BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_B22 (859 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF519478-2|ABP73566.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519477-2|ABP73564.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519476-2|ABP73562.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519475-2|ABP73560.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519474-2|ABP73558.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519473-2|ABP73556.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519472-2|ABP73554.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519471-2|ABP73552.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519470-2|ABP73550.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519469-2|ABP73548.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519468-2|ABP73546.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519467-2|ABP73544.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519466-2|ABP73542.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519465-2|ABP73540.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519464-2|ABP73538.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519463-2|ABP73536.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519462-2|ABP73534.1| 163|Anopheles gambiae CTL4 protein. 28 0.42 EF519461-2|ABP73532.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519460-2|ABP73530.1| 166|Anopheles gambiae CTL4 protein. 28 0.42 EF519459-2|ABP73528.1| 166|Anopheles gambiae CTL4 protein. 28 0.42 EF519458-2|ABP73526.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519457-2|ABP73524.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519456-2|ABP73522.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519455-2|ABP73520.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519454-2|ABP73518.1| 161|Anopheles gambiae CTL4 protein. 28 0.42 EF519453-2|ABP73516.1| 176|Anopheles gambiae CTL4 protein. 28 0.42 EF519452-2|ABP73514.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519451-2|ABP73512.1| 171|Anopheles gambiae CTL4 protein. 28 0.42 EF519450-2|ABP73510.1| 171|Anopheles gambiae CTL4 protein. 28 0.42 EF519449-2|ABP73508.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519448-2|ABP73506.1| 171|Anopheles gambiae CTL4 protein. 28 0.42 EF519447-2|ABP73504.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519446-2|ABP73502.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519445-2|ABP73500.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519444-2|ABP73498.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519443-2|ABP73496.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519442-2|ABP73494.1| 177|Anopheles gambiae CTL4 protein. 28 0.42 EF519440-2|ABP73490.1| 165|Anopheles gambiae CTL4 protein. 28 0.42 EF519439-2|ABP73488.1| 152|Anopheles gambiae CTL4 protein. 28 0.42 EF519438-2|ABP73486.1| 161|Anopheles gambiae CTL4 protein. 28 0.42 EF519437-2|ABP73484.1| 165|Anopheles gambiae CTL4 protein. 28 0.42 EF519441-2|ABP73492.1| 164|Anopheles gambiae CTL4 protein. 25 2.9 AJ973475-1|CAJ01522.1| 127|Anopheles gambiae hypothetical prote... 25 2.9 AJ697728-1|CAG26921.1| 127|Anopheles gambiae putative sensory a... 25 2.9 AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 25 3.9 AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family prote... 25 3.9 AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 24 5.1 U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. 24 6.8 DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. 24 6.8 AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding pr... 24 6.8 AJ618924-1|CAF02003.1| 144|Anopheles gambiae odorant-binding pr... 24 6.8 AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine pr... 24 6.8 U50474-1|AAA93476.1| 62|Anopheles gambiae protein ( Anopheles ... 23 9.0 AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A... 23 9.0 >EF519478-2|ABP73566.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519477-2|ABP73564.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519476-2|ABP73562.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519475-2|ABP73560.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519474-2|ABP73558.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519473-2|ABP73556.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519472-2|ABP73554.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519471-2|ABP73552.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519470-2|ABP73550.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519469-2|ABP73548.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519468-2|ABP73546.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519467-2|ABP73544.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519466-2|ABP73542.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519465-2|ABP73540.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519464-2|ABP73538.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519463-2|ABP73536.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519462-2|ABP73534.1| 163|Anopheles gambiae CTL4 protein. Length = 163 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 28 PCGNPRGGKLYTTPNLRLNW 47 >EF519461-2|ABP73532.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519460-2|ABP73530.1| 166|Anopheles gambiae CTL4 protein. Length = 166 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 31 PCGNPRGGKLYTTPNLRLNW 50 >EF519459-2|ABP73528.1| 166|Anopheles gambiae CTL4 protein. Length = 166 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 31 PCGNPRGGKLYTTPNLRLNW 50 >EF519458-2|ABP73526.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519457-2|ABP73524.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519456-2|ABP73522.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519455-2|ABP73520.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519454-2|ABP73518.1| 161|Anopheles gambiae CTL4 protein. Length = 161 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 26 PCGNPRGGKLYTTPNLRLNW 45 >EF519453-2|ABP73516.1| 176|Anopheles gambiae CTL4 protein. Length = 176 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 41 PCGNPRGGKLYTTPNLRLNW 60 >EF519452-2|ABP73514.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519451-2|ABP73512.1| 171|Anopheles gambiae CTL4 protein. Length = 171 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 36 PCGNPRGGKLYTTPNLRLNW 55 >EF519450-2|ABP73510.1| 171|Anopheles gambiae CTL4 protein. Length = 171 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 36 PCGNPRGGKLYTTPNLRLNW 55 >EF519449-2|ABP73508.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519448-2|ABP73506.1| 171|Anopheles gambiae CTL4 protein. Length = 171 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 36 PCGNPRGGKLYTTPNLRLNW 55 >EF519447-2|ABP73504.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519446-2|ABP73502.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519445-2|ABP73500.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519444-2|ABP73498.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519443-2|ABP73496.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519442-2|ABP73494.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 42 PCGNPRGGKLYTTPNLRLNW 61 >EF519440-2|ABP73490.1| 165|Anopheles gambiae CTL4 protein. Length = 165 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 30 PCGNPRGGKLYTTPNLRLNW 49 >EF519439-2|ABP73488.1| 152|Anopheles gambiae CTL4 protein. Length = 152 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 17 PCGNPRGGKLYTTPNLRLNW 36 >EF519438-2|ABP73486.1| 161|Anopheles gambiae CTL4 protein. Length = 161 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 26 PCGNPRGGKLYTTPNLRLNW 45 >EF519437-2|ABP73484.1| 165|Anopheles gambiae CTL4 protein. Length = 165 Score = 27.9 bits (59), Expect = 0.42 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P G PRG + Y P LNW Sbjct: 30 PCGNPRGGKLYTTPNLRLNW 49 >EF519441-2|ABP73492.1| 164|Anopheles gambiae CTL4 protein. Length = 164 Score = 25.0 bits (52), Expect = 2.9 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -1 Query: 805 PXGLPRGSRSYRAPKAXLNW 746 P PRG + Y P LNW Sbjct: 29 PCXNPRGGKLYTTPNLRLNW 48 >AJ973475-1|CAJ01522.1| 127|Anopheles gambiae hypothetical protein protein. Length = 127 Score = 25.0 bits (52), Expect = 2.9 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +3 Query: 84 MKLLVVFAMCMLAASAGVVELSADTSNQDLEEKLYNSILTGDY 212 MKL V A +LA +A + + DL+E L + L +Y Sbjct: 1 MKLFVAIAFALLALAAAQEQYTTKYDGIDLDEILKSDRLFNNY 43 >AJ697728-1|CAG26921.1| 127|Anopheles gambiae putative sensory appendage protein SAP-2 protein. Length = 127 Score = 25.0 bits (52), Expect = 2.9 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +3 Query: 84 MKLLVVFAMCMLAASAGVVELSADTSNQDLEEKLYNSILTGDY 212 MKL V A +LA +A + + DL+E L + L +Y Sbjct: 1 MKLFVAIAFALLALAAAQEQYTTKYDGIDLDEILKSDRLFNNY 43 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 24.6 bits (51), Expect = 3.9 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -1 Query: 118 SMHIANTTRSFILLGAFQIAFKSANQILR 32 ++++ N S +LLG F + F A Q+LR Sbjct: 144 NVYLLNLAISDLLLGVFCMPFTLAGQVLR 172 >AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family protein Anob-1 protein. Length = 278 Score = 24.6 bits (51), Expect = 3.9 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 276 VVNNLIIDKRRNTMEYCYKLWVG-NGQEIVRKYFPL 380 ++N I+ + RN+ME+C G G +VR+ P+ Sbjct: 85 LLNRKILQRLRNSMEHCMAGSGGLGGGAVVREALPI 120 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 24.2 bits (50), Expect = 5.1 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -1 Query: 301 LSMIRLLTTFWMMEPLPWLSYS 236 L+++ +LT +W M LP+L S Sbjct: 97 LTLVEILTKYWPMGRLPFLCKS 118 >U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. Length = 140 Score = 23.8 bits (49), Expect = 6.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 726 RTXFSYLAGWKNHCS 682 R F+ GWKNHC+ Sbjct: 115 RHGFNAWYGWKNHCN 129 >DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. Length = 140 Score = 23.8 bits (49), Expect = 6.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 726 RTXFSYLAGWKNHCS 682 R F+ GWKNHC+ Sbjct: 115 RHGFNAWYGWKNHCN 129 >AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding protein AgamOBP54 protein. Length = 176 Score = 23.8 bits (49), Expect = 6.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 38 DLIXRLEGDLKGS*QNETSRCICDV 112 + I RLEGD KG+ + + CI + Sbjct: 96 EYIDRLEGDWKGTAKTIATECITTI 120 >AJ618924-1|CAF02003.1| 144|Anopheles gambiae odorant-binding protein OBP5470 protein. Length = 144 Score = 23.8 bits (49), Expect = 6.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 38 DLIXRLEGDLKGS*QNETSRCICDV 112 + I RLEGD KG+ + + CI + Sbjct: 59 EYIDRLEGDWKGTAKTIATECITTI 83 >AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine protein 1 protein. Length = 162 Score = 23.8 bits (49), Expect = 6.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 38 DLIXRLEGDLKGS*QNETSRCICDV 112 + I RLEGD KG+ + + CI + Sbjct: 96 EYIDRLEGDWKGTAKTIATECITTI 120 >U50474-1|AAA93476.1| 62|Anopheles gambiae protein ( Anopheles gambiae putativetrypsin-like enzyme precursor, mRNA, partial cds. ). Length = 62 Score = 23.4 bits (48), Expect = 9.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 Query: 695 FQPAKYENXVLVLHLQSPI 751 FQP N + V+ L SPI Sbjct: 1 FQPTNIRNDIAVVRLNSPI 19 >AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A protein. Length = 433 Score = 23.4 bits (48), Expect = 9.0 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -1 Query: 79 LGAFQIAFKSANQILRIPYSES 14 LGA+ IAF S +Q+L PY ++ Sbjct: 305 LGAY-IAFHSYSQLLLFPYGDT 325 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 802,040 Number of Sequences: 2352 Number of extensions: 15595 Number of successful extensions: 79 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 79 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 91372671 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -