BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_B07 (1259 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 38 0.013 07_01_0080 + 587674-588510 33 0.47 07_03_1136 + 24218601-24218734,24218769-24219906 33 0.63 03_03_0160 + 14957139-14957603,14958054-14958113,14959012-14959776 32 0.83 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 32 1.1 01_06_1377 + 36764461-36765339 32 1.1 02_05_0686 - 30900748-30902167,30903442-30904742 31 1.4 05_04_0011 + 17139322-17139451,17139552-17140174 31 1.9 02_04_0563 - 23895573-23895614,23896330-23896390,23896901-238970... 31 2.5 09_06_0020 - 20267190-20267612,20269086-20269495,20269573-202697... 30 4.4 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 30 4.4 04_04_1404 + 33302080-33303341,33303435-33305307 30 4.4 02_01_0471 - 3364215-3364912,3365511-3365742,3365827-3366198,336... 30 4.4 01_03_0005 + 11568545-11569119,11569179-11569191 30 4.4 04_04_1641 + 34993807-34994589,34994924-34995022,34995521-349956... 29 5.8 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 29 5.8 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 29 5.8 03_03_0008 - 13674602-13674708,13675272-13675439,13676169-136767... 29 5.8 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 29 7.7 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 29 7.7 05_04_0173 + 18724367-18724476,18724570-18724651,18724750-187248... 29 7.7 03_06_0758 - 36052261-36052301,36052463-36052697,36052895-360529... 29 7.7 03_06_0242 + 32596846-32597268 29 7.7 02_05_0543 + 29872168-29872767,29873089-29873115 29 7.7 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 38.3 bits (85), Expect = 0.013 Identities = 23/67 (34%), Positives = 24/67 (35%), Gaps = 4/67 (5%) Frame = +2 Query: 1070 PPPQQKIFFLXPPP----PXXXLSPXPPXGGXRXRXGXXXFFFLGPRXXXSXPXXXGXXK 1237 PPPQQ + PPP P P PP G F GP P Sbjct: 31 PPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMYY 90 Query: 1238 XPPPPPP 1258 PPPPPP Sbjct: 91 QPPPPPP 97 >07_01_0080 + 587674-588510 Length = 278 Score = 33.1 bits (72), Expect = 0.47 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 1125 SXPXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPPP 1259 S PPR GG G F P P PP G PPPPPP Sbjct: 75 STSTPPRLGGDG-------MFRRPPPPPPPPPSSGSPPPPPPPPP 112 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 32.7 bits (71), Expect = 0.63 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 1258 GGGGGGXFXXPXXGGXGXXGARPQKEKXXXPXPPXPPPRGGXG 1130 GGGGGG P GG G RP P P GG G Sbjct: 150 GGGGGGALARPPGGGRGGALGRPPGGGGGGGGPGRAPGGGGGG 192 Score = 29.1 bits (62), Expect = 7.7 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -2 Query: 1258 GGGGGGXFXXPXXGGXGXXGARPQKEKXXXPXPPXPPPRGGXG 1130 GGGGGG GG G GA + PP GG G Sbjct: 136 GGGGGGGAPRRVLGGGGGGGALARPPGGGRGGALGRPPGGGGG 178 >03_03_0160 + 14957139-14957603,14958054-14958113,14959012-14959776 Length = 429 Score = 32.3 bits (70), Expect = 0.83 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +3 Query: 1122 PSXPX--PPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPPP 1259 PS P PPRGGG F F R P P P G PPP PP Sbjct: 239 PSLPGVGPPRGGGAIPGLPAGFPFLLRPP--PPLPVPGVICRPPPSPP 284 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 31.9 bits (69), Expect = 1.1 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 1191 GRAPXLPXPPXXGXKXXPPPPP 1256 G P +P PP G + PPPPP Sbjct: 290 GMPPRIPPPPVGGTQPPPPPPP 311 >01_06_1377 + 36764461-36765339 Length = 292 Score = 31.9 bits (69), Expect = 1.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 1070 PPPQQKIFFLXPPPPXXXLSPXPPXGG 1150 PPP ++ PPPP +P PP G Sbjct: 163 PPPSSSPYYFPPPPPPAYSAPPPPQYG 189 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 31.5 bits (68), Expect = 1.4 Identities = 23/66 (34%), Positives = 23/66 (34%) Frame = +2 Query: 1061 AXXPPPQQKIFFLXPPPPXXXLSPXPPXGGXRXRXGXXXFFFLGPRXXXSXPXXXGXXKX 1240 A PPP K PPPP P PP G GP P G Sbjct: 325 APPPPPPPKA--APPPPPPKGPPPPPPAKGPPPPPPPK-----GP-SPPPPPPPGGKKGG 376 Query: 1241 PPPPPP 1258 PPPPPP Sbjct: 377 PPPPPP 382 Score = 31.1 bits (67), Expect = 1.9 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 1122 PSXPXPP-RGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPPP 1259 PS P PP R + AP P PP PPPPPP Sbjct: 286 PSLPLPPGRESPSRPQSIAAAAVASPAPPPPPPPKPAAAAPPPPPPP 332 Score = 30.3 bits (65), Expect = 3.3 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = +2 Query: 1070 PPPQQKIFFLXPPPPXXXLSPXPPXGGXRXRXGXXXFFFLGPRXXXSXPXXXGXXKXPPP 1249 PPP+ PPPP P PP G P P PPP Sbjct: 317 PPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPP---------PAKGPPPPPPPKGPSPPPP 367 Query: 1250 PPP 1258 PPP Sbjct: 368 PPP 370 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 1194 RAPXLPXPPXXGXKXXPPPPPP 1259 + P P PP G K PPPPP Sbjct: 360 KGPSPPPPPPPGGKKGGPPPPP 381 >05_04_0011 + 17139322-17139451,17139552-17140174 Length = 250 Score = 31.1 bits (67), Expect = 1.9 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPPP 1259 P P PP GG G G P P P + PPPPPP Sbjct: 71 PPPPSPPNGGNVIGNGKRL------TPTGPDPIHNEFQPPPPPPPP 110 Score = 31.1 bits (67), Expect = 1.9 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPPP 1259 P P PP GG G G P P P + PPPPPP Sbjct: 139 PPPPSPPNGGNVIGDGKRL------TPTGPDPIHNEFQPPPPPPPP 178 >02_04_0563 - 23895573-23895614,23896330-23896390,23896901-23897025, 23897217-23897302,23898052-23898167,23898274-23898336, 23898451-23898530,23898751-23898871,23899419-23899501, 23900081-23900155,23900436-23900936 Length = 450 Score = 30.7 bits (66), Expect = 2.5 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -2 Query: 1258 GGGGGGXFXXPXXGGXGXXGARPQKEKXXXPXPPXPPPRGGXG 1130 GGGGGG GG G GARP + P PR G G Sbjct: 41 GGGGGGG----GGGGGGGGGARPTRFGLARQSSLDPTPREGGG 79 >09_06_0020 - 20267190-20267612,20269086-20269495,20269573-20269747, 20270833-20271066,20271164-20271265,20271354-20272091, 20272204-20272321,20272417-20272667,20272768-20272932 Length = 871 Score = 29.9 bits (64), Expect = 4.4 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -2 Query: 1255 GGGGGXFXXPXXGGXGXXGARPQKEKXXXPXPPXPPPRGG 1136 G G G F GG G G + P PP P P GG Sbjct: 9 GAGSGVFSYDAGGGGGGGGVHNSR---LLPTPPVPKPGGG 45 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 1200 PXLPXPPXXGXKXXPPPPPP 1259 P LP PP PPPPPP Sbjct: 52 PTLPPPPPRTLPPPPPPPPP 71 >04_04_1404 + 33302080-33303341,33303435-33305307 Length = 1044 Score = 29.9 bits (64), Expect = 4.4 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -2 Query: 1249 GGGXFXXPXXGGXGXXG-ARPQKEKXXXPXPPXPPPRGG 1136 GGG P GG G A Q ++ PP PPRGG Sbjct: 328 GGGRASGPRVGGSGSSRPADAQGKRKLGGTPPPSPPRGG 366 >02_01_0471 - 3364215-3364912,3365511-3365742,3365827-3366198, 3366324-3366449,3367056-3367262,3367399-3367492, 3367575-3367621,3367705-3368157,3368261-3368560, 3368656-3369114,3369189-3369410,3369659-3369890, 3370051-3370422,3371210-3371322,3371682-3371903, 3371977-3372180,3372308-3372572,3373123-3373311, 3373441-3373768,3373843-3374248,3374339-3374648, 3375677-3375837,3376825-3376998,3377265-3377609, 3377713-3377754,3378585-3378734,3378847-3379002, 3379088-3379540,3379651-3379966,3380402-3380839, 3381475-3381697,3383538-3383852,3384033-3384095, 3384699-3384903,3385362-3385425,3386014-3386204 Length = 3048 Score = 29.9 bits (64), Expect = 4.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 1258 GGGGGGXFXXPXXGGXGXXGARPQKEKXXXPXPPXPPPR 1142 GGGGGG GG G GA P P PR Sbjct: 22 GGGGGGGGGGGDGGGGGGAGAGGSSSSAPDRLPAAPSPR 60 >01_03_0005 + 11568545-11569119,11569179-11569191 Length = 195 Score = 29.9 bits (64), Expect = 4.4 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -2 Query: 1252 GGGGXFXXPXXGGXGXXGARPQKEKXXXPXPPXPPP 1145 GGGG + P GG G G Q+ P PPP Sbjct: 107 GGGGIYYPPPTGGGGGGGGGWQQGGGGGGAYPTPPP 142 Score = 29.9 bits (64), Expect = 4.4 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = +3 Query: 1131 PXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXP----PPPPP 1259 P P GGG GG G G A P PP P PPPP Sbjct: 114 PPPTGGGGGGGGGWQQGGGGGGAYPTPPPPNPFLPYFPFYYYSPPPP 160 Score = 29.1 bits (62), Expect = 7.7 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -2 Query: 1255 GGGGGXFXXPXXGGXGXXGARPQKEKXXXPXPPXPPP 1145 GGGG + P GG G G Q P PPP Sbjct: 107 GGGGIYYPPPTGGGGGGGGGWQQGGGGGGAYPTPPPP 143 >04_04_1641 + 34993807-34994589,34994924-34995022,34995521-34995648, 34996095-34996235,34996456-34996542,34996627-34996780, 34998569-34998628,34999019-34999447,34999524-34999819, 35000278-35000407,35000690-35001187 Length = 934 Score = 29.5 bits (63), Expect = 5.8 Identities = 17/63 (26%), Positives = 19/63 (30%) Frame = +2 Query: 1070 PPPQQKIFFLXPPPPXXXLSPXPPXGGXRXRXGXXXFFFLGPRXXXSXPXXXGXXKXPPP 1249 PPP + PPPP SP PP + P P P Sbjct: 40 PPPPSPVPSPAPPPPPHRPSPSPPPNPLSSKLWLSSKLSPPPPETLEQPEPSTTTTTTTP 99 Query: 1250 PPP 1258 PPP Sbjct: 100 PPP 102 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 29.5 bits (63), Expect = 5.8 Identities = 20/65 (30%), Positives = 24/65 (36%), Gaps = 4/65 (6%) Frame = +2 Query: 1073 PPQQKIFFLXPPPPXXXLS---PXPPXGGXRXRXGXXXFFFL-GPRXXXSXPXXXGXXKX 1240 PP + + PPPP P PP GG L G + + P G Sbjct: 1089 PPTLGDYGVAPPPPSIGAGAPPPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGV 1148 Query: 1241 PPPPP 1255 PPPPP Sbjct: 1149 PPPPP 1153 Score = 29.1 bits (62), Expect = 7.7 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 1131 PXPPRG-GGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPPP 1259 P PPRG GG GG P P PP PPPPP Sbjct: 1186 PPPPRGHGGVGGPPTP--------PGAPAPPMPPGVPGGPPPPP 1221 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 29.5 bits (63), Expect = 5.8 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXX-----GXKXXPPPPPP 1259 P P PP G G G A P PP G PPPPPP Sbjct: 304 PPHPLPPGAGAGAGTGAPPPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPP 354 >03_03_0008 - 13674602-13674708,13675272-13675439,13676169-13676787, 13676868-13677330,13677855-13678036,13678093-13678235, 13678315-13678423,13679000-13679456,13680490-13682473, 13682507-13682626,13682920-13682971 Length = 1467 Score = 29.5 bits (63), Expect = 5.8 Identities = 16/54 (29%), Positives = 19/54 (35%) Frame = +2 Query: 1097 LXPPPPXXXLSPXPPXGGXRXRXGXXXFFFLGPRXXXSXPXXXGXXKXPPPPPP 1258 + PPPP L+P P G S P + PPPPPP Sbjct: 1211 MPPPPPIAPLNPPGPHGNFPAPPAPYHGNNYHQPPMASVPNEGYHMQPPPPPPP 1264 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 29.1 bits (62), Expect = 7.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 1209 PXPPXXGXKXXPPPPPP 1259 P PP G PPPPPP Sbjct: 625 PPPPPPGKPGGPPPPPP 641 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 29.1 bits (62), Expect = 7.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 1209 PXPPXXGXKXXPPPPPP 1259 P PP G PPPPPP Sbjct: 930 PPPPPPGKPGGPPPPPP 946 >05_04_0173 + 18724367-18724476,18724570-18724651,18724750-18724840, 18725060-18725172,18725270-18725342,18725445-18725565, 18725665-18725782,18726609-18726748,18726824-18726881, 18727007-18727077,18727181-18727733 Length = 509 Score = 29.1 bits (62), Expect = 7.7 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 8/51 (15%) Frame = -2 Query: 1258 GGGGGGXFXXPXXGGXGXXGARPQKEKXXXPXPPXP--------PPRGGXG 1130 G GGG GG G G P ++ P PP P PRGG G Sbjct: 416 GNQGGGYPNRGGQGGGGSYGNAPYPQQGRGPPPPYPGSGMAGTGGPRGGVG 466 >03_06_0758 - 36052261-36052301,36052463-36052697,36052895-36052966, 36056477-36056567,36056650-36056872,36056964-36057300, 36057406-36057588 Length = 393 Score = 29.1 bits (62), Expect = 7.7 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 1076 PQQKIFFLXPPPPXXXLSPXPP 1141 P I+++ PPPP L P PP Sbjct: 181 PVSPIYYVGPPPPPEALRPLPP 202 >03_06_0242 + 32596846-32597268 Length = 140 Score = 29.1 bits (62), Expect = 7.7 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -2 Query: 1258 GGGGGGXFXXPXXGGXGXXGARPQKEKXXXPXPPXPPPR 1142 GGGGGG P G + P P PP PPP+ Sbjct: 17 GGGGGGVGAPPYRPAAGSVWSLP----GMTPRPPGPPPK 51 >02_05_0543 + 29872168-29872767,29873089-29873115 Length = 208 Score = 29.1 bits (62), Expect = 7.7 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 1188 WGRAPXLPXPPXXGXKXXPPPPPP 1259 WG +P P PP PPPPPP Sbjct: 175 WGESPAAPPPP-------PPPPPP 191 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,878,302 Number of Sequences: 37544 Number of extensions: 386837 Number of successful extensions: 8966 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 2086 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5628 length of database: 14,793,348 effective HSP length: 84 effective length of database: 11,639,652 effective search space used: 3899283420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -