BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= MFBP03_F_C01
(902 letters)
Database: nematostella
59,808 sequences; 16,821,457 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SB_48161| Best HMM Match : LSPR (HMM E-Value=8.2) 28 9.0
>SB_48161| Best HMM Match : LSPR (HMM E-Value=8.2)
Length = 163
Score = 28.3 bits (60), Expect = 9.0
Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
Frame = +2
Query: 65 YRQEVKEGKMDQSRHHKHYSRTDHNR-----NYQQLGERCRR*NGKFWICIAYT 211
YR+ GK +Q RH K + D N+ NY+ R + WICI T
Sbjct: 46 YRRMDVHGKYNQPRHLKTFFEPDSNQQTSDHNYKSTAPRSTNWAIEGWICIERT 99
Database: nematostella
Posted date: Oct 22, 2007 1:22 PM
Number of letters in database: 16,821,457
Number of sequences in database: 59,808
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,722,624
Number of Sequences: 59808
Number of extensions: 200222
Number of successful extensions: 518
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 460
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 515
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2597949818
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -