BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_C06 (894 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 31 1.0 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 30 2.4 At5g45050.2 68418.m05524 disease resistance protein-related simi... 29 5.5 At5g45050.1 68418.m05523 disease resistance protein-related simi... 29 5.5 At3g47980.1 68416.m05231 integral membrane HPP family protein co... 29 5.5 At5g07390.1 68418.m00846 respiratory burst oxidase protein A (Rb... 28 7.3 At3g20830.1 68416.m02634 protein kinase family protein contains ... 28 7.3 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 31.1 bits (67), Expect = 1.0 Identities = 26/102 (25%), Positives = 37/102 (36%), Gaps = 3/102 (2%) Frame = -1 Query: 744 GMEEKAPNGFPERGRKGGTGIPVRRPGSXTRESARGSFQGETPGIXIVL---SGFATXDL 574 G++ P+ P G GG G+ V P +A + P L + F Sbjct: 85 GVQRSKPSS-PIHGHVGGRGMKVTSPFKTHFGTAATAIPSPLPFSHYTLPYTNPFGFSSY 143 Query: 573 SVDFCDARQGGGAYGKTPATRPXYGSWPFAGLXLTCSFLRYP 448 S+D+ YG A P YGS P G+ + YP Sbjct: 144 SMDYNYPTSYYNVYGGATAQHPMYGSGPMTGVAAAPAAGFYP 185 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 29.9 bits (64), Expect = 2.4 Identities = 27/103 (26%), Positives = 38/103 (36%), Gaps = 4/103 (3%) Frame = -1 Query: 744 GMEEKAPNGFPERGRKGGTGIPVRRPGSXTRESARGSFQGETPGIXIVL---SGFATXDL 574 G++ P+ P G GG G+ V P +A + P L + F Sbjct: 85 GVQRSKPSS-PIHGHVGGRGMKVTSPFKTHFGTAATAIPSPLPFSHYTLPYTNPFGFSSY 143 Query: 573 SVDFCDARQGG-GAYGKTPATRPXYGSWPFAGLXLTCSFLRYP 448 S+D+ Q YG A P YGS P G+ + YP Sbjct: 144 SMDYNYPTQSYYNVYGGATAQHPMYGSGPMTGVAAAPAAGFYP 186 >At5g45050.2 68418.m05524 disease resistance protein-related similar to NL27 [Solanum tuberosum] GI:3947735; contains Pfam profiles PF03106: WRKY DNA -binding domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1344 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 Query: 348 PLPRSLTRCARSFGCGERYQLTQRR 422 P PRS RCA S GC R Q+ + R Sbjct: 1169 PYPRSYYRCASSKGCFARKQVERSR 1193 >At5g45050.1 68418.m05523 disease resistance protein-related similar to NL27 [Solanum tuberosum] GI:3947735; contains Pfam profiles PF03106: WRKY DNA -binding domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1372 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 Query: 348 PLPRSLTRCARSFGCGERYQLTQRR 422 P PRS RCA S GC R Q+ + R Sbjct: 1197 PYPRSYYRCASSKGCFARKQVERSR 1221 >At3g47980.1 68416.m05231 integral membrane HPP family protein contains Pfam domain, PF04982: HPP family Length = 252 Score = 28.7 bits (61), Expect = 5.5 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = +2 Query: 590 KPDRTIXIPGVSP--WKLPRALSLVXDPGRLTGIPVPPFLPLSGKPLGAFSSI 742 KP++T P +S W A + + GR+ + P + +S PLGA S+I Sbjct: 91 KPEKTTVAPSLSDVIWPAAGAFAAMAIMGRIDQMLNPKGISMSVAPLGAVSAI 143 >At5g07390.1 68418.m00846 respiratory burst oxidase protein A (RbohA) / NADPH oxidase identical to respiratory burst oxidase protein A from Arabidopsis thaliana [gi:3242781] Length = 902 Score = 28.3 bits (60), Expect = 7.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 540 RPPDEHHKNRRSSXRW 587 RPPDEH NR S W Sbjct: 667 RPPDEHRLNRADSKHW 682 >At3g20830.1 68416.m02634 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 408 Score = 28.3 bits (60), Expect = 7.3 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 339 PIRKPPLPARWPIH*CRKNLPHL 271 P PP P R P H CRKN P + Sbjct: 384 PSSAPPSPLRSPPHVCRKNDPFI 406 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,397,972 Number of Sequences: 28952 Number of extensions: 308412 Number of successful extensions: 775 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 775 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2100696768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -