BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_B11 (903 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g33985.1 68417.m04822 expressed protein 30 1.8 At3g13590.1 68416.m01711 DC1 domain-containing protein contains ... 29 5.6 >At4g33985.1 68417.m04822 expressed protein Length = 154 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 Query: 143 HEMRSRA*AEEAWLRRKSHEELGMSGRAR 229 H A EEAWLR+K + LG GR++ Sbjct: 19 HSWSPDADREEAWLRKKGKQSLGRLGRSK 47 >At3g13590.1 68416.m01711 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 513 Score = 28.7 bits (61), Expect = 5.6 Identities = 22/56 (39%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Frame = -3 Query: 220 TRHTQFLMRFSSKPCFLS---SCTRPHLVNVLASEPTQRTTKAKIINFCISIVSFE 62 TR+ L + SSK S S HLVNV E + R ++ I C S VSFE Sbjct: 6 TRNMMTLSKRSSKTKTGSVWFSYLEEHLVNVHIFEESPRDSRDAICKLCKSTVSFE 61 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,298,491 Number of Sequences: 28952 Number of extensions: 220147 Number of successful extensions: 629 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 608 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 627 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2129873112 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -