BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_B16 (931 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 23 3.4 AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esteras... 22 5.9 AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esteras... 22 5.9 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 22 7.8 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 22 7.8 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 23.0 bits (47), Expect = 3.4 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 742 FGXPXSGFPPPXXLPXP 792 +G P SG PP +P P Sbjct: 65 YGGPPSGGQPPQGMPYP 81 >AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.2 bits (45), Expect = 5.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 561 NFTNKAFFSXH 529 NF NKAFF H Sbjct: 20 NFNNKAFFCFH 30 >AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.2 bits (45), Expect = 5.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 561 NFTNKAFFSXH 529 NF NKAFF H Sbjct: 20 NFNNKAFFCFH 30 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 21.8 bits (44), Expect = 7.8 Identities = 10/33 (30%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 122 KYGTR-YGASLRKMVKKMEVTQHAKYTCSFCGK 217 KY R + S ++ + T Y+C CGK Sbjct: 83 KYCNRQFTKSYNLLIHERTHTDERPYSCDICGK 115 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 21.8 bits (44), Expect = 7.8 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 751 PXSGFPPPXXLPXPPR 798 P SG P P P PP+ Sbjct: 312 PYSGTPTPMMSPAPPQ 327 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,262 Number of Sequences: 336 Number of extensions: 3175 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26065116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -