BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_C06 (894 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyce... 30 0.51 SPBC23E6.07c |rfc1||DNA replication factor C complex subunit Rfc... 26 6.3 >SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 993 Score = 29.9 bits (64), Expect = 0.51 Identities = 19/61 (31%), Positives = 31/61 (50%) Frame = -1 Query: 747 EGMEEKAPNGFPERGRKGGTGIPVRRPGSXTRESARGSFQGETPGIXIVLSGFATXDLSV 568 E + AP G+ +GG IP+++PG T ES + + I + +GFA+ L + Sbjct: 845 ENITMSAPLGYVNIAVRGGNIIPLQQPGYTTYESRNNPY---SLLIAMDNNGFASGSLYI 901 Query: 567 D 565 D Sbjct: 902 D 902 >SPBC23E6.07c |rfc1||DNA replication factor C complex subunit Rfc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 934 Score = 26.2 bits (55), Expect = 6.3 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = +3 Query: 552 EHHKNRRSSXRWRNPTGL*XYQAF----PPGSSLVRSPWXPTLAALPGY 686 ++HKNR+S+ P GL Y+A PPG + ++ +A L GY Sbjct: 389 DYHKNRKSNFNKPGPDGLGLYKAVLLSGPPG--IGKTTAAHLVAKLEGY 435 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,959,239 Number of Sequences: 5004 Number of extensions: 52307 Number of successful extensions: 138 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 138 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 450492750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -