BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_C07 (852 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 26 5.9 SPAC29B12.10c |||OPT oligopeptide transporter family|Schizosacch... 26 7.8 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 26.2 bits (55), Expect = 5.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 627 GGXPPPPSXXGXKXXXFXXXXXPPXXXPPPP 719 GG PPPP G PP PPPP Sbjct: 759 GGPPPPPPPPG------VAGAGPPPPPPPPP 783 >SPAC29B12.10c |||OPT oligopeptide transporter family|Schizosaccharomyces pombe|chr 1|||Manual Length = 851 Score = 25.8 bits (54), Expect = 7.8 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 126 LCWLWPTLKETATNLLTTARTSL-ILPKTTTLMETATNLSTTVHITWTL 269 LCW+WP K N L + L ILP T + N + W + Sbjct: 361 LCWIWP--KNRVVNQLFGYNSGLGILPLTFDWQQVVYNSNPLASPWWVI 407 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,636,250 Number of Sequences: 5004 Number of extensions: 49229 Number of successful extensions: 129 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 422462090 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -