BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_C01 (902 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11G7.01 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 27 2.8 SPAC29B12.12 |||helper of TIM |Schizosaccharomyces pombe|chr 1||... 27 2.8 >SPAC11G7.01 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 536 Score = 27.5 bits (58), Expect = 2.8 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = +3 Query: 111 TSIIAEPTTIATTNNWGNAAE--DETENFGYASHTRAPVVVPSAFSCSTRRLG 263 TS ++E T TTNNW +++ T + +S + +PS + S+ +G Sbjct: 190 TSYVSEVVTPTTTNNWNSSSSFTSSTSSTPISSSYSSSGTLPSKSNKSSNHVG 242 >SPAC29B12.12 |||helper of TIM |Schizosaccharomyces pombe|chr 1|||Manual Length = 113 Score = 27.5 bits (58), Expect = 2.8 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 129 PTTIATTNNWGNAAEDETENFGYASHTRAPVVVPSAFSC 245 PT ++TN +G ++ET F Y H++A VV C Sbjct: 4 PTARSSTNVYGKLVDNETRCFHY--HSKADVVALRCGQC 40 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,335,712 Number of Sequences: 5004 Number of extensions: 22340 Number of successful extensions: 53 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 456499320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -