BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_B14 (1481 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0686 - 30900748-30902167,30903442-30904742 35 0.19 12_02_0299 - 17051570-17052474,17053542-17053755 33 0.44 06_03_0696 + 23617687-23617851,23618838-23619536 27 0.48 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 33 0.58 04_03_1022 - 21778315-21779007 27 0.63 07_03_1136 + 24218601-24218734,24218769-24219906 33 0.76 01_01_0046 - 331758-332627 31 1.8 02_05_0543 + 29872168-29872767,29873089-29873115 25 2.4 12_02_1174 - 26696869-26698191 31 3.1 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 31 3.1 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 31 3.1 07_01_0080 + 587674-588510 31 3.1 03_01_0515 - 3864796-3865425 31 3.1 02_01_0075 - 522554-522616,522742-522748,523033-523136,523237-52... 31 3.1 02_04_0520 - 23628183-23628195,23629354-23630036 25 4.0 10_03_0023 - 7151465-7152111,7152222-7152405 30 4.1 07_01_0282 - 2070027-2070041,2074763-2075062,2075154-2075722,207... 30 4.1 03_02_0338 + 7614199-7614450,7614518-7614703,7614815-7614927,761... 30 4.1 01_01_0083 + 631196-631675 30 4.1 02_05_0002 - 24849189-24849825,24850267-24850328 25 5.1 08_01_0059 - 394001-394708 30 5.4 03_06_0758 - 36052261-36052301,36052463-36052697,36052895-360529... 30 5.4 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 25 6.1 06_03_1121 + 27767707-27768065,27768612-27769034,27770013-277701... 29 7.1 06_01_0561 - 3983308-3983564,3983652-3983775 29 7.1 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 29 7.1 02_01_0016 + 110796-110979,111252-111768,111847-112213 25 8.3 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 29 9.4 07_01_0516 - 3850252-3852870 29 9.4 06_03_1191 + 28286685-28287008,28287149-28287211,28287377-282874... 29 9.4 06_01_0486 - 3455030-3455770 29 9.4 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 25 9.8 01_05_0490 + 22672241-22674679 25 9.9 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +1 Query: 382 PXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPPXP 537 P P PP + P P K P PP AK PPPP P Sbjct: 311 PAPPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGP 362 Score = 33.1 bits (72), Expect = 0.58 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXPXG 211 P PPP PP G G PP P G Sbjct: 362 PSPPPPPPPGGKKGGPPPPPPKG 384 Score = 30.7 bits (66), Expect = 3.1 Identities = 23/99 (23%), Positives = 26/99 (26%) Frame = +1 Query: 370 PXXXPXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPPXPXXGX 549 P P P P P + + P PP +PPPPP P Sbjct: 277 PAARPASPSPSLPLPPGRESPSRPQSIAAAAVASPAPPPPPPPKPAAAAPPPPPPP---- 332 Query: 550 XXXAXPVXXPXXXNLXXXRXGGXXXXPPXXXXPPXHXXP 666 A P P G PP PP P Sbjct: 333 -KAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPP 370 Score = 30.7 bits (66), Expect = 3.1 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +1 Query: 367 PPXXXPXXPXXX--PPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPP 531 PP P P PP P P K P PP K PPPPP Sbjct: 313 PPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPP 369 Score = 30.3 bits (65), Expect = 4.1 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +1 Query: 367 PPXXXPXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPP 531 PP P PP P P P PP K PPPPP Sbjct: 328 PPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPPP 382 Score = 29.9 bits (64), Expect = 5.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 146 PPPPXPPXGAXSGXXXPPXPXG 211 PPPP PP G G PP G Sbjct: 364 PPPPPPPGGKKGGPPPPPPKGG 385 Score = 29.5 bits (63), Expect = 7.1 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = +2 Query: 77 PPTKXKNXEPRXXWXSXXXXTXPPPPPXPPXGAXSGXXXPPXP 205 PP + P+ + PPPPP PP A + PP P Sbjct: 291 PPGRESPSRPQSIAAAAVASPAPPPPP-PPKPAAAAPPPPPPP 332 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 33.5 bits (73), Expect = 0.44 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = +1 Query: 367 PPXXXPXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPPXP 537 PP P P PP P P P PP Y SPPPPP P Sbjct: 281 PPIFSPPSPPPPPPPAFPFPFPQLPPL-----------PHFPPLPSFYPSPPPPPPP 326 Score = 30.3 bits (65), Expect = 4.1 Identities = 23/99 (23%), Positives = 25/99 (25%) Frame = +1 Query: 370 PXXXPXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPPXPXXGX 549 P P P PP+ P P P PP PPPPP Sbjct: 241 PFPLPPIPFLTPPSPPPPAFPFPLPPWPWAPPPAFPFPHLPPIFSPPSPPPPPPPAFPFP 300 Query: 550 XXXAXPVXXPXXXNLXXXRXGGXXXXPPXXXXPPXHXXP 666 P+ P L PP PP P Sbjct: 301 FPQLPPL--PHFPPLPSFYPSPPPPPPPPPPPPPSFPWP 337 >06_03_0696 + 23617687-23617851,23618838-23619536 Length = 287 Score = 27.1 bits (57), Expect(2) = 0.48 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP G PP Sbjct: 83 PPPPPSPPATHDVGQPPPP 101 Score = 25.0 bits (52), Expect(2) = 0.48 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 76 TPPPPPPPPP 85 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 33.1 bits (72), Expect = 0.58 Identities = 14/43 (32%), Positives = 17/43 (39%) Frame = +2 Query: 77 PPTKXKNXEPRXXWXSXXXXTXPPPPPXPPXGAXSGXXXPPXP 205 PP + + P S PPPPP PP +G P P Sbjct: 670 PPPRSSSRTPTGAATSSKGPPPPPPPPLPPANRTNGPGVPSAP 712 Score = 31.9 bits (69), Expect = 1.3 Identities = 29/120 (24%), Positives = 33/120 (27%), Gaps = 5/120 (4%) Frame = +1 Query: 382 PXXPXXXPPTXXSXXXPXXXPXLRVXXXHTX---KXPXXPPXAKXYXSPPPPPXPXXGXX 552 P P PP + P P H+ P PP + PPPP P G Sbjct: 602 PPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIGNK 661 Query: 553 XXAXPVXXPXXXNLXXXRXGG--XXXXPPXXXXPPXHXXPPQXXXXXQXXXIXXPPXRXP 726 A P P + G PP PP PP PP P Sbjct: 662 FPAPPPPPPPPRSSSRTPTGAATSSKGPPPPPPPP---LPPANRTNGPGVPSAPPPPPPP 718 Score = 30.7 bits (66), Expect = 3.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXP 205 PPPPP PP G PP P Sbjct: 547 PPPPPPPPSGNKPAFSPPPPP 567 Score = 30.3 bits (65), Expect = 4.1 Identities = 26/121 (21%), Positives = 27/121 (22%), Gaps = 1/121 (0%) Frame = +1 Query: 367 PPXXXPXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPPXPXXG 546 PP P PP P P P PP PPPP P Sbjct: 551 PPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPP 610 Query: 547 -XXXXAXPVXXPXXXNLXXXRXGGXXXXPPXXXXPPXHXXPPQXXXXXQXXXIXXPPXRX 723 + P P L PP P PP PP Sbjct: 611 ILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPP 670 Query: 724 P 726 P Sbjct: 671 P 671 >04_03_1022 - 21778315-21779007 Length = 230 Score = 26.6 bits (56), Expect(2) = 0.63 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXP 205 PPPPP PP PP P Sbjct: 37 PPPPPPPPPPYVPPHLLPPSP 57 Score = 25.0 bits (52), Expect(2) = 0.63 Identities = 11/30 (36%), Positives = 11/30 (36%) Frame = +2 Query: 77 PPTKXKNXEPRXXWXSXXXXTXPPPPPXPP 166 PP R S PPPPP PP Sbjct: 16 PPPPPPATRARPPCSSAHLLPPPPPPPPPP 45 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 32.7 bits (71), Expect = 0.76 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 216 RXPXGXGGXXXPLXAPXGGXGGGG 145 R P G GG P AP GG GGGG Sbjct: 171 RPPGGGGGGGGPGRAPGGGGGGGG 194 Score = 32.7 bits (71), Expect = 0.76 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 216 RXPXGXGGXXXPLXAPXGGXGGGG 145 R P G GG P AP GG GGGG Sbjct: 184 RAPGGGGGGGGPGRAPGGGGGGGG 207 >01_01_0046 - 331758-332627 Length = 289 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +2 Query: 104 PRXXWXSXXXXTXPPPPPXPPXGAXSGXXXPPXPXGXR 217 P+ W + PPPPP PP S PP P R Sbjct: 10 PQRYWFPYWT-SPPPPPPPPPPPPSSSRYRPPSPPSSR 46 >02_05_0543 + 29872168-29872767,29873089-29873115 Length = 208 Score = 25.0 bits (52), Expect(2) = 2.4 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +2 Query: 116 WXSXXXXTXPPPPPXPP 166 W PPPPP PP Sbjct: 175 WGESPAAPPPPPPPPPP 191 Score = 24.6 bits (51), Expect(2) = 2.4 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 143 PPPPPXPPXGA 175 PPPPP PP A Sbjct: 183 PPPPPPPPPAA 193 >12_02_1174 - 26696869-26698191 Length = 440 Score = 30.7 bits (66), Expect = 3.1 Identities = 38/196 (19%), Positives = 43/196 (21%), Gaps = 8/196 (4%) Frame = +1 Query: 403 PPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPPXPXXGXXXXAXPVXXPX 582 PP P P R + P P PPPPP P P P Sbjct: 116 PPALSPVPPPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPP---------PPPPPR 166 Query: 583 XXNLXXXRXGGXXXXPPXXXXPPXHXXPPQXXXXXQXXXIXXPPXRXPXXXPLXXXPAXX 762 ++ PP P PP + + P P P P Sbjct: 167 PPSVKPPVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPPPPPP 226 Query: 763 XXXXRXPXXXRXAXXXXXXAPXG--------XXXLXSXPXXDSXXPXXAPPXXXXXPTQX 918 R P P L P P PP PT Sbjct: 227 TVPPRTPGDTPAVVEPKPQPPPPPPRAPVKMPRVLEPKPSPPPPSPLPPPPEDYWSPTAV 286 Query: 919 XXPXXRPXXVXPPXDP 966 P PP P Sbjct: 287 TPPEPTKPKPPPPSPP 302 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +1 Query: 367 PPXXXPXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPP 531 PP P P PP P V P PP + PPPPP Sbjct: 141 PPPVKPQPPPSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPP 195 Score = 30.7 bits (66), Expect = 3.1 Identities = 27/128 (21%), Positives = 31/128 (24%) Frame = +1 Query: 370 PXXXPXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPPXPXXGX 549 P P P PP S P P + P PP + PP P Sbjct: 153 PPPPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQP 212 Query: 550 XXXAXPVXXPXXXNLXXXRXGGXXXXPPXXXXPPXHXXPPQXXXXXQXXXIXXPPXRXPX 729 P P R G P P PP + + P P Sbjct: 213 PPTLPPPSPPPPPPTVPPRTPG---DTPAVVEPKPQPPPPPPRAPVKMPRVLEPKPSPPP 269 Query: 730 XXPLXXXP 753 PL P Sbjct: 270 PSPLPPPP 277 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 30.7 bits (66), Expect = 3.1 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +2 Query: 143 PP--PPPXPPXGAXSGXXXPPXPXG 211 PP PPP PP G G PP P G Sbjct: 925 PPGAPPPPPPPGKPGGPPPPPPPPG 949 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 30.7 bits (66), Expect = 3.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 146 PPPPXPPXGAXSGXXXPPXP 205 PPPP PP G S PP P Sbjct: 92 PPPPPPPYGVNSSQPPPPPP 111 Score = 30.3 bits (65), Expect = 4.1 Identities = 15/55 (27%), Positives = 16/55 (29%) Frame = +1 Query: 367 PPXXXPXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPP 531 PP P PP P P + PP Y PPPPP Sbjct: 43 PPQGAPPPFLAPPPPPPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMYYQPPPPPP 97 Score = 29.9 bits (64), Expect = 5.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXP 205 PPPPP PP S PP P Sbjct: 107 PPPPPPPPSPPPSAPPPPPPP 127 Score = 29.5 bits (63), Expect = 7.1 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +1 Query: 382 PXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPPXP 537 P PP P P V P PP PPPPP P Sbjct: 77 PQQQQPPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPP 128 >07_01_0080 + 587674-588510 Length = 278 Score = 30.7 bits (66), Expect = 3.1 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXP 205 PPPPP PP + S PP P Sbjct: 91 PPPPPPPPPSSGSPPPPPPPP 111 >03_01_0515 - 3864796-3865425 Length = 209 Score = 30.7 bits (66), Expect = 3.1 Identities = 21/71 (29%), Positives = 22/71 (30%) Frame = +1 Query: 367 PPXXXPXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPPXPXXG 546 PP P PP+ S P L P PP SPPPPP P Sbjct: 42 PPTEASPPPLAPPPSVTSSPPPPAAGPLM---------PPPPPPPSVTSSPPPPPLPPPP 92 Query: 547 XXXXAXPVXXP 579 A P P Sbjct: 93 PPPAASPPPPP 103 >02_01_0075 - 522554-522616,522742-522748,523033-523136,523237-523368, 525209-525401,525978-526330,526693-526791,526864-526935, 527062-527213,527338-527386,527755-527885,528067-528307, 528392-528565,528656-528797,529236-529282,529370-529450, 530170-530271,530345-530440,531437-531444,531575-531616, 531830-531894,534761-534853,534888-534959,535303-535509, 536318-537226,537503-538158 Length = 1429 Score = 30.7 bits (66), Expect = 3.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP G S PP Sbjct: 141 PPPPPPPPEGESSAEEQPP 159 >02_04_0520 - 23628183-23628195,23629354-23630036 Length = 231 Score = 25.0 bits (52), Expect(2) = 4.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 191 TLPPPPPPPP 200 Score = 23.8 bits (49), Expect(2) = 4.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 143 PPPPPXPPXGA 175 PPPPP PP A Sbjct: 194 PPPPPPPPDTA 204 >10_03_0023 - 7151465-7152111,7152222-7152405 Length = 276 Score = 30.3 bits (65), Expect = 4.1 Identities = 16/57 (28%), Positives = 18/57 (31%) Frame = +1 Query: 367 PPXXXPXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPPXP 537 P P P PP + P P L + P P PPPPP P Sbjct: 189 PNPITPAPPSLVPPVFPTPSPPSILPPLTPQPPPSSLIPPVLPLPLLNPPPPPPPPP 245 >07_01_0282 - 2070027-2070041,2074763-2075062,2075154-2075722, 2075812-2076337 Length = 469 Score = 30.3 bits (65), Expect = 4.1 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXPXG 211 PPPPP PP + G PP G Sbjct: 427 PPPPPHPPSPSAEGSASPPTTPG 449 >03_02_0338 + 7614199-7614450,7614518-7614703,7614815-7614927, 7615023-7615206,7615343-7615440,7616113-7616578, 7617342-7617683 Length = 546 Score = 30.3 bits (65), Expect = 4.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 146 PPPPXPPXGAXSGXXXPPXP 205 PPPP PP GA PP P Sbjct: 493 PPPPLPPAGAAPNATWPPFP 512 >01_01_0083 + 631196-631675 Length = 159 Score = 30.3 bits (65), Expect = 4.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 210 PXGXGGXXXPLXAPXGGXGGGGG 142 P G GG P P G GGGGG Sbjct: 80 PQGGGGGYIPYYQPPAGGGGGGG 102 >02_05_0002 - 24849189-24849825,24850267-24850328 Length = 232 Score = 24.6 bits (51), Expect(2) = 5.1 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = +2 Query: 86 KXKNXEPRXXWXSXXXXTXPPPPPXPP 166 K K +P PPPPP PP Sbjct: 200 KRKKPQPADTSGGGGHPHPPPPPPPPP 226 Score = 23.8 bits (49), Expect(2) = 5.1 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 143 PPPPPXPPXGA 175 PPPPP P GA Sbjct: 220 PPPPPPPSAGA 230 >08_01_0059 - 394001-394708 Length = 235 Score = 29.9 bits (64), Expect = 5.4 Identities = 17/60 (28%), Positives = 20/60 (33%), Gaps = 3/60 (5%) Frame = +1 Query: 367 PPXXXPXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPP---PPXP 537 PP P PP P P +R T + PP + PPP PP P Sbjct: 5 PPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAP 64 Score = 29.9 bits (64), Expect = 5.4 Identities = 16/57 (28%), Positives = 16/57 (28%) Frame = +1 Query: 367 PPXXXPXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPPXP 537 PP P P PP P P R P PP P PP P Sbjct: 13 PPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAPVPPPP 69 >03_06_0758 - 36052261-36052301,36052463-36052697,36052895-36052966, 36056477-36056567,36056650-36056872,36056964-36057300, 36057406-36057588 Length = 393 Score = 29.9 bits (64), Expect = 5.4 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +1 Query: 367 PPXXXPXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPP 531 PP P PP P P L H P P Y PPPPP Sbjct: 143 PPPPPPPMAVAPPPFLPPPLRPFAAPLL---FHHDMASPVSPVSPIYYVGPPPPP 194 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 24.6 bits (51), Expect(2) = 6.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 146 PPPPXPPXGAXSGXXXPPXP 205 PPPP PP PP P Sbjct: 119 PPPPPPPHPPEDPPPHPPHP 138 Score = 23.4 bits (48), Expect(2) = 6.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 143 PPPPPXPP 166 PPPPP PP Sbjct: 85 PPPPPVPP 92 >06_03_1121 + 27767707-27768065,27768612-27769034,27770013-27770175, 27770271-27770381,27770895-27770963,27771117-27771203, 27771967-27772752 Length = 665 Score = 29.5 bits (63), Expect = 7.1 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -3 Query: 210 PXGXGGXXXPLXAPXGGXGGGGG 142 P G GG P + GG GGGGG Sbjct: 18 PAGGGGGPAPHSSDPGGVGGGGG 40 >06_01_0561 - 3983308-3983564,3983652-3983775 Length = 126 Score = 29.5 bits (63), Expect = 7.1 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +2 Query: 143 PPPPPXPPXGAXSG 184 PPPPP PP GA +G Sbjct: 33 PPPPPPPPSGAAAG 46 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 29.5 bits (63), Expect = 7.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 152 PPXPPXGAXSGXXXPPXPXGXR 217 PP PP G G PP P G R Sbjct: 1149 PPPPPVGGLGGPPAPPPPAGFR 1170 >02_01_0016 + 110796-110979,111252-111768,111847-112213 Length = 355 Score = 25.0 bits (52), Expect(2) = 8.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 214 TMPPPPPPPP 223 Score = 22.6 bits (46), Expect(2) = 8.3 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 143 PPPPPXPPXGA 175 PPPPP P G+ Sbjct: 219 PPPPPPQPQGS 229 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 29.1 bits (62), Expect = 9.4 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +1 Query: 367 PPXXXPXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPPXP 537 PP P P PP S P P L P PP PPPP P Sbjct: 1161 PPSPPPATPPPPPPLSPSLPPPPPPPPL---PSGPPPQPAPPPLPIQPPPIPPPPVP 1214 >07_01_0516 - 3850252-3852870 Length = 872 Score = 29.1 bits (62), Expect = 9.4 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +1 Query: 481 PXXPPXAKXYXSPPPPPXPXXG 546 P PP ++ PPPPP P G Sbjct: 17 PQPPPTSRPLPPPPPPPPPAHG 38 >06_03_1191 + 28286685-28287008,28287149-28287211,28287377-28287461, 28287561-28287623,28287954-28288029,28288190-28288223, 28289553-28289659,28289738-28289807,28289852-28289950 Length = 306 Score = 29.1 bits (62), Expect = 9.4 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 490 PPXAKXYXSPPPPPXPXXG 546 PP Y +PPPPP P G Sbjct: 10 PPPHSSYAAPPPPPPPPPG 28 >06_01_0486 - 3455030-3455770 Length = 246 Score = 29.1 bits (62), Expect = 9.4 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +1 Query: 367 PPXXXPXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPPXP 537 PP P P PP P P + P PP Y PP PP P Sbjct: 97 PPYVPPYIPPPTPPYVPPYIPPPTPPYV---------PPPTPPSPPPYVPPPTPPSP 144 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 25.0 bits (52), Expect(2) = 9.8 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 490 PPXAKXYXSPPPPPXP 537 PP + PPPPP P Sbjct: 414 PPPTHTHGPPPPPPPP 429 Score = 22.2 bits (45), Expect(2) = 9.8 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 517 PPPPPXPXXG 546 PPPPP P G Sbjct: 426 PPPPPPPPVG 435 >01_05_0490 + 22672241-22674679 Length = 812 Score = 25.4 bits (53), Expect(2) = 9.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP + PP Sbjct: 698 PPPPPPPPPMSEGEEEAPP 716 Score = 21.8 bits (44), Expect(2) = 9.9 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +2 Query: 77 PPTKXKNXEPRXXWXSXXXXTXPPPPPXP 163 PPT ++ +P PPPPP P Sbjct: 646 PPTTRRSRKP----PQPPSRPAPPPPPPP 670 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,270,663 Number of Sequences: 37544 Number of extensions: 329267 Number of successful extensions: 8201 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 2011 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6020 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 4733660064 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -