BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_B24 (869 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 25 1.2 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 24.6 bits (51), Expect = 1.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 296 YNREIFNDDRGQLTGQAYGTRVLGPGGDSTNYGG 397 Y + ++ D+ +TG AYG + PG S + G Sbjct: 60 YKQRVY--DKNGMTGDAYGGLNIRPGQPSRQHAG 91 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,739 Number of Sequences: 438 Number of extensions: 4430 Number of successful extensions: 6 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28159464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -