BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_B14 (1481 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC034003-1|AAH34003.1| 600|Homo sapiens PRR12 protein protein. 36 0.50 AB033031-1|BAA86519.1| 1217|Homo sapiens KIAA1205 protein protein. 36 0.50 AB083343-1|BAE96598.1| 3599|Homo sapiens zinc-finger homeodomain... 27 1.8 AF129756-16|AAD18085.1| 1229|Homo sapiens BAT3 protein. 27 2.0 M33521-1|AAA35588.1| 1132|Homo sapiens protein ( Human HLA-B-ass... 27 2.0 M33519-1|AAA35587.1| 1132|Homo sapiens protein ( Human HLA-B-ass... 27 2.0 BX511262-9|CAM45800.1| 1132|Homo sapiens HLA-B associated transc... 27 2.0 AL805934-11|CAI18504.1| 1132|Homo sapiens HLA-B associated trans... 27 2.0 AL670886-2|CAI17785.1| 1132|Homo sapiens HLA-B associated transc... 27 2.0 AL662847-2|CAI17659.1| 1132|Homo sapiens HLA-B associated transc... 27 2.0 AL662801-54|CAI18314.1| 1132|Homo sapiens HLA-B associated trans... 27 2.0 BX511262-8|CAM45799.1| 1126|Homo sapiens HLA-B associated transc... 27 2.0 BC003133-1|AAH03133.1| 1126|Homo sapiens HLA-B associated transc... 27 2.0 BA000025-30|BAB63390.1| 1126|Homo sapiens BAT3 protein. 27 2.0 AL805934-10|CAI18501.1| 1126|Homo sapiens HLA-B associated trans... 27 2.0 AL670886-1|CAI17784.1| 1126|Homo sapiens HLA-B associated transc... 27 2.0 AL662847-1|CAI17658.1| 1126|Homo sapiens HLA-B associated transc... 27 2.0 AL662801-53|CAI18315.1| 1126|Homo sapiens HLA-B associated trans... 27 2.0 AK131462-1|BAD18607.1| 1103|Homo sapiens protein ( Homo sapiens ... 27 2.0 AK025837-1|BAB15254.1| 616|Homo sapiens protein ( Homo sapiens ... 33 2.0 AK131399-1|BAD18546.1| 907|Homo sapiens protein ( Homo sapiens ... 27 2.0 BX511262-10|CAM45801.1| 743|Homo sapiens HLA-B associated trans... 27 2.1 AL805934-12|CAI18508.2| 743|Homo sapiens HLA-B associated trans... 27 2.1 AL670886-3|CAM25014.1| 743|Homo sapiens HLA-B associated transc... 27 2.1 AL662847-3|CAO72072.1| 743|Homo sapiens HLA-B associated transc... 27 2.1 AL662801-55|CAI18316.2| 743|Homo sapiens HLA-B associated trans... 27 2.1 BC085610-1|AAH85610.1| 578|Homo sapiens ZFHX4 protein protein. 27 2.1 BC047745-1|AAH47745.2| 507|Homo sapiens ZFHX4 protein protein. 27 2.1 BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. 33 2.7 AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. 33 2.7 AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen ... 33 2.7 U80017-3|AAC52048.1| 294|Homo sapiens survival motor neuron pro... 29 2.9 U43883-1|AAC50473.1| 294|Homo sapiens survival motor neuron pro... 29 2.9 U18423-1|AAA66242.1| 294|Homo sapiens spinal muscular atrophy d... 29 2.9 BC062723-1|AAH62723.1| 294|Homo sapiens survival of motor neuro... 29 2.9 BC015308-1|AAH15308.1| 294|Homo sapiens survival of motor neuro... 29 2.9 AC005031-2|AAC62262.1| 294|Homo sapiens survival of motor neuro... 29 2.9 AC004999-1|AAC83178.1| 294|Homo sapiens survival motor neuron 1... 29 2.9 U21914-1|AAA64505.1| 293|Homo sapiens U18423; it is not known i... 29 2.9 BC070242-1|AAH70242.1| 282|Homo sapiens survival of motor neuro... 29 2.9 BC000908-1|AAH00908.1| 282|Homo sapiens SMN1 protein protein. 29 2.9 AB002358-1|BAA21638.2| 1019|Homo sapiens KIAA0360 protein. 29 3.4 Z93020-1|CAI21594.1| 729|Homo sapiens RAN binding protein 9 pro... 33 3.5 U19927-1|AAC50140.1| 502|Homo sapiens WAS protein. 33 3.5 U12707-1|AAA62663.1| 502|Homo sapiens Wiskott-Aldrich syndrome ... 33 3.5 BC052781-1|AAH52781.1| 802|Homo sapiens RANBP9 protein protein. 33 3.5 BC012738-1|AAH12738.1| 502|Homo sapiens Wiskott-Aldrich syndrom... 33 3.5 BC002961-1|AAH02961.1| 514|Homo sapiens WAS protein protein. 33 3.5 AL441883-5|CAI19841.1| 729|Homo sapiens RAN binding protein 9 p... 33 3.5 AF115549-1|AAD26691.1| 502|Homo sapiens Wiskott-Aldrich Syndrom... 33 3.5 AB055311-1|BAB62525.1| 729|Homo sapiens RanBPM protein. 33 3.5 AK025571-1|BAB15173.1| 727|Homo sapiens osaminidase mRNA. prot... 25 5.9 BC030146-1|AAH30146.1| 717|Homo sapiens RNA binding motif prote... 25 5.9 BC037223-1|AAH37223.1| 194|Homo sapiens mediator complex subuni... 31 8.1 BC009723-1|AAH09723.1| 205|Homo sapiens Unknown (protein for IM... 31 8.1 AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain... 31 8.1 AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens ... 31 8.1 L12392-1|AAB38240.1| 3144|Homo sapiens Huntington's Disease prot... 25 8.8 AB016794-1|BAA36753.1| 3144|Homo sapiens huntingtin protein. 25 8.8 BC117407-1|AAI17408.1| 1081|Homo sapiens LOC152485 protein protein. 25 9.6 AK091130-1|BAC03591.1| 1077|Homo sapiens protein ( Homo sapiens ... 25 9.6 AB023209-1|BAA76836.1| 772|Homo sapiens KIAA0992 protein protein. 25 9.8 >BC034003-1|AAH34003.1| 600|Homo sapiens PRR12 protein protein. Length = 600 Score = 35.5 bits (78), Expect = 0.50 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +1 Query: 367 PPXXXPXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPPXP 537 PP P PP P P + P PP SPPPPP P Sbjct: 98 PPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPPP 154 >AB033031-1|BAA86519.1| 1217|Homo sapiens KIAA1205 protein protein. Length = 1217 Score = 35.5 bits (78), Expect = 0.50 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +1 Query: 367 PPXXXPXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPPXP 537 PP P PP P P + P PP SPPPPP P Sbjct: 643 PPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPPP 699 >AB083343-1|BAE96598.1| 3599|Homo sapiens zinc-finger homeodomain protein 4 protein. Length = 3599 Score = 27.1 bits (57), Expect(2) = 1.8 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 143 PPPPPXPPXGAXSG 184 PPPPP PP + SG Sbjct: 3149 PPPPPPPPSSSLSG 3162 Score = 25.0 bits (52), Expect(2) = 1.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 3144 TPPPPPPPPP 3153 >AF129756-16|AAD18085.1| 1229|Homo sapiens BAT3 protein. Length = 1229 Score = 27.1 bits (57), Expect(2) = 2.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP A PP Sbjct: 756 PPPPPPPPPPAPEQQTMPP 774 Score = 25.0 bits (52), Expect(2) = 2.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 752 TAPPPPPPPP 761 >M33521-1|AAA35588.1| 1132|Homo sapiens protein ( Human HLA-B-associated transcript 3 (BAT3) gene, 3' end. ). Length = 1132 Score = 27.1 bits (57), Expect(2) = 2.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP A PP Sbjct: 659 PPPPPPPPPPAPEQQTMPP 677 Score = 25.0 bits (52), Expect(2) = 2.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 655 TAPPPPPPPP 664 >M33519-1|AAA35587.1| 1132|Homo sapiens protein ( Human HLA-B-associated transcript 3 (BAT3) mRNA, complete cds. ). Length = 1132 Score = 27.1 bits (57), Expect(2) = 2.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP A PP Sbjct: 659 PPPPPPPPPPAPEQQTMPP 677 Score = 25.0 bits (52), Expect(2) = 2.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 655 TAPPPPPPPP 664 >BX511262-9|CAM45800.1| 1132|Homo sapiens HLA-B associated transcript 3 protein. Length = 1132 Score = 27.1 bits (57), Expect(2) = 2.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP A PP Sbjct: 659 PPPPPPPPPPAPEQQTMPP 677 Score = 25.0 bits (52), Expect(2) = 2.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 655 TAPPPPPPPP 664 >AL805934-11|CAI18504.1| 1132|Homo sapiens HLA-B associated transcript 3 protein. Length = 1132 Score = 27.1 bits (57), Expect(2) = 2.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP A PP Sbjct: 659 PPPPPPPPPPAPEQQTMPP 677 Score = 25.0 bits (52), Expect(2) = 2.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 655 TAPPPPPPPP 664 >AL670886-2|CAI17785.1| 1132|Homo sapiens HLA-B associated transcript 3 protein. Length = 1132 Score = 27.1 bits (57), Expect(2) = 2.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP A PP Sbjct: 659 PPPPPPPPPPAPEQQTMPP 677 Score = 25.0 bits (52), Expect(2) = 2.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 655 TAPPPPPPPP 664 >AL662847-2|CAI17659.1| 1132|Homo sapiens HLA-B associated transcript 3 protein. Length = 1132 Score = 27.1 bits (57), Expect(2) = 2.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP A PP Sbjct: 659 PPPPPPPPPPAPEQQTMPP 677 Score = 25.0 bits (52), Expect(2) = 2.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 655 TAPPPPPPPP 664 >AL662801-54|CAI18314.1| 1132|Homo sapiens HLA-B associated transcript 3 protein. Length = 1132 Score = 27.1 bits (57), Expect(2) = 2.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP A PP Sbjct: 659 PPPPPPPPPPAPEQQTMPP 677 Score = 25.0 bits (52), Expect(2) = 2.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 655 TAPPPPPPPP 664 >BX511262-8|CAM45799.1| 1126|Homo sapiens HLA-B associated transcript 3 protein. Length = 1126 Score = 27.1 bits (57), Expect(2) = 2.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP A PP Sbjct: 653 PPPPPPPPPPAPEQQTMPP 671 Score = 25.0 bits (52), Expect(2) = 2.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 649 TAPPPPPPPP 658 >BC003133-1|AAH03133.1| 1126|Homo sapiens HLA-B associated transcript 3 protein. Length = 1126 Score = 27.1 bits (57), Expect(2) = 2.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP A PP Sbjct: 653 PPPPPPPPPPAPEQQTMPP 671 Score = 25.0 bits (52), Expect(2) = 2.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 649 TAPPPPPPPP 658 >BA000025-30|BAB63390.1| 1126|Homo sapiens BAT3 protein. Length = 1126 Score = 27.1 bits (57), Expect(2) = 2.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP A PP Sbjct: 653 PPPPPPPPPPAPEQQTMPP 671 Score = 25.0 bits (52), Expect(2) = 2.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 649 TAPPPPPPPP 658 >AL805934-10|CAI18501.1| 1126|Homo sapiens HLA-B associated transcript 3 protein. Length = 1126 Score = 27.1 bits (57), Expect(2) = 2.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP A PP Sbjct: 653 PPPPPPPPPPAPEQQTMPP 671 Score = 25.0 bits (52), Expect(2) = 2.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 649 TAPPPPPPPP 658 >AL670886-1|CAI17784.1| 1126|Homo sapiens HLA-B associated transcript 3 protein. Length = 1126 Score = 27.1 bits (57), Expect(2) = 2.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP A PP Sbjct: 653 PPPPPPPPPPAPEQQTMPP 671 Score = 25.0 bits (52), Expect(2) = 2.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 649 TAPPPPPPPP 658 >AL662847-1|CAI17658.1| 1126|Homo sapiens HLA-B associated transcript 3 protein. Length = 1126 Score = 27.1 bits (57), Expect(2) = 2.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP A PP Sbjct: 653 PPPPPPPPPPAPEQQTMPP 671 Score = 25.0 bits (52), Expect(2) = 2.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 649 TAPPPPPPPP 658 >AL662801-53|CAI18315.1| 1126|Homo sapiens HLA-B associated transcript 3 protein. Length = 1126 Score = 27.1 bits (57), Expect(2) = 2.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP A PP Sbjct: 653 PPPPPPPPPPAPEQQTMPP 671 Score = 25.0 bits (52), Expect(2) = 2.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 649 TAPPPPPPPP 658 >AK131462-1|BAD18607.1| 1103|Homo sapiens protein ( Homo sapiens cDNA FLJ16624 fis, clone TESTI4015442, moderately similar to Mus musculus zinc finger homeodomain 4 (Zfh4-pending). ). Length = 1103 Score = 27.1 bits (57), Expect(2) = 2.0 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 143 PPPPPXPPXGAXSG 184 PPPPP PP + SG Sbjct: 653 PPPPPPPPSSSLSG 666 Score = 25.0 bits (52), Expect(2) = 2.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 648 TPPPPPPPPP 657 >AK025837-1|BAB15254.1| 616|Homo sapiens protein ( Homo sapiens cDNA: FLJ22184 fis, clone HRC00983. ). Length = 616 Score = 33.5 bits (73), Expect = 2.0 Identities = 27/121 (22%), Positives = 31/121 (25%), Gaps = 1/121 (0%) Frame = +1 Query: 367 PPXXXPXXPXXXPPTXXSXXXP-XXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPPXPXX 543 PP P P PP S P P L P P +PPP P Sbjct: 163 PPVQAPFSPPASPPVSPSATPPSQAPPSLAAPPLQVPPSPPASPPMSPSATPPPQAPPPL 222 Query: 544 GXXXXAXPVXXPXXXNLXXXRXGGXXXXPPXXXXPPXHXXPPQXXXXXQXXXIXXPPXRX 723 P P + PP PP PP + PP + Sbjct: 223 AAPPLQVPPSPPASPPMSPSAT-PPPRVPPLLAAPPLQ-VPPSPPASLPMSPLAKPPPQA 280 Query: 724 P 726 P Sbjct: 281 P 281 >AK131399-1|BAD18546.1| 907|Homo sapiens protein ( Homo sapiens cDNA FLJ16492 fis, clone CTONG2028758, highly similar to Mus musculus zfh-4 mRNA for zinc-finger homeodomain protein 4. ). Length = 907 Score = 27.1 bits (57), Expect(2) = 2.0 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 143 PPPPPXPPXGAXSG 184 PPPPP PP + SG Sbjct: 857 PPPPPPPPSSSLSG 870 Score = 25.0 bits (52), Expect(2) = 2.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 852 TPPPPPPPPP 861 >BX511262-10|CAM45801.1| 743|Homo sapiens HLA-B associated transcript 3 protein. Length = 743 Score = 27.1 bits (57), Expect(2) = 2.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP A PP Sbjct: 689 PPPPPPPPPPAPEQQTMPP 707 Score = 25.0 bits (52), Expect(2) = 2.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 685 TAPPPPPPPP 694 >AL805934-12|CAI18508.2| 743|Homo sapiens HLA-B associated transcript 3 protein. Length = 743 Score = 27.1 bits (57), Expect(2) = 2.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP A PP Sbjct: 689 PPPPPPPPPPAPEQQTMPP 707 Score = 25.0 bits (52), Expect(2) = 2.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 685 TAPPPPPPPP 694 >AL670886-3|CAM25014.1| 743|Homo sapiens HLA-B associated transcript 3 protein. Length = 743 Score = 27.1 bits (57), Expect(2) = 2.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP A PP Sbjct: 689 PPPPPPPPPPAPEQQTMPP 707 Score = 25.0 bits (52), Expect(2) = 2.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 685 TAPPPPPPPP 694 >AL662847-3|CAO72072.1| 743|Homo sapiens HLA-B associated transcript 3 protein. Length = 743 Score = 27.1 bits (57), Expect(2) = 2.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP A PP Sbjct: 689 PPPPPPPPPPAPEQQTMPP 707 Score = 25.0 bits (52), Expect(2) = 2.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 685 TAPPPPPPPP 694 >AL662801-55|CAI18316.2| 743|Homo sapiens HLA-B associated transcript 3 protein. Length = 743 Score = 27.1 bits (57), Expect(2) = 2.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP A PP Sbjct: 689 PPPPPPPPPPAPEQQTMPP 707 Score = 25.0 bits (52), Expect(2) = 2.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 685 TAPPPPPPPP 694 >BC085610-1|AAH85610.1| 578|Homo sapiens ZFHX4 protein protein. Length = 578 Score = 27.1 bits (57), Expect(2) = 2.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 143 PPPPPXPPXGAXSG 184 PPPPP PP + SG Sbjct: 128 PPPPPPPPSSSLSG 141 Score = 25.0 bits (52), Expect(2) = 2.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 123 TPPPPPPPPP 132 >BC047745-1|AAH47745.2| 507|Homo sapiens ZFHX4 protein protein. Length = 507 Score = 27.1 bits (57), Expect(2) = 2.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 143 PPPPPXPPXGAXSG 184 PPPPP PP + SG Sbjct: 57 PPPPPPPPSSSLSG 70 Score = 25.0 bits (52), Expect(2) = 2.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 52 TPPPPPPPPP 61 >BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. Length = 682 Score = 33.1 bits (72), Expect = 2.7 Identities = 18/70 (25%), Positives = 20/70 (28%) Frame = +1 Query: 370 PXXXPXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPPXPXXGX 549 P P P P P P + + P PP PPPPP P G Sbjct: 120 PGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGT 179 Query: 550 XXXAXPVXXP 579 P P Sbjct: 180 DGPVPPPPPP 189 >AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. Length = 1100 Score = 33.1 bits (72), Expect = 2.7 Identities = 18/70 (25%), Positives = 20/70 (28%) Frame = +1 Query: 370 PXXXPXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPPXPXXGX 549 P P P P P P + + P PP PPPPP P G Sbjct: 538 PGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGT 597 Query: 550 XXXAXPVXXP 579 P P Sbjct: 598 DGPVPPPPPP 607 >AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen KW-13 protein. Length = 991 Score = 33.1 bits (72), Expect = 2.7 Identities = 18/70 (25%), Positives = 20/70 (28%) Frame = +1 Query: 370 PXXXPXXPXXXPPTXXSXXXPXXXPXLRVXXXHTXKXPXXPPXAKXYXSPPPPPXPXXGX 549 P P P P P P + + P PP PPPPP P G Sbjct: 429 PGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGT 488 Query: 550 XXXAXPVXXP 579 P P Sbjct: 489 DGPVPPPPPP 498 >U80017-3|AAC52048.1| 294|Homo sapiens survival motor neuron protein SMN protein. Length = 294 Score = 29.1 bits (62), Expect(2) = 2.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXPXG 211 PPPPP PP PP P G Sbjct: 217 PPPPPPPPPPHLLSCWLPPFPSG 239 Score = 22.6 bits (46), Expect(2) = 2.9 Identities = 12/30 (40%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 77 PPTKXKNXEPRXX-WXSXXXXTXPPPPPXP 163 P K N +P+ W S PPPPP P Sbjct: 176 PGNKSDNIKPKSAPWNSFL----PPPPPMP 201 >U43883-1|AAC50473.1| 294|Homo sapiens survival motor neuron protein. Length = 294 Score = 29.1 bits (62), Expect(2) = 2.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXPXG 211 PPPPP PP PP P G Sbjct: 217 PPPPPPPPPPHLLSCWLPPFPSG 239 Score = 22.6 bits (46), Expect(2) = 2.9 Identities = 12/30 (40%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 77 PPTKXKNXEPRXX-WXSXXXXTXPPPPPXP 163 P K N +P+ W S PPPPP P Sbjct: 176 PGNKSDNIKPKSAPWNSFL----PPPPPMP 201 >U18423-1|AAA66242.1| 294|Homo sapiens spinal muscular atrophy determining gene protein. Length = 294 Score = 29.1 bits (62), Expect(2) = 2.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXPXG 211 PPPPP PP PP P G Sbjct: 217 PPPPPPPPPPHLLSCWLPPFPSG 239 Score = 22.6 bits (46), Expect(2) = 2.9 Identities = 12/30 (40%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 77 PPTKXKNXEPRXX-WXSXXXXTXPPPPPXP 163 P K N +P+ W S PPPPP P Sbjct: 176 PGNKSDNIKPKSAPWNSFL----PPPPPMP 201 >BC062723-1|AAH62723.1| 294|Homo sapiens survival of motor neuron 1, telomeric protein. Length = 294 Score = 29.1 bits (62), Expect(2) = 2.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXPXG 211 PPPPP PP PP P G Sbjct: 217 PPPPPPPPPPHLLSCWLPPFPSG 239 Score = 22.6 bits (46), Expect(2) = 2.9 Identities = 12/30 (40%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 77 PPTKXKNXEPRXX-WXSXXXXTXPPPPPXP 163 P K N +P+ W S PPPPP P Sbjct: 176 PGNKSDNIKPKSAPWNSFL----PPPPPMP 201 >BC015308-1|AAH15308.1| 294|Homo sapiens survival of motor neuron 1, telomeric protein. Length = 294 Score = 29.1 bits (62), Expect(2) = 2.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXPXG 211 PPPPP PP PP P G Sbjct: 217 PPPPPPPPPPHLLSCWLPPFPSG 239 Score = 22.6 bits (46), Expect(2) = 2.9 Identities = 12/30 (40%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 77 PPTKXKNXEPRXX-WXSXXXXTXPPPPPXP 163 P K N +P+ W S PPPPP P Sbjct: 176 PGNKSDNIKPKSAPWNSFL----PPPPPMP 201 >AC005031-2|AAC62262.1| 294|Homo sapiens survival of motor neuron 1 product protein. Length = 294 Score = 29.1 bits (62), Expect(2) = 2.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXPXG 211 PPPPP PP PP P G Sbjct: 217 PPPPPPPPPPHLLSCWLPPFPSG 239 Score = 22.6 bits (46), Expect(2) = 2.9 Identities = 12/30 (40%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 77 PPTKXKNXEPRXX-WXSXXXXTXPPPPPXP 163 P K N +P+ W S PPPPP P Sbjct: 176 PGNKSDNIKPKSAPWNSFL----PPPPPMP 201 >AC004999-1|AAC83178.1| 294|Homo sapiens survival motor neuron 1 protein protein. Length = 294 Score = 29.1 bits (62), Expect(2) = 2.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXPXG 211 PPPPP PP PP P G Sbjct: 217 PPPPPPPPPPHLLSCWLPPFPSG 239 Score = 22.6 bits (46), Expect(2) = 2.9 Identities = 12/30 (40%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 77 PPTKXKNXEPRXX-WXSXXXXTXPPPPPXP 163 P K N +P+ W S PPPPP P Sbjct: 176 PGNKSDNIKPKSAPWNSFL----PPPPPMP 201 >U21914-1|AAA64505.1| 293|Homo sapiens U18423; it is not known if this copy of the gene protein. Length = 293 Score = 29.1 bits (62), Expect(2) = 2.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXPXG 211 PPPPP PP PP P G Sbjct: 216 PPPPPPPPPPHLLSCWLPPFPSG 238 Score = 22.6 bits (46), Expect(2) = 2.9 Identities = 12/30 (40%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 77 PPTKXKNXEPRXX-WXSXXXXTXPPPPPXP 163 P K N +P+ W S PPPPP P Sbjct: 175 PGNKSDNIKPKSAPWNSFL----PPPPPMP 200 >BC070242-1|AAH70242.1| 282|Homo sapiens survival of motor neuron 2, centromeric protein. Length = 282 Score = 29.1 bits (62), Expect(2) = 2.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXPXG 211 PPPPP PP PP P G Sbjct: 217 PPPPPPPPPPHLLSCWLPPFPSG 239 Score = 22.6 bits (46), Expect(2) = 2.9 Identities = 12/30 (40%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 77 PPTKXKNXEPRXX-WXSXXXXTXPPPPPXP 163 P K N +P+ W S PPPPP P Sbjct: 176 PGNKSDNIKPKSAPWNSFL----PPPPPMP 201 >BC000908-1|AAH00908.1| 282|Homo sapiens SMN1 protein protein. Length = 282 Score = 29.1 bits (62), Expect(2) = 2.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXPXG 211 PPPPP PP PP P G Sbjct: 217 PPPPPPPPPPHLLSCWLPPFPSG 239 Score = 22.6 bits (46), Expect(2) = 2.9 Identities = 12/30 (40%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 77 PPTKXKNXEPRXX-WXSXXXXTXPPPPPXP 163 P K N +P+ W S PPPPP P Sbjct: 176 PGNKSDNIKPKSAPWNSFL----PPPPPMP 201 >AB002358-1|BAA21638.2| 1019|Homo sapiens KIAA0360 protein. Length = 1019 Score = 29.5 bits (63), Expect(2) = 3.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP G SG P Sbjct: 174 PPPPPPPPPGVGSGHLNIP 192 Score = 21.8 bits (44), Expect(2) = 3.4 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPP PP Sbjct: 169 TPAPPPPPPP 178 >Z93020-1|CAI21594.1| 729|Homo sapiens RAN binding protein 9 protein. Length = 729 Score = 32.7 bits (71), Expect = 3.5 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXPXG 211 PPPPP PP A + PP P G Sbjct: 85 PPPPPPPPASAAAPASGPPAPPG 107 >U19927-1|AAC50140.1| 502|Homo sapiens WAS protein. Length = 502 Score = 32.7 bits (71), Expect = 3.5 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXP 205 PPPPP PP + +G PP P Sbjct: 396 PPPPPPPPPSSGNGPAPPPLP 416 >U12707-1|AAA62663.1| 502|Homo sapiens Wiskott-Aldrich syndrome protein protein. Length = 502 Score = 32.7 bits (71), Expect = 3.5 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXP 205 PPPPP PP + +G PP P Sbjct: 396 PPPPPPPPPSSGNGPAPPPLP 416 >BC052781-1|AAH52781.1| 802|Homo sapiens RANBP9 protein protein. Length = 802 Score = 32.7 bits (71), Expect = 3.5 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXPXG 211 PPPPP PP A + PP P G Sbjct: 158 PPPPPPPPASAAAPASGPPAPPG 180 >BC012738-1|AAH12738.1| 502|Homo sapiens Wiskott-Aldrich syndrome (eczema-thrombocytopenia) protein. Length = 502 Score = 32.7 bits (71), Expect = 3.5 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXP 205 PPPPP PP + +G PP P Sbjct: 396 PPPPPPPPPSSGNGPAPPPLP 416 >BC002961-1|AAH02961.1| 514|Homo sapiens WAS protein protein. Length = 514 Score = 32.7 bits (71), Expect = 3.5 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXP 205 PPPPP PP + +G PP P Sbjct: 408 PPPPPPPPPSSGNGPAPPPLP 428 >AL441883-5|CAI19841.1| 729|Homo sapiens RAN binding protein 9 protein. Length = 729 Score = 32.7 bits (71), Expect = 3.5 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXPXG 211 PPPPP PP A + PP P G Sbjct: 85 PPPPPPPPASAAAPASGPPAPPG 107 >AF115549-1|AAD26691.1| 502|Homo sapiens Wiskott-Aldrich Syndrome protein protein. Length = 502 Score = 32.7 bits (71), Expect = 3.5 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXP 205 PPPPP PP + +G PP P Sbjct: 396 PPPPPPPPPSSGNGPAPPPLP 416 >AB055311-1|BAB62525.1| 729|Homo sapiens RanBPM protein. Length = 729 Score = 32.7 bits (71), Expect = 3.5 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXPXG 211 PPPPP PP A + PP P G Sbjct: 85 PPPPPPPPASAAAPASGPPAPPG 107 >AK025571-1|BAB15173.1| 727|Homo sapiens osaminidase mRNA. protein. Length = 727 Score = 25.4 bits (53), Expect(2) = 5.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 143 PPPPPXPPXG 172 PPPPP PP G Sbjct: 3 PPPPPPPPPG 12 Score = 25.0 bits (52), Expect(2) = 5.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 2 TPPPPPPPPP 11 >BC030146-1|AAH30146.1| 717|Homo sapiens RNA binding motif protein 35B protein. Length = 717 Score = 25.4 bits (53), Expect(2) = 5.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 143 PPPPPXPPXG 172 PPPPP PP G Sbjct: 3 PPPPPPPPPG 12 Score = 25.0 bits (52), Expect(2) = 5.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 2 TPPPPPPPPP 11 >BC037223-1|AAH37223.1| 194|Homo sapiens mediator complex subunit 19 protein. Length = 194 Score = 31.5 bits (68), Expect = 8.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP G G PP Sbjct: 28 PPPPPPPPAGGGPGTAPPP 46 >BC009723-1|AAH09723.1| 205|Homo sapiens Unknown (protein for IMAGE:3895048) protein. Length = 205 Score = 31.5 bits (68), Expect = 8.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPP 199 PPPPP PP G G PP Sbjct: 28 PPPPPPPPAGGGPGTAPPP 46 >AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain 4 protein protein. Length = 3567 Score = 31.5 bits (68), Expect = 8.1 Identities = 19/69 (27%), Positives = 20/69 (28%), Gaps = 1/69 (1%) Frame = +1 Query: 367 PPXXXPXXPXXXPPTXXSXXXPXXXPX-LRVXXXHTXKXPXXPPXAKXYXSPPPPPXPXX 543 PP P P P S P P + P PP PPPPP P Sbjct: 1958 PPPPPPPPPLPPAPPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPPPS 2017 Query: 544 GXXXXAXPV 570 PV Sbjct: 2018 APPQVQLPV 2026 >AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens cDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV. ). Length = 844 Score = 31.5 bits (68), Expect = 8.1 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +1 Query: 481 PXXPPXAKXYXSPPPPPXPXXGXXXXAXPVXXPXXXNLXXXRXGGXXXXPPXXXXPPXHX 660 P P A PPPPP P A P P L PP PP Sbjct: 318 PMPPVSAGPPLPPPPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPPGLA 377 Query: 661 XPP 669 PP Sbjct: 378 PPP 380 >L12392-1|AAB38240.1| 3144|Homo sapiens Huntington's Disease protein protein. Length = 3144 Score = 25.4 bits (53), Expect(2) = 8.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 143 PPPPPXPPXG 172 PPPPP PP G Sbjct: 70 PPPPPPPPPG 79 Score = 24.2 bits (50), Expect(2) = 8.8 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +2 Query: 77 PPTKXKNXEPRXXWXSXXXXTXPPPPPXPP 166 PP + +P PPPPP PP Sbjct: 47 PPPPPQLPQPPPQAQPLLPQPQPPPPPPPP 76 >AB016794-1|BAA36753.1| 3144|Homo sapiens huntingtin protein. Length = 3144 Score = 25.4 bits (53), Expect(2) = 8.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 143 PPPPPXPPXG 172 PPPPP PP G Sbjct: 70 PPPPPPPPPG 79 Score = 24.2 bits (50), Expect(2) = 8.8 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +2 Query: 77 PPTKXKNXEPRXXWXSXXXXTXPPPPPXPP 166 PP + +P PPPPP PP Sbjct: 47 PPPPPQLPQPPPQAQPLLPQPQPPPPPPPP 76 >BC117407-1|AAI17408.1| 1081|Homo sapiens LOC152485 protein protein. Length = 1081 Score = 25.0 bits (52), Expect(2) = 9.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 328 TPPPPPPPPP 337 Score = 24.6 bits (51), Expect(2) = 9.6 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXPXG 211 PPPPP PP P P G Sbjct: 334 PPPPPPPPPPQSLELLLLPVPKG 356 >AK091130-1|BAC03591.1| 1077|Homo sapiens protein ( Homo sapiens cDNA FLJ33811 fis, clone CTONG2002095. ). Length = 1077 Score = 25.0 bits (52), Expect(2) = 9.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 137 TXPPPPPXPP 166 T PPPPP PP Sbjct: 328 TPPPPPPPPP 337 Score = 24.6 bits (51), Expect(2) = 9.6 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXPXG 211 PPPPP PP P P G Sbjct: 334 PPPPPPPPPPQSLELLLLPVPKG 356 >AB023209-1|BAA76836.1| 772|Homo sapiens KIAA0992 protein protein. Length = 772 Score = 25.4 bits (53), Expect(2) = 9.8 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 101 EPRXXWXSXXXXTXPPPPP 157 EP W S PPPPP Sbjct: 176 EPEAPWGSSSPSPPPPPPP 194 Score = 24.2 bits (50), Expect(2) = 9.8 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 Query: 143 PPPPPXPPXGAXSGXXXPPXPXG 211 PPPPP P G S P G Sbjct: 212 PPPPPLPSPGQASHCSSPATRFG 234 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,782,406 Number of Sequences: 237096 Number of extensions: 1460695 Number of successful extensions: 24868 Number of sequences better than 10.0: 62 Number of HSP's better than 10.0 without gapping: 4853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16958 length of database: 76,859,062 effective HSP length: 93 effective length of database: 54,809,134 effective search space used: 21923653600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -