BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_B07 (1259 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 36 0.088 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 36 0.088 AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p pro... 36 0.088 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 36 0.088 AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p pro... 36 0.088 AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA... 36 0.088 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 36 0.088 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 36 0.088 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 36 0.088 AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p pro... 34 0.36 AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-P... 34 0.36 AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-P... 34 0.36 AY094861-1|AAM11214.1| 362|Drosophila melanogaster RE22192p pro... 32 1.9 AE014297-3653|AAF56353.1| 362|Drosophila melanogaster CG7016-PA... 32 1.9 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 31 2.5 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 31 2.5 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 31 2.5 BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p pro... 31 2.5 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 31 2.5 AE014296-2355|AAF49762.2| 1155|Drosophila melanogaster CG32138-P... 31 2.5 AE014296-2354|AAF49761.2| 1165|Drosophila melanogaster CG32138-P... 31 2.5 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 31 2.5 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 31 2.5 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 31 2.5 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 31 2.5 AY122168-1|AAM52680.1| 318|Drosophila melanogaster LD26105p pro... 31 3.3 AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P... 31 3.3 AE014296-977|AAF50763.2| 312|Drosophila melanogaster CG10591-PA... 31 3.3 AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. 31 3.3 BT010035-1|AAQ22504.1| 1596|Drosophila melanogaster LD47819p pro... 30 7.7 AE014298-2938|AAN09519.1| 1596|Drosophila melanogaster CG12701-P... 30 7.7 AE014298-2937|AAF49020.1| 1596|Drosophila melanogaster CG12701-P... 30 7.7 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 36.3 bits (80), Expect = 0.088 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFS--FWGRAPXLPXPPXXGXKXXPPPPPP 1259 P P PP GGG G P P PP G PPPPPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 Score = 31.1 bits (67), Expect = 3.3 Identities = 18/54 (33%), Positives = 20/54 (37%) Frame = +2 Query: 1097 LXPPPPXXXLSPXPPXGGXRXRXGXXXFFFLGPRXXXSXPXXXGXXKXPPPPPP 1258 + PPPP +P PP R G GP P PPPPPP Sbjct: 513 MPPPPPGGGGAPPPPPPPMPGRAGG------GPPPPPPPPMPGRAGGPPPPPPP 560 Score = 31.1 bits (67), Expect = 3.3 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPP 1256 P P P R GG G GRA P PP PPPPP Sbjct: 527 PPPPMPGRAGG-GPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 36.3 bits (80), Expect = 0.088 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFS--FWGRAPXLPXPPXXGXKXXPPPPPP 1259 P P PP GGG G P P PP G PPPPPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 Score = 31.1 bits (67), Expect = 3.3 Identities = 18/54 (33%), Positives = 20/54 (37%) Frame = +2 Query: 1097 LXPPPPXXXLSPXPPXGGXRXRXGXXXFFFLGPRXXXSXPXXXGXXKXPPPPPP 1258 + PPPP +P PP R G GP P PPPPPP Sbjct: 513 MPPPPPGGGGAPPPPPPPMPGRAGG------GPPPPPPPPMPGRAGGPPPPPPP 560 Score = 31.1 bits (67), Expect = 3.3 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPP 1256 P P P R GG G GRA P PP PPPPP Sbjct: 527 PPPPMPGRAGG-GPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 >AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p protein. Length = 417 Score = 36.3 bits (80), Expect = 0.088 Identities = 21/63 (33%), Positives = 24/63 (38%) Frame = +2 Query: 1070 PPPQQKIFFLXPPPPXXXLSPXPPXGGXRXRXGXXXFFFLGPRXXXSXPXXXGXXKXPPP 1249 PP + L PPPP P PP GG G + P + P PPP Sbjct: 353 PPIPGTLPPLIPPPPGTSAPPMPPWGGGAYS-GWGGGYAPPPPPPCAPPPPALSLSQPPP 411 Query: 1250 PPP 1258 PPP Sbjct: 412 PPP 414 Score = 35.5 bits (78), Expect = 0.15 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +3 Query: 1131 PXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPPP 1259 P PP GGG ++ P P PP PPPPPP Sbjct: 373 PMPPWGGGAYSGWGGGYAPPPPPPCAPPPPALSLSQPPPPPPP 415 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 36.3 bits (80), Expect = 0.088 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPPP 1259 PS P PP G G G G AP P P + PPPPPP Sbjct: 37 PSVPFPPPGSGNGIEDSGIGP--GPAPSAPAPSYGPPQTRPPPPPP 80 >AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p protein. Length = 222 Score = 36.3 bits (80), Expect = 0.088 Identities = 21/63 (33%), Positives = 24/63 (38%) Frame = +2 Query: 1070 PPPQQKIFFLXPPPPXXXLSPXPPXGGXRXRXGXXXFFFLGPRXXXSXPXXXGXXKXPPP 1249 PP + L PPPP P PP GG G + P + P PPP Sbjct: 158 PPIPGTLPPLIPPPPGTSAPPMPPWGGGAYS-GWGGGYAPPPPPPCAPPPPALSLSQPPP 216 Query: 1250 PPP 1258 PPP Sbjct: 217 PPP 219 Score = 35.5 bits (78), Expect = 0.15 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +3 Query: 1131 PXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPPP 1259 P PP GGG ++ P P PP PPPPPP Sbjct: 178 PMPPWGGGAYSGWGGGYAPPPPPPCAPPPPALSLSQPPPPPPP 220 >AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA protein. Length = 787 Score = 36.3 bits (80), Expect = 0.088 Identities = 21/63 (33%), Positives = 24/63 (38%) Frame = +2 Query: 1070 PPPQQKIFFLXPPPPXXXLSPXPPXGGXRXRXGXXXFFFLGPRXXXSXPXXXGXXKXPPP 1249 PP + L PPPP P PP GG G + P + P PPP Sbjct: 723 PPIPGTLPPLIPPPPGTSAPPMPPWGGGAYS-GWGGGYAPPPPPPCAPPPPALSLSQPPP 781 Query: 1250 PPP 1258 PPP Sbjct: 782 PPP 784 Score = 35.5 bits (78), Expect = 0.15 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +3 Query: 1131 PXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPPP 1259 P PP GGG ++ P P PP PPPPPP Sbjct: 743 PMPPWGGGAYSGWGGGYAPPPPPPCAPPPPALSLSQPPPPPPP 785 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 36.3 bits (80), Expect = 0.088 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPPP 1259 PS P PP G G G G AP P P + PPPPPP Sbjct: 37 PSVPFPPPGSGNGIEDSGIGP--GPAPSAPAPSYGPPQTRPPPPPP 80 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 36.3 bits (80), Expect = 0.088 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFS--FWGRAPXLPXPPXXGXKXXPPPPPP 1259 P P PP GGG G P P PP G PPPPPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 Score = 31.1 bits (67), Expect = 3.3 Identities = 18/54 (33%), Positives = 20/54 (37%) Frame = +2 Query: 1097 LXPPPPXXXLSPXPPXGGXRXRXGXXXFFFLGPRXXXSXPXXXGXXKXPPPPPP 1258 + PPPP +P PP R G GP P PPPPPP Sbjct: 513 MPPPPPGGGGAPPPPPPPMPGRAGG------GPPPPPPPPMPGRAGGPPPPPPP 560 Score = 31.1 bits (67), Expect = 3.3 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPP 1256 P P P R GG G GRA P PP PPPPP Sbjct: 527 PPPPMPGRAGG-GPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 36.3 bits (80), Expect = 0.088 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFS--FWGRAPXLPXPPXXGXKXXPPPPPP 1259 P P PP GGG G P P PP G PPPPPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 Score = 31.1 bits (67), Expect = 3.3 Identities = 18/54 (33%), Positives = 20/54 (37%) Frame = +2 Query: 1097 LXPPPPXXXLSPXPPXGGXRXRXGXXXFFFLGPRXXXSXPXXXGXXKXPPPPPP 1258 + PPPP +P PP R G GP P PPPPPP Sbjct: 513 MPPPPPGGGGAPPPPPPPMPGRAGG------GPPPPPPPPMPGRAGGPPPPPPP 560 Score = 31.1 bits (67), Expect = 3.3 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPP 1256 P P P R GG G GRA P PP PPPPP Sbjct: 527 PPPPMPGRAGG-GPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 >AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p protein. Length = 514 Score = 34.3 bits (75), Expect = 0.36 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPP 1256 P P PP G F G AP P PP G PPPPP Sbjct: 384 PPPPAPPAGVPPAPPPMPVFGAGG-APPPPPPPSSGMAGVPPPPP 427 Score = 30.7 bits (66), Expect = 4.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPPP 1259 P P PP G G P P P G PPPPPP Sbjct: 369 PVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPP 414 >AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-PA, isoform A protein. Length = 514 Score = 34.3 bits (75), Expect = 0.36 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPP 1256 P P PP G F G AP P PP G PPPPP Sbjct: 384 PPPPAPPAGVPPAPPPMPVFGAGG-APPPPPPPSSGMAGVPPPPP 427 Score = 30.7 bits (66), Expect = 4.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPPP 1259 P P PP G G P P P G PPPPPP Sbjct: 369 PVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPP 414 >AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-PB, isoform B protein. Length = 630 Score = 34.3 bits (75), Expect = 0.36 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPP 1256 P P PP G F G AP P PP G PPPPP Sbjct: 500 PPPPAPPAGVPPAPPPMPVFGAGG-APPPPPPPSSGMAGVPPPPP 543 Score = 30.7 bits (66), Expect = 4.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPPP 1259 P P PP G G P P P G PPPPPP Sbjct: 485 PVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPP 530 >AY094861-1|AAM11214.1| 362|Drosophila melanogaster RE22192p protein. Length = 362 Score = 31.9 bits (69), Expect = 1.9 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 1131 PXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPP 1256 P PPR G GG W P PP G PPPP Sbjct: 176 PPPPRPGWNGGGPPPPMPGWNGGG--PPPPRPGWNGGGPPPP 215 >AE014297-3653|AAF56353.1| 362|Drosophila melanogaster CG7016-PA protein. Length = 362 Score = 31.9 bits (69), Expect = 1.9 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 1131 PXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPP 1256 P PPR G GG W P PP G PPPP Sbjct: 176 PPPPRPGWNGGGPPPPMPGWNGGG--PPPPRPGWNGGGPPPP 215 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 31.5 bits (68), Expect = 2.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 1197 APXLPXPPXXGXKXXPPPPPP 1259 AP P PP G PPPPPP Sbjct: 518 APPPPPPPPPGSGSAPPPPPP 538 Score = 30.7 bits (66), Expect = 4.4 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 3/65 (4%) Frame = +2 Query: 1070 PPPQQKIFFLXPPPPXXXLSPXPP---XGGXRXRXGXXXFFFLGPRXXXSXPXXXGXXKX 1240 PPP F+ PPPP P PP G P P G Sbjct: 489 PPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIP 548 Query: 1241 PPPPP 1255 PPPPP Sbjct: 549 PPPPP 553 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 31.5 bits (68), Expect = 2.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 1197 APXLPXPPXXGXKXXPPPPPP 1259 AP P PP G PPPPPP Sbjct: 613 APPPPPPPPPGSGSAPPPPPP 633 Score = 30.7 bits (66), Expect = 4.4 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 3/65 (4%) Frame = +2 Query: 1070 PPPQQKIFFLXPPPPXXXLSPXPP---XGGXRXRXGXXXFFFLGPRXXXSXPXXXGXXKX 1240 PPP F+ PPPP P PP G P P G Sbjct: 584 PPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIP 643 Query: 1241 PPPPP 1255 PPPPP Sbjct: 644 PPPPP 648 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 31.5 bits (68), Expect = 2.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 1197 APXLPXPPXXGXKXXPPPPPP 1259 AP P PP G PPPPPP Sbjct: 746 APPPPPPPPPGSGSAPPPPPP 766 Score = 30.7 bits (66), Expect = 4.4 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 3/65 (4%) Frame = +2 Query: 1070 PPPQQKIFFLXPPPPXXXLSPXPP---XGGXRXRXGXXXFFFLGPRXXXSXPXXXGXXKX 1240 PPP F+ PPPP P PP G P P G Sbjct: 717 PPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIP 776 Query: 1241 PPPPP 1255 PPPPP Sbjct: 777 PPPPP 781 >BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p protein. Length = 1273 Score = 31.5 bits (68), Expect = 2.5 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPP 1256 P+ P PP G G S AP P P PPPPP Sbjct: 719 PAPPAPPPPPGFSPLGSPSGSLASTAPSPPHAPPMLSSFQPPPPP 763 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 31.5 bits (68), Expect = 2.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 1197 APXLPXPPXXGXKXXPPPPPP 1259 AP P PP G PPPPPP Sbjct: 509 APPPPPPPPPGSGSAPPPPPP 529 Score = 31.1 bits (67), Expect = 3.3 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +2 Query: 1070 PPPQQKIFFLXPPPPXXXLSPXPP---XGGXRXRXGXXXFFFLGPRXXXSXPXXXGXXKX 1240 PPP F PPPP P PP G P P G Sbjct: 480 PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIP 539 Query: 1241 PPPPP 1255 PPPPP Sbjct: 540 PPPPP 544 >AE014296-2355|AAF49762.2| 1155|Drosophila melanogaster CG32138-PB, isoform B protein. Length = 1155 Score = 31.5 bits (68), Expect = 2.5 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPP 1256 P+ P PP G G S AP P P PPPPP Sbjct: 611 PAPPAPPPPPGFSPLGSPSGSLASTAPSPPHAPPMLSSFQPPPPP 655 >AE014296-2354|AAF49761.2| 1165|Drosophila melanogaster CG32138-PA, isoform A protein. Length = 1165 Score = 31.5 bits (68), Expect = 2.5 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFSFWGRAPXLPXPPXXGXKXXPPPPP 1256 P+ P PP G G S AP P P PPPPP Sbjct: 611 PAPPAPPPPPGFSPLGSPSGSLASTAPSPPHAPPMLSSFQPPPPP 655 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 31.5 bits (68), Expect = 2.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 1197 APXLPXPPXXGXKXXPPPPPP 1259 AP P PP G PPPPPP Sbjct: 519 APPPPPPPPPGSGSAPPPPPP 539 Score = 31.1 bits (67), Expect = 3.3 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +2 Query: 1070 PPPQQKIFFLXPPPPXXXLSPXPP---XGGXRXRXGXXXFFFLGPRXXXSXPXXXGXXKX 1240 PPP F PPPP P PP G P P G Sbjct: 490 PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIP 549 Query: 1241 PPPPP 1255 PPPPP Sbjct: 550 PPPPP 554 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 31.5 bits (68), Expect = 2.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 1197 APXLPXPPXXGXKXXPPPPPP 1259 AP P PP G PPPPPP Sbjct: 509 APPPPPPPPPGSGSAPPPPPP 529 Score = 31.1 bits (67), Expect = 3.3 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +2 Query: 1070 PPPQQKIFFLXPPPPXXXLSPXPP---XGGXRXRXGXXXFFFLGPRXXXSXPXXXGXXKX 1240 PPP F PPPP P PP G P P G Sbjct: 480 PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIP 539 Query: 1241 PPPPP 1255 PPPPP Sbjct: 540 PPPPP 544 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 31.5 bits (68), Expect = 2.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 1197 APXLPXPPXXGXKXXPPPPPP 1259 AP P PP G PPPPPP Sbjct: 667 APPPPPPPPPGSGSAPPPPPP 687 Score = 31.1 bits (67), Expect = 3.3 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +2 Query: 1070 PPPQQKIFFLXPPPPXXXLSPXPP---XGGXRXRXGXXXFFFLGPRXXXSXPXXXGXXKX 1240 PPP F PPPP P PP G P P G Sbjct: 638 PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIP 697 Query: 1241 PPPPP 1255 PPPPP Sbjct: 698 PPPPP 702 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 31.5 bits (68), Expect = 2.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 1197 APXLPXPPXXGXKXXPPPPPP 1259 AP P PP G PPPPPP Sbjct: 614 APPPPPPPPPGSGSAPPPPPP 634 Score = 31.1 bits (67), Expect = 3.3 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +2 Query: 1070 PPPQQKIFFLXPPPPXXXLSPXPP---XGGXRXRXGXXXFFFLGPRXXXSXPXXXGXXKX 1240 PPP F PPPP P PP G P P G Sbjct: 585 PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIP 644 Query: 1241 PPPPP 1255 PPPPP Sbjct: 645 PPPPP 649 >AY122168-1|AAM52680.1| 318|Drosophila melanogaster LD26105p protein. Length = 318 Score = 31.1 bits (67), Expect = 3.3 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFSFWGRAPXLPXPP----XXGXKXXPPPPPP 1259 P P PP G G +WG P P PP G + P PP P Sbjct: 44 PGPPGPP--GNQNGLSGSGSGYWGYPPTGPYPPNLPFIQGPRGLPGPPGP 91 >AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA protein. Length = 1644 Score = 31.1 bits (67), Expect = 3.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 1191 GRAPXLPXPPXXGXKXXPPPPPP 1259 G AP P PP PPPPPP Sbjct: 292 GAAPPPPPPPMINGGALPPPPPP 314 >AE014296-977|AAF50763.2| 312|Drosophila melanogaster CG10591-PA protein. Length = 312 Score = 31.1 bits (67), Expect = 3.3 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +3 Query: 1122 PSXPXPPRGGGXGGXGXXXFSFWGRAPXLPXPP----XXGXKXXPPPPPP 1259 P P PP G G +WG P P PP G + P PP P Sbjct: 38 PGPPGPP--GNQNGLSGSGSGYWGYPPTGPYPPNLPFIQGPRGLPGPPGP 85 >AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. Length = 1644 Score = 31.1 bits (67), Expect = 3.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 1191 GRAPXLPXPPXXGXKXXPPPPPP 1259 G AP P PP PPPPPP Sbjct: 292 GAAPPPPPPPMINGGALPPPPPP 314 >BT010035-1|AAQ22504.1| 1596|Drosophila melanogaster LD47819p protein. Length = 1596 Score = 29.9 bits (64), Expect = 7.7 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 1258 GGGGGGXFXXPXXGGXGXXGARP 1190 GGGGGG P GG G G+ P Sbjct: 34 GGGGGGGSGGPGAGGTGGVGSAP 56 >AE014298-2938|AAN09519.1| 1596|Drosophila melanogaster CG12701-PB, isoform B protein. Length = 1596 Score = 29.9 bits (64), Expect = 7.7 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 1258 GGGGGGXFXXPXXGGXGXXGARP 1190 GGGGGG P GG G G+ P Sbjct: 34 GGGGGGGSGGPGAGGTGGVGSAP 56 >AE014298-2937|AAF49020.1| 1596|Drosophila melanogaster CG12701-PA, isoform A protein. Length = 1596 Score = 29.9 bits (64), Expect = 7.7 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 1258 GGGGGGXFXXPXXGGXGXXGARP 1190 GGGGGG P GG G G+ P Sbjct: 34 GGGGGGGSGGPGAGGTGGVGSAP 56 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,747,977 Number of Sequences: 53049 Number of extensions: 554621 Number of successful extensions: 9101 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 2118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5830 length of database: 24,988,368 effective HSP length: 87 effective length of database: 20,373,105 effective search space used: 6763870860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -