BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_B06 (852 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56340.1 68416.m06264 40S ribosomal protein S26 (RPS26C) seve... 161 4e-40 At2g40590.1 68415.m05007 40S ribosomal protein S26 (RPS26B) 158 4e-39 At2g40510.1 68415.m04999 40S ribosomal protein S26 (RPS26A) 158 4e-39 At3g60200.1 68416.m06726 expressed protein hypothetical proteins... 30 2.2 At1g15290.1 68414.m01830 tetratricopeptide repeat (TPR)-containi... 29 5.2 At3g14440.1 68416.m01830 9-cis-epoxycarotenoid dioxygenase, puta... 28 6.9 >At3g56340.1 68416.m06264 40S ribosomal protein S26 (RPS26C) several 40S ribosomal protein S26 Length = 130 Score = 161 bits (392), Expect = 4e-40 Identities = 72/113 (63%), Positives = 86/113 (76%) Frame = +1 Query: 76 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 255 MT KRRNGGR KH RGHVK +RC+NC +C PKDKAIK+F++RNIVE AA+RD+ +ASVY Sbjct: 1 MTFKRRNGGRNKHNRGHVKPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYE 60 Query: 256 MFQLPKLYAKLHYCVSCAIHSKVVRNRSKKDRRIRTPPKSNFPRDMSRPQAVQ 414 + LPKLYAK YCVSCAIHS VVR RS+ +RR+RTPP R P+ Q Sbjct: 61 GYTLPKLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPRFARRKEDTPKPAQ 113 >At2g40590.1 68415.m05007 40S ribosomal protein S26 (RPS26B) Length = 131 Score = 158 bits (384), Expect = 4e-39 Identities = 71/113 (62%), Positives = 85/113 (75%) Frame = +1 Query: 76 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 255 MT KRRNGGR KH RGHV +RC+NC +C PKDKAIK+F++RNIVE AA+RD+ +ASVY Sbjct: 1 MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYE 60 Query: 256 MFQLPKLYAKLHYCVSCAIHSKVVRNRSKKDRRIRTPPKSNFPRDMSRPQAVQ 414 + LPKLYAK YCVSCAIHS VVR RS+ +RR+RTPP R P+ Q Sbjct: 61 GYTLPKLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPRFTRRKEDTPKPGQ 113 >At2g40510.1 68415.m04999 40S ribosomal protein S26 (RPS26A) Length = 133 Score = 158 bits (384), Expect = 4e-39 Identities = 71/113 (62%), Positives = 85/113 (75%) Frame = +1 Query: 76 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 255 MT KRRNGGR KH RGHV +RC+NC +C PKDKAIK+F++RNIVE AA+RD+ +ASVY Sbjct: 1 MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYE 60 Query: 256 MFQLPKLYAKLHYCVSCAIHSKVVRNRSKKDRRIRTPPKSNFPRDMSRPQAVQ 414 + LPKLYAK YCVSCAIHS VVR RS+ +RR+RTPP R P+ Q Sbjct: 61 GYTLPKLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPRFARRKEDTPKPGQ 113 >At3g60200.1 68416.m06726 expressed protein hypothetical proteins At2g44600 - Arabidopsis thaliana, EMBL:AAC27462 Length = 305 Score = 29.9 bits (64), Expect = 2.2 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +1 Query: 286 LHYCVSCAIHSKVVRNRSKKDRRIRTPPKSNFPRDMSRPQAVQRK 420 L S A+ + V N+SKK PP FPR +S P +RK Sbjct: 26 LSLAASAAVSAAVEDNQSKKSNNNNHPPLLIFPRSVS-PYVTRRK 69 >At1g15290.1 68414.m01830 tetratricopeptide repeat (TPR)-containing protein ESTs gb|F20110 and gb|F20109 come from this gene; contains Pfam profile PF00515: TPR Domain Length = 1558 Score = 28.7 bits (61), Expect = 5.2 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 594 FTNKAFFSLHFSCGLS 547 + N+A F LHF+CGLS Sbjct: 904 YVNRALFLLHFTCGLS 919 >At3g14440.1 68416.m01830 9-cis-epoxycarotenoid dioxygenase, putative / neoxanthin cleavage enzyme, putative / carotenoid cleavage dioxygenase, putative similar to 9-cis-epoxycarotenoid dioxygenase GB:AAF26356 [GI:6715257][Phaseolus vulgaris] Length = 599 Score = 28.3 bits (60), Expect = 6.9 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +1 Query: 286 LHYCVSCAIHSKVVRNRSKKDRRIRTPPKSNFPRDMSRPQAV 411 L YC S + S+V R + + TPP +FP+ S A+ Sbjct: 32 LSYCSSLPMASRVTRKLNVSSA-LHTPPALHFPKQSSNSPAI 72 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,235,015 Number of Sequences: 28952 Number of extensions: 252836 Number of successful extensions: 577 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 569 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 577 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1980143200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -