BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_B12 (878 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13168| Best HMM Match : Ribosomal_S26e (HMM E-Value=0) 188 7e-48 SB_973| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.057 SB_21167| Best HMM Match : KH_1 (HMM E-Value=0) 30 2.1 >SB_13168| Best HMM Match : Ribosomal_S26e (HMM E-Value=0) Length = 289 Score = 188 bits (457), Expect = 7e-48 Identities = 85/98 (86%), Positives = 92/98 (93%) Frame = +3 Query: 87 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 266 MT+KR NGGR+KHGRGHVK VRCTNCARCVPKDK+IKKFVIRNIVEAAAVRDI DASVY Sbjct: 1 MTKKRCNGGRSKHGRGHVKFVRCTNCARCVPKDKSIKKFVIRNIVEAAAVRDIADASVYE 60 Query: 267 MFQLPKLYAKLHYCVSCAIHSKVVRNRSKKDRRIRTPP 380 ++ LPKLY KLHYCVSCAIHSKVVRNRSK+DR+IRTPP Sbjct: 61 VYALPKLYVKLHYCVSCAIHSKVVRNRSKEDRKIRTPP 98 >SB_973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1200 Score = 35.5 bits (78), Expect = 0.057 Identities = 29/77 (37%), Positives = 39/77 (50%), Gaps = 7/77 (9%) Frame = +3 Query: 162 CAR-CVPKDKAIKKFVIRNIVEAAAVRD--INDASVYPMFQLPKLYAKLHYC--VS--CA 320 C R C+ +D+ I FVI AAAVRD + D ++Y + C VS C Sbjct: 664 CERDCIMRDRTICDFVICG--RAAAVRDCIMRDRAIYNCVMSDRFIRDCVMCDRVSRDCL 721 Query: 321 IHSKVVRNRSKKDRRIR 371 IH +VVR+ +DR IR Sbjct: 722 IHDRVVRDCVMRDRVIR 738 >SB_21167| Best HMM Match : KH_1 (HMM E-Value=0) Length = 1650 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/64 (25%), Positives = 28/64 (43%) Frame = +3 Query: 12 TTHYREFLRFAFPAVLCSPGSEVRNMTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKA 191 T Y+ AFP + C+P ++ +N HG GH+++ T R +++ Sbjct: 72 TEGYQPTYAEAFPPLPCAPSTD-QNQANSNPAAKWRTHGTGHIRSTTVTQVFRVPLEERR 130 Query: 192 IKKF 203 K F Sbjct: 131 YKLF 134 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,139,598 Number of Sequences: 59808 Number of extensions: 294508 Number of successful extensions: 635 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 635 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2502612210 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -