - 3850252-3852870 Length = 872 Score = 29.1 bits (62), Expect = 6.4 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P P P P P + G +PPPP Sbjct: 19 PPPTSRPLPPPPPPP-----PPAHGPSPPPP 44 >06_02_0127 + 12140843-12140966,12141170-12141567 Length = 173 Score = 29.1 bits (62), Expect = 6.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGGG G G G G G G GGG Sbjct: 139 GGGGGGYSKGFGGGYGGGGYPGGGYYGGGGGGG 171 >06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-388276, 388355-388482,388914-389048,389122-389250,389620-389787, 389897-390019,390099-390227,390543-390866,390946-392901 Length = 1448 Score = 29.1 bits (62), Expect = 6.4 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PP R PPP P P P P P + APPPP Sbjct: 37 PPSRPEPDQAAPPPPPQPHTAPPPPP-----PNAEPEAPPPP 73 >05_07_0031 - 27183252-27183317,27183542-27184282 Length = 268 Score = 29.1 bits (62), Expect = 6.4 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPPXXXP 1054 P P P PPP P PPP PPP P Sbjct: 115 PSPPPPPPPPPPPPTTTTKPESLPAEADSEPELKAPPPPPPPPPLLP 161 >04_04_0057 + 22410167-22411330 Length = 387 Score = 29.1 bits (62), Expect = 6.4 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P P P P PPPP P Sbjct: 182 PPPPPPPPAAAAASPSPERSPRCQPSPPPPPPP 214 >03_02_0234 + 6625417-6626184,6626314-6626339,6626435-6626531, 6627009-6627116,6627194-6627328,6627429-6627528, 6627763-6627974,6628060-6628125,6628231-6628464, 6628583-6628641,6628716-6628782,6628863-6629192, 6629267-6629335,6629417-6629503,6629605-6629692, 6630057-6630178,6630251-6630355,6630442-6630485, 6630558-6630627,6630711-6630814,6630980-6631189, 6632935-6633018,6633291-6634003,6634115-6634649, 6634703-6634789,6634826-6634970,6635049-6635125, 6635215-6635359,6635462-6635626,6635725-6635958 Length = 1761 Score = 29.1 bits (62), Expect = 6.4 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +1 Query: 541 PPPX--PXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P PA P P P S G AP PP P Sbjct: 1150 PPPGSSPPPASPPPSTPSAPPT-NSSGSAPSPPSP 1183 >02_04_0264 - 21393029-21393046,21394249-21394814,21395005-21395623 Length = 400 Score = 29.1 bits (62), Expect = 6.4 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXG-XXGXGXAGXGXGGGKKKXXAPRXGG 507 G G GGA G G G G AG G GGG+ A GG Sbjct: 271 GGGHGGAGAGAGGARGGAGAGGGHGGAGAGAGGGRGGAGAGAGGG 315 >02_04_0171 + 20581995-20582354,20582509-20583141,20584954-20585058 Length = 365 Score = 29.1 bits (62), Expect = 6.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 1010 PTXXPPPXPPPXXXPAXAXPP 1072 P PPP PPP A A PP Sbjct: 242 PAAMPPPPPPPTGAAAVAPPP 262 >02_04_0170 + 20576149-20576889 Length = 246 Score = 29.1 bits (62), Expect = 6.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 1010 PTXXPPPXPPPXXXPAXAXPP 1072 P PPP PPP A A PP Sbjct: 123 PAAMPPPPPPPTGAAAVAPPP 143 >02_02_0240 + 8196140-8198248,8198381-8198650 Length = 792 Score = 29.1 bits (62), Expect = 6.4 Identities = 15/45 (33%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXG-XAPPPPXP 639 PP G + PP P P P P G PPPP P Sbjct: 621 PPPPGQNPYMPGPPRPYSMPPPPHMPTMATMVNPIGIPQPPPPLP 665 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 29.1 bits (62), Expect = 6.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 PPP P A P P P PPPP Sbjct: 419 PPPLPSDAFEQPPPPPEHPPPPESTSPPPPP 449 >01_06_0146 + 26969011-26969995,26970878-26970930 Length = 345 Score = 29.1 bits (62), Expect = 6.4 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 544 PPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PP P A P P P P PP P P Sbjct: 78 PPPPPTADPSPPLPHDNRTPQPRAAPPPAPAP 109 >01_03_0005 + 11568545-11569119,11569179-11569191 Length = 195 Score = 29.1 bits (62), Expect = 6.4 Identities = 16/53 (30%), Positives = 19/53 (35%), Gaps = 10/53 (18%) Frame = +1 Query: 535 FFPPPXPXPAXPXPXXPXXXXXPXSXG----------XAPPPPXPXXXGGXXT 663 ++PPP P P P P P G +PPPP GG T Sbjct: 54 YYPPPPPPVVTPTPQCPPPPSYPSGGGGGGGGGTVMYTSPPPPYSGGGGGSST 106 >01_01_0073 + 555485-556315 Length = 276 Score = 29.1 bits (62), Expect = 6.4 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGGK 537 G GGG A G G G AG G GGG+ Sbjct: 180 GVGGGDATGTGGGGTVAGGGTATGGAGGGEGGGE 213 >01_06_1805 - 39999987-40000169,40000648-40000974,40001724-40002017, 40002112-40002231,40002714-40002776,40003150-40003310, 40003864-40004035 Length = 439 Score = 26.6 bits (56), Expect(2) = 7.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 1010 PTXXPPPXPPPXXXPAXA 1063 P PPP PPP PA A Sbjct: 25 PLPPPPPPPPPSQLPATA 42 Score = 20.6 bits (41), Expect(2) = 7.4 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 Query: 920 SPTPXGPPPXXP 955 +PTP PPP P Sbjct: 21 APTPPLPPPPPP 32 >06_03_1146 - 28004896-28005554,28005664-28005844 Length = 279 Score = 28.7 bits (61), Expect = 8.5 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 541 PPPXPXPAXPXPXXPXXXXXPXSXGXAPPPPXP 639 PPP P PA P P P P S +PP P P Sbjct: 141 PPPSP-PAVPPPVAPVPMPSPAS---SPPSPAP 169 >05_04_0303 - 20010761-20011756 Length = 331 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 632 GGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 GGGG G G G G G G GGG Sbjct: 45 GGGGGGGVGGGVVGGDGVGGGGGGGGGGGGG 75 >04_04_1413 - 33386049-33386339 Length = 96 Score = 28.7 bits (61), Expect = 8.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 632 GGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 GGGG G C G G G G G GGG Sbjct: 62 GGGGGGGGGGGGC-GGGGGGGGGGGCGGGGG 91 >04_04_0233 + 23801944-23802598,23802914-23803047,23803548-23803730, 23804145-23804318 Length = 381 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/43 (30%), Positives = 13/43 (30%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPP 1042 P P P PPP P P P P PPP Sbjct: 27 PPPPPPSDPPPPPPPHHHHHHRRRHRHSKKPKPQPQPQPPPPP 69 >04_04_0198 + 23502657-23502900,23505228-23505298,23505690-23505727, 23505905-23507693 Length = 713 Score = 28.7 bits (61), Expect = 8.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 1010 PTXXPPPXPPPXXXPAXAXPP 1072 P PPP PPP PA A P Sbjct: 550 PPPPPPPPPPPAPAPALAPAP 570 >03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655, 9041608-9041802,9041905-9042153,9042525-9042672, 9042673-9042779,9043311-9043475,9044506-9045948 Length = 1273 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 638 GXGGGGAXPXXXGXCXXXGXXGXGXAGXGXGGG 540 G GGG P G G G G G GGG Sbjct: 90 GFGGGAGGPLGGGGGGWGAGGGGGGGGGGGGGG 122 >02_04_0654 - 24755339-24755408,24755488-24755624,24756243-24756326, 24756929-24756944,24758035-24758405 Length = 225 Score = 28.7 bits (61), Expect = 8.5 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 4/42 (9%) Frame = +1 Query: 541 PPPXPXPAXPX----PXXPXXXXXPXSXGXAPPPPXPXXXGG 654 PPP P P P P P PPPP P GG Sbjct: 33 PPPPPPPLFPAMSARPQPPRPAHPARFVKPMPPPPPPFPKGG 74 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 28.7 bits (61), Expect = 8.5 Identities = 16/56 (28%), Positives = 18/56 (32%), Gaps = 3/56 (5%) Frame = +1 Query: 508 PPXRGAXXFFFPPPXPXPAX---PXPXXPXXXXXPXSXGXAPPPPXPXXXGGXXTP 666 P R P P P P+ P P P P PPPP P +P Sbjct: 9 PKKRRLVEVHVPSPAPSPSSSSAPAPASPRSPVPPPPGVPPPPPPPPQTLAAAASP 64 >01_05_0490 + 22672241-22674679 Length = 812 Score = 28.7 bits (61), Expect = 8.5 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +1 Query: 511 PXRGAXXFFFPPPXPXPAXPXPXXPXXXXXPXSXGXAPPPP 633 P R + +P P P P P P P P S G PP Sbjct: 678 PRRAVVYYTYPLPPPSP--PLPPPPPPPPPPMSEGEEEAPP 716 >01_01_0995 + 7875273-7875495,7876196-7876274,7876422-7876536, 7878507-7878761 Length = 223 Score = 28.7 bits (61), Expect = 8.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 1010 PTXXPPPXPPPXXXPAXAXPPG 1075 P PPP PP P A PPG Sbjct: 34 PPSYPPPRPPVVGYPQPAPPPG 55 >01_01_0715 - 5542648-5543219,5543352-5543544 Length = 254 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/43 (30%), Positives = 14/43 (32%) Frame = +2 Query: 914 PXSPTPXGPPPXXPXXXXXXXXXXXXXXXXXXPTXXPPPXPPP 1042 P +PTP PP P PPP PPP Sbjct: 152 PAAPTPRPSPPPPAAGTNGTARAPSPPVPAPAPAGSPPPPPPP 194 >01_01_1162 - 9253034-9254229,9254387-9254456,9254473-9254567, 9255344-9255487,9255514-9255622 Length = 537 Score = 24.6 bits (51), Expect(2) = 9.4 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 1010 PTXXPPPXPPP 1042 PT PPP PPP Sbjct: 201 PTRRPPPPPPP 211 Score = 22.2 bits (45), Expect(2) = 9.4 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 1022 PPPXPPPXXXP 1054 PPP PPP P Sbjct: 206 PPPPPPPPRCP 216 >11_01_0387 + 2922208-2922704,2922956-2923088,2923487-2923549, 2923564-2923680,2925040-2925399 Length = 389 Score = 25.8 bits (54), Expect(2) = 9.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 1025 PPXPPPXXXPAXAXPPGXA 1081 PP PPP A PPG A Sbjct: 66 PPPPPPALPQAAPRPPGGA 84 Score = 21.0 bits (42), Expect(2) = 9.7 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 923 PTPXGPPPXXP 955 PTP PPP P Sbjct: 64 PTPPPPPPALP 74 >02_05_1277 - 35408097-35409080 Length = 327 Score = 25.0 bits (52), Expect(2) = 9.8 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 Query: 1010 PTXXPPPXPPPXXXPAXAXPP 1072 P PP PP PA A PP Sbjct: 62 PPPPPPAQPPVLAAPAPAPPP 82 Score = 21.8 bits (44), Expect(2) = 9.8 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +2 Query: 914 PXSPTPXGPPPXXP 955 P +P P PPP P Sbjct: 57 PSTPAPPPPPPAQP 70 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,622,328 Number of Sequences: 37544 Number of extensions: 302930 Number of successful extensions: 8252 Number of sequences better than 10.0: 105 Number of HSP's better than 10.0 without gapping: 1974 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6222 length of database: 14,793,348 effective HSP length: 83 effective length of database: 11,677,196 effective search space used: 3234583292 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -