BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_B21 (830 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000D55903 Cluster: PREDICTED: hypothetical protein;... 44 0.006 UniRef50_A0V605 Cluster: Diguanylate cyclase; n=1; Delftia acido... 34 5.0 UniRef50_Q019M1 Cluster: YebC-related; n=3; Ostreococcus|Rep: Ye... 33 6.6 >UniRef50_UPI0000D55903 Cluster: PREDICTED: hypothetical protein; n=1; Tribolium castaneum|Rep: PREDICTED: hypothetical protein - Tribolium castaneum Length = 534 Score = 43.6 bits (98), Expect = 0.006 Identities = 18/42 (42%), Positives = 25/42 (59%) Frame = +3 Query: 489 VSDRKKEVLLDAGALGDVPAVYXVPQPALHXMPVIGVYIEPR 614 V + +LDA +GD PAVY V P H MP +GV+++ R Sbjct: 88 VEQQPTYTVLDASTVGDFPAVYTVCSPERHQMPAVGVFVDKR 129 >UniRef50_A0V605 Cluster: Diguanylate cyclase; n=1; Delftia acidovorans SPH-1|Rep: Diguanylate cyclase - Delftia acidovorans SPH-1 Length = 532 Score = 33.9 bits (74), Expect = 5.0 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -1 Query: 455 QGPPVQGRPLLRRFH-SHSLLTQAL*EQLXIPALEESFQRTLVPH 324 Q PPV + L RR H H L+ A+ +QL + L + +TLV H Sbjct: 154 QSPPVDAKALARRLHDQHYQLSFAIADQLQVLQLMQELLQTLVQH 198 >UniRef50_Q019M1 Cluster: YebC-related; n=3; Ostreococcus|Rep: YebC-related - Ostreococcus tauri Length = 374 Score = 33.5 bits (73), Expect = 6.6 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 1/84 (1%) Frame = +3 Query: 411 MKATEKRPSLNWRSLSPIEASKNFWIVSDRKKEVLLDAGALGDVPAVYXVPQPALHXMP- 587 +K ++ L ++ IE S ++++ + LL AL DV AVY LH Sbjct: 227 LKVNDEETGLKCIPVAEIEVSDEDAAINEKIVDALL---ALDDVDAVYTQEARRLHSYSF 283 Query: 588 VIGVYIEPRCSEPASDTKLDQCRL 659 ++ + PR +EP+S ++D RL Sbjct: 284 IVSLRKHPRFTEPSSVVRVDAHRL 307 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 796,487,415 Number of Sequences: 1657284 Number of extensions: 16659313 Number of successful extensions: 42599 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 41033 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42584 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 72143915536 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -