BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_B18 (882 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23284| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_4460| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 >SB_23284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 31.5 bits (68), Expect = 0.93 Identities = 18/79 (22%), Positives = 36/79 (45%) Frame = -2 Query: 398 CKYEICKATFSTQPLELILVFWINL*PKTHSKNKAAYCRYKTT*ERIKWESADKATVAEL 219 C Y + K+TFS + +E + F + P T + A + +T+ E I W + + + + Sbjct: 43 CNYHLAKSTFSIRNVEFL--FAVRTLP-TREERITADSKLRTSFETIAWATCESTNASTI 99 Query: 218 YDRSKENIEKVCINYFKLL 162 D + E + +L+ Sbjct: 100 KDEENAHGEDKSFLFIRLI 118 >SB_4460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 685 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 880 VARSRNXPGAGRSXERETGRGA 815 +ARSR GAGR R GRGA Sbjct: 205 LARSRQNGGAGRGFNRTRGRGA 226 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,354,739 Number of Sequences: 59808 Number of extensions: 474263 Number of successful extensions: 861 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 860 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2514529411 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -