BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_C09 (776 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0700 + 22259921-22260207,22264678-22264750,22265062-222658... 28 9.5 >12_02_0700 + 22259921-22260207,22264678-22264750,22265062-22265802, 22265849-22266424,22266505-22266957 Length = 709 Score = 27.9 bits (59), Expect = 9.5 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +3 Query: 333 GMRMVRTSYGIHAGDSEFTXQLV*ARRFLQSNIIQRHHCIVLRL 464 G+R++ T G A T V R ++ +I RHH ++L+L Sbjct: 196 GLRILSTLVGEIASSYACTTTHVEQHRMIKHMLISRHHVVMLKL 239 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,154,246 Number of Sequences: 37544 Number of extensions: 338217 Number of successful extensions: 526 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 526 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2080154268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -