BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_B05 (962 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 40 4e-04 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 37 0.004 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 37 0.004 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 37 0.005 SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 36 0.009 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 35 0.015 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 35 0.020 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 31 0.24 SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex p... 30 0.42 SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pomb... 29 1.3 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 29 1.3 SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1... 23 3.6 SPAC26A3.09c |rga2||GTPase activating protein Rga2|Schizosacchar... 27 3.9 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 27 3.9 SPCC645.07 |rgf1||RhoGEF for Rho1, Rgf1|Schizosaccharomyces pomb... 26 6.9 SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccha... 26 6.9 SPAC20G4.02c |fus1||formin Fus1|Schizosaccharomyces pombe|chr 1|... 26 9.1 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 40.3 bits (90), Expect = 4e-04 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 +P P P P + PPPP P PP PPP PPP Sbjct: 749 IPVPPPAPIMGGPPPPPP---PPGVAGAGPPPPPPP 781 Score = 35.1 bits (77), Expect = 0.015 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXX---NPPXPXPXXPPPXPPP 951 P P PP P P P PP P PPP PPP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPP 767 Score = 34.3 bits (75), Expect = 0.026 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P + P P P P PP P PPP PP Sbjct: 734 PPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPP 768 Score = 32.7 bits (71), Expect = 0.079 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +3 Query: 882 PPXXPXP--QPPPPXPPXXPXXXPPPXPP 962 PP P PPPP PP PPP PP Sbjct: 752 PPPAPIMGGPPPPPPPPGVAGAGPPPPPP 780 Score = 31.5 bits (68), Expect = 0.18 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P + PP PPPP PP PP PP Sbjct: 748 PIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPP 779 Score = 29.1 bits (62), Expect = 0.98 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P + PAP P P P A P P P PPP G P Sbjct: 734 PPPPAVIVPTPAPAPI-PVPPPA--PIMGGPPPPPPPPGVAGAGP 775 Score = 29.1 bits (62), Expect = 0.98 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 583 PAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGG 681 P P P P A A PP P P PP S GG Sbjct: 761 PPPPPPPPGVAGAGPPPP----PPPPPAVSAGG 789 Score = 27.9 bits (59), Expect = 2.3 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 595 PXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P PA P P P PP GG P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPP 762 Score = 26.2 bits (55), Expect = 6.9 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPPXG 694 PTP +P PP P P PPP P G G Sbjct: 742 PTPAPAPIPVP-PPAPIMGGPP-PPPPPPGVAGAG 774 Score = 25.8 bits (54), Expect = 9.1 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 L P P P P P P PPP P Sbjct: 729 LKSPPPPPPAVIVPTPAPAPIPVPPPAP 756 Score = 25.8 bits (54), Expect = 9.1 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = +2 Query: 596 PXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P A + PP P P PP P PP Sbjct: 753 PPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 37.1 bits (82), Expect = 0.004 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 5/43 (11%) Frame = -1 Query: 959 GXXGGGXGG-----GXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GG G G G GG G GG G GG G G G Sbjct: 224 GGFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGGGPGGFGGGPG 266 Score = 33.5 bits (73), Expect = 0.045 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G GGG GG G G GG G GG G GG G Sbjct: 238 GGFGGGPGG--FGGGLGGFGGGPGGFGGGPGGHG 269 Score = 27.5 bits (58), Expect = 3.0 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Frame = -1 Query: 959 GXXGGGXGGGXXG--XGXGGL--XXGXGGGGXXXGGXGXGXG 846 G GG GGG G G GG G GG G GG G G Sbjct: 187 GGGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGG 228 Score = 27.5 bits (58), Expect = 3.0 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G GG GG G G G G GG GG Sbjct: 208 GGFGGFGGEGHHHGGHGGFGGGPG-GFEGGPGGFGGGPGGFGG 249 Score = 27.5 bits (58), Expect = 3.0 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G GG GG G G G G GG GG Sbjct: 222 GHGGFGGGPGGFEGGPGGFGGGPG-GFGGGLGGFGGGPGGFGG 263 Score = 26.6 bits (56), Expect = 5.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 687 GGAPXGXGGGRXGXXGLGXGGXCXGRVXAXGVG 589 GG P G GGG G G G GG G G G Sbjct: 241 GGGPGGFGGGLGGFGG-GPGGFGGGPGGHGGPG 272 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 37.1 bits (82), Expect = 0.004 Identities = 18/47 (38%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +1 Query: 553 PRPSGLXPXX-PAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPL 690 P PSG P P+ P P P+ A PP PK P P G P+ Sbjct: 1077 PAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPV 1123 Score = 36.3 bits (80), Expect = 0.006 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXP--XXPXXXPPPXXP 961 PP P + PP PPP PP P P P PP P Sbjct: 1179 PPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAP 1217 Score = 35.9 bits (79), Expect = 0.009 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P P P P PP P P PP P P Sbjct: 1063 PPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKP 1097 Score = 35.5 bits (78), Expect = 0.011 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P P PP P P PP P P PP P Sbjct: 1023 PVPLPSADAPPIPVPSTAPPVPIPTSTPPVP 1053 Score = 35.5 bits (78), Expect = 0.011 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXN-PPXPXPXXPPPXPPP 951 P P P + PP P P PP P P PP P P Sbjct: 1093 PVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKP 1126 Score = 35.5 bits (78), Expect = 0.011 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXP-XXPPPXPPP 951 P P P + PP P P PP P P PP P P Sbjct: 1122 PVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAP 1155 Score = 35.5 bits (78), Expect = 0.011 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXP-XXPPPXPPP 951 P P P + PP P P PP P P PP P P Sbjct: 1141 PVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAP 1174 Score = 35.5 bits (78), Expect = 0.011 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 553 PRPSGLXPXXPAPX--PXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P+PS P PAP P P P+ A PP P P P G P Sbjct: 1143 PKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVP 1189 Score = 35.1 bits (77), Expect = 0.015 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXP-XXPPPXPPP 951 P P P + PP P P PP P P PP P P Sbjct: 1103 PVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVP 1136 Score = 34.7 bits (76), Expect = 0.020 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXN-PPXPXPXXP-PPXPPP 951 P P P + PP P P PP P P PP PPP Sbjct: 1160 PVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPP 1194 Score = 34.7 bits (76), Expect = 0.020 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXP-PPXPPP 951 P P P + PP P P PP P P PP P P Sbjct: 1199 PVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVP 1232 Score = 34.3 bits (75), Expect = 0.026 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXN-PPXPXPXXPPPXPPP 951 P P P PP P P PP P P PP P P Sbjct: 1170 PVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKP 1203 Score = 33.9 bits (74), Expect = 0.034 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXN-PPXPXPXXPPPXPPP 951 P PP PP P P PP P P PP P P Sbjct: 1189 PPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTP 1222 Score = 32.7 bits (71), Expect = 0.079 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +1 Query: 553 PRPSGLXPXXPAP---XPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P+PS P PAP P P PA PP P P P P G P Sbjct: 1162 PKPSVAAPPVPAPSSGIPPVPKPAAGVPPVP-PPSEAPPVPKPSVGVP 1208 Score = 32.3 bits (70), Expect = 0.10 Identities = 17/48 (35%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +1 Query: 553 PRPSGLXPXXPAP--XPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPL 690 P+PS P PAP P P P+ A PP P P S P+ Sbjct: 1105 PKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPV 1152 Score = 32.3 bits (70), Expect = 0.10 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXP 925 PP P PP PPP PP P P Sbjct: 1198 PPVPKPSVGVPPVPPPSTAPPVPTP 1222 Score = 31.9 bits (69), Expect = 0.14 Identities = 33/126 (26%), Positives = 39/126 (30%), Gaps = 1/126 (0%) Frame = +2 Query: 314 PPNXXP*SXYPXPLASXXXPXXRRPRXXFSXHXXTXPTPPAXAXXLXGPSSAFP-PXXXX 490 PP P S P P +S P P S + P P + A + PS P P Sbjct: 1041 PPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAP-SGAPPVPAPSGIPPVPKPSV 1099 Query: 491 XXXXXXXXXXAXPALXXXXXXXXXXXXXXXXXRPTPXAXTLPXQXPPXPXPXXPXRPPPX 670 A P + P P +P PP P P P P Sbjct: 1100 AAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAP-PVP----VPSGAPPVPKPSVAAPPVPA 1154 Query: 671 PXGAPP 688 P GAPP Sbjct: 1155 PSGAPP 1160 Score = 31.5 bits (68), Expect = 0.18 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 +P P PP+ P P P PPP P P Sbjct: 1034 IPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAP 1069 Score = 31.1 bits (67), Expect = 0.24 Identities = 16/48 (33%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +1 Query: 553 PRPSGLXPXXPAPX--PXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPL 690 P+PS P P P P P P+ A PP P P S P+ Sbjct: 1124 PKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPV 1171 Score = 30.7 bits (66), Expect = 0.32 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P P PP P P PP P P Sbjct: 1113 PVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKP 1145 Score = 30.7 bits (66), Expect = 0.32 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P P PP P P PP P P Sbjct: 1132 PVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKP 1164 Score = 30.3 bits (65), Expect = 0.42 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P S PP P P TPP P PP P Sbjct: 1032 PPIPVP-STAPPVPIPTSTPPVPKSSSGAPSAPPPVP 1067 Score = 30.3 bits (65), Expect = 0.42 Identities = 19/49 (38%), Positives = 21/49 (42%), Gaps = 3/49 (6%) Frame = +1 Query: 553 PRPSGLXPXXPAP---XPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPL 690 P PSG P P P P P P+ A PP PK P P G P+ Sbjct: 1115 PAPSGA-PPVPKPSVAAPPVPVPSGA-PPVPKPSVAAPPVPAPSGAPPV 1161 Score = 30.3 bits (65), Expect = 0.42 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = +1 Query: 553 PRPSGLXPXXPAPX---PXXPXPAXAXPPXPKXP--XPXXPPP 666 P PSG P P P P P P+ PP PK P PPP Sbjct: 1153 PAPSGAPPV-PKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPP 1194 Score = 30.3 bits (65), Expect = 0.42 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +1 Query: 553 PRPSGLXPXXPAP--XPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P+P+ P P P P P P+ PP P P P P G P Sbjct: 1182 PKPAAGVPPVPPPSEAPPVPKPSVGVPPVP-PPSTAPPVPTPSAGLP 1227 Score = 29.9 bits (64), Expect = 0.56 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXN-PPXPXPXXPPPXPPP 951 P P PP P P + PP P P PP P P Sbjct: 1013 PVPKLSSKAPPVPLPSADAPPIPVPSTAPPVPIP 1046 Score = 29.9 bits (64), Expect = 0.56 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXN-PPXPXP-XXPPPXPPP 951 V P PP PP P P PP P P PP P P Sbjct: 1205 VGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAP 1242 Score = 29.5 bits (63), Expect = 0.74 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXP 925 PP P PP P P PP P P Sbjct: 1102 PPVPKPSVAVPPVPAPSGAPPVPKP 1126 Score = 29.5 bits (63), Expect = 0.74 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXP 925 PP P PP P P PP P P Sbjct: 1140 PPVPKPSVAAPPVPAPSGAPPVPKP 1164 Score = 29.1 bits (62), Expect = 0.98 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXP-XXPPPXPPP 951 P P PP P P PP P P PP P P Sbjct: 1074 PSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKP 1107 Score = 29.1 bits (62), Expect = 0.98 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = +1 Query: 844 VPXPXPXPPIXXPP--PPXPXXN---PPXPXPXXP-PPXPPP 951 +P P PP+ P PP P + PP P P PP P P Sbjct: 1076 IPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAP 1117 Score = 29.1 bits (62), Expect = 0.98 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXP 925 PP P PP P P PP P P Sbjct: 1121 PPVPKPSVAAPPVPVPSGAPPVPKP 1145 Score = 28.7 bits (61), Expect = 1.3 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXP-AXAXPPXPKXP--XPXXPPP 666 P PS P P P P P + PP PK P PPP Sbjct: 1025 PLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPP 1065 Score = 27.9 bits (59), Expect = 2.3 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 614 PXQXPPXPXPXXPXRPPPXPXGAPP 688 P + PP P P P P P APP Sbjct: 1194 PSEAPPVPKPSVGVPPVPPPSTAPP 1218 Score = 27.5 bits (58), Expect = 3.0 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 596 PXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P L + PP P P P P P APP Sbjct: 1012 PPVPKLSSKAPPVPLPSADAPPIPVPSTAPP 1042 Score = 27.5 bits (58), Expect = 3.0 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +1 Query: 553 PRPSGLXPXXPAPX--PXXPXPAXAXPPXPKXPXPXXPP 663 P+PS P P P P P P+ PP P P PP Sbjct: 1201 PKPSVGVPPVPPPSTAPPVPTPSAGLPPVP-VPTAKAPP 1238 Score = 27.1 bits (57), Expect = 3.9 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 10/46 (21%) Frame = +1 Query: 844 VPXPXPXPPI-------XXPPPPXPXXN---PPXPXPXXPPPXPPP 951 VP P PP+ PPP P + P P P PP P P Sbjct: 1043 VPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAP 1088 Score = 25.8 bits (54), Expect = 9.1 Identities = 12/37 (32%), Positives = 12/37 (32%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP S P PPP P P P P P Sbjct: 1050 PPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVP 1086 Score = 25.8 bits (54), Expect = 9.1 Identities = 13/34 (38%), Positives = 13/34 (38%), Gaps = 1/34 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXP-PPXPPP 951 P P P P P PP P P PP P P Sbjct: 1151 PVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKP 1184 Score = 25.8 bits (54), Expect = 9.1 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 7/44 (15%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPP-----PXTPPXPXP--XXPXXXPPPXXP 961 PP P S PP P P P PP P P PP P Sbjct: 1169 PPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPP 1212 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 36.7 bits (81), Expect = 0.005 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP+ PPPP P P PPP P P Sbjct: 1705 PTPPP-PPMSVPPPPSAPPMPAGPPSAPPPPLPASSAP 1741 Score = 34.7 bits (76), Expect = 0.020 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPX--PPPPXTPPXPXPXXPXXXPPPXXP 961 P P P PP PPPP PP P P PPP P Sbjct: 1700 PQMSAPTPPPPPMSVPPPPSAPPMPA--GPPSAPPPPLP 1736 Score = 32.7 bits (71), Expect = 0.079 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P +PP P PPPP P PP P Sbjct: 1691 PVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMP 1724 Score = 30.7 bits (66), Expect = 0.32 Identities = 13/43 (30%), Positives = 15/43 (34%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P + P P P P + PP P P PPP P Sbjct: 1699 PPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAP 1741 Score = 30.7 bits (66), Expect = 0.32 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PP P P P PP P P P P Sbjct: 1711 PMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVP 1744 Score = 28.7 bits (61), Expect = 1.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 V P P PP PP P PPP PP Sbjct: 1687 VSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPP 1722 Score = 27.9 bits (59), Expect = 2.3 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PP P PPP P P Sbjct: 1691 PVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMP 1724 Score = 27.5 bits (58), Expect = 3.0 Identities = 13/34 (38%), Positives = 13/34 (38%), Gaps = 1/34 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPP-XPXPXXPXXXPP 949 PP P P PP P PP P P P P Sbjct: 1708 PPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAP 1741 Score = 27.1 bits (57), Expect = 3.9 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 556 RP-SGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPP 663 RP S P AP P P P PP P P PP Sbjct: 1693 RPQSAAPPQMSAPTPPPP-PMSVPPPPSAPPMPAGPP 1728 Score = 26.6 bits (56), Expect = 5.2 Identities = 11/36 (30%), Positives = 13/36 (36%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP+ P + P P P PPP P Sbjct: 1686 PVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAP 1721 Score = 26.6 bits (56), Expect = 5.2 Identities = 12/38 (31%), Positives = 14/38 (36%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P + P AP P+ PP P P P P Sbjct: 1709 PPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 25.8 bits (54), Expect = 9.1 Identities = 15/47 (31%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = +1 Query: 565 GLXPXXPAPXPXXPXPAXAXP----PXPKXPXPXXPPPXSXGGXPLG 693 G+ P P P + A P P P P PPP S P G Sbjct: 1680 GMAPAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAG 1726 Score = 25.8 bits (54), Expect = 9.1 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPP-PXP 945 VP P PP+ PP P PP P P P P Sbjct: 1714 VPPPPSAPPMPAGPPSAPP--PPLPASSAPSVPNP 1746 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 35.9 bits (79), Expect = 0.009 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GG G G GG G GG G GG G G Sbjct: 26 GGFGGGRGGA-RGGGRGGARGGRGGRGGARGGRGGSSG 62 Score = 32.3 bits (70), Expect = 0.10 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G G G G G GG GGG G G G G GG+ Sbjct: 17 GRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGS 60 Score = 31.1 bits (67), Expect = 0.24 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGG-GGXGG-XGDXGXXXGGXXXG-GGA 829 GG G G G GG GG GG GG G G GG GGA Sbjct: 29 GGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGGA 71 Score = 31.1 bits (67), Expect = 0.24 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -1 Query: 959 GXXGGGXGGGXXG-XGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GG G G GG G GG GG G Sbjct: 34 GARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 Score = 29.9 bits (64), Expect = 0.56 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = -3 Query: 960 GXXGG-GXXXGXXGXGXGGVXGG--GGXGGXGDXGXXXGGXXXG-GGA 829 G GG G G G GG GG GG GG G GG G GGA Sbjct: 20 GFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGA 67 Score = 29.1 bits (62), Expect = 0.98 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -1 Query: 959 GXXGGGXGG-GXXGXGXGGLXXGXGGG-GXXXGGXGXGXG 846 G GG GG G G GG G GG G GG G G Sbjct: 9 GGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRG 48 Score = 28.3 bits (60), Expect = 1.7 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXG-GGGXGGXGDXGXXXGGXXXG 838 G GG G G GG G GG GG G GG G Sbjct: 29 GGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 35.1 bits (77), Expect = 0.015 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXP--XPXXPXXXPPPXXP 961 PP P P P P P PP P P P PPP P Sbjct: 139 PPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQP 177 Score = 33.1 bits (72), Expect = 0.060 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PPI PP P PP P P PP Sbjct: 152 PSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPP 185 Score = 31.1 bits (67), Expect = 0.24 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P PP PP P PP P PP P Sbjct: 145 PRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQP 177 Score = 29.5 bits (63), Expect = 0.74 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 626 PPXPXPXXPXRPPPXPXGAPP 688 PP P P PPP P APP Sbjct: 139 PPTSAPPRPSIPPPSPASAPP 159 Score = 29.5 bits (63), Expect = 0.74 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P +P P P P P P PPP Sbjct: 172 PPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPP 205 Score = 29.1 bits (62), Expect = 0.98 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXPP 949 P +P PP P PP P P PP Sbjct: 125 PSAPAPPTPQSELRPPTSAPPRPSIPPP 152 Score = 27.9 bits (59), Expect = 2.3 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +2 Query: 590 PTPXAXTLPX-QXPPXPX--PXXPXRPPPXPXGAPP 688 PTP + P PP P P P PP P APP Sbjct: 131 PTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPP 166 Score = 27.1 bits (57), Expect = 3.9 Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 590 PTPX-AXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P+P A +P + PP P P P P +PP Sbjct: 152 PSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPP 185 Score = 26.6 bits (56), Expect = 5.2 Identities = 12/37 (32%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +1 Query: 583 PAPXPXXPXP-AXAXPPXPKXPXPXXPPPXSXGGXPL 690 P P P P + PP P P PPP P+ Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPI 160 Score = 26.2 bits (55), Expect = 6.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 884 PXPPPPXTPPXPXPXXPXXXPP 949 P PPPP PP P P PP Sbjct: 3 PAPPPP--PPAPAPAAAAPAPP 22 Score = 26.2 bits (55), Expect = 6.9 Identities = 11/36 (30%), Positives = 13/36 (36%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P + P P + P P P PP P P Sbjct: 131 PTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPP 166 Score = 25.8 bits (54), Expect = 9.1 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +2 Query: 872 SPXPPXPPPPXTPPXPXPXXP 934 +P PP PPP P P P Sbjct: 2 APAPPPPPPAPAPAAAAPAPP 22 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 34.7 bits (76), Expect = 0.020 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = +3 Query: 882 PPXXPXPQPPPP--XPPXXPXXXPPPXPP 962 PP P P PPPP PP P PPP PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQP---PPPPPP 30 Score = 32.7 bits (71), Expect = 0.079 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P PP PPPP P PP P PPP Sbjct: 5 PPGNPP---PPPPPPGFEPPSQPPPPPPP 30 Score = 32.3 bits (70), Expect = 0.10 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 868 PIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PPPP P P P PPP PPP Sbjct: 5 PPGNPPPPPPP--PGFEPPSQPPPPPPP 30 Score = 31.5 bits (68), Expect = 0.18 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXP 925 PP P P PP PP PP P P Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPP 29 Score = 29.5 bits (63), Expect = 0.74 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 608 TLPXQXPPXPXPXXPXRPPPXPXGAPPXG 694 +LP PP P P PP P PP G Sbjct: 3 SLPPGNPPPPPPPPGFEPPSQPPPPPPPG 31 Score = 27.1 bits (57), Expect = 3.9 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPP 913 PP P PP PPP PP Sbjct: 10 PPPPPPPGFEPPSQPPPPPPP 30 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 31.1 bits (67), Expect = 0.24 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PPI PP P PP P P PPP P Sbjct: 224 PTSTSAPPI---PPSIPSSRPPERVPSLSAPAPPPIPP 258 Score = 30.3 bits (65), Expect = 0.42 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 881 PPXPPPPXTPPXPXPXXPXXXPP 949 PP P PP PP P P PP Sbjct: 415 PPVPTPPSLPPSAPPSLPPSAPP 437 Score = 29.9 bits (64), Expect = 0.56 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXP--PPXPP 962 P P S P P PP PP P P PP PP Sbjct: 415 PPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPP 451 Score = 29.5 bits (63), Expect = 0.74 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 593 TPXAXTLPXQXPPXPXPXXPXRPPPXPXGAP 685 TP T P P P P PP P GAP Sbjct: 414 TPPVPTPPSLPPSAPPSLPPSAPPSLPMGAP 444 Score = 29.5 bits (63), Expect = 0.74 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PP P P P P PPP Sbjct: 444 PAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPP 478 Score = 29.1 bits (62), Expect = 0.98 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXP 959 +PP P PP PP P PP P Sbjct: 414 TPPVPTPPSLPPSAPPSLPPSAPPSLP 440 Score = 28.3 bits (60), Expect = 1.7 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 5/29 (17%) Frame = +1 Query: 880 PPPPXPXXNPPXPXPXXP-----PPXPPP 951 PPPP P N P P PP PPP Sbjct: 338 PPPPPPRSNAAGSIPLPPQGRSAPPPPPP 366 Score = 28.3 bits (60), Expect = 1.7 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXPP--PPXTPPXPXPXXPXXXP-PPXXP 961 PP P S P PP PP PP P P PP P Sbjct: 415 PPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAP 454 Score = 27.1 bits (57), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Frame = +1 Query: 853 PXPXPPIXXP--PPPXPXXNPPXPXPXXP--PPXPP 948 P P PP P PP P PP P PP PP Sbjct: 416 PVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPP 451 Score = 27.1 bits (57), Expect = 3.9 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPX--PXXPP-PXPPPXXP 960 P P P PI P P PP P P PP P P P P Sbjct: 448 PLP-PSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPAPAAP 487 Score = 26.6 bits (56), Expect = 5.2 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 ++PP PP PP P P P P Sbjct: 455 IAPPLPAGMPAAPPLPPAAPAPPPAPAP 482 Score = 26.6 bits (56), Expect = 5.2 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXP 918 +P P PP PPP P P P Sbjct: 463 MPAAPPLPPAAPAPPPAPAPAPAAP 487 Score = 26.2 bits (55), Expect = 6.9 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXP 645 P P+G+ P P P P P A P P P Sbjct: 458 PLPAGMPAAPPLP-PAAPAPPPAPAPAPAAP 487 Score = 25.8 bits (54), Expect = 9.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPP 936 P P P P PP P + P P P PP Sbjct: 231 PIP-PSIPSSRPPERVPSLSAPAPPPIPPP 259 Score = 25.8 bits (54), Expect = 9.1 Identities = 14/42 (33%), Positives = 14/42 (33%), Gaps = 4/42 (9%) Frame = +1 Query: 847 PXPXPXPPIXXPPPP----XPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPP NPP P P P P P Sbjct: 364 PPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPP 405 >SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex protein Gar1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 194 Score = 30.3 bits (65), Expect = 0.42 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXR 875 GG GGG G GG GG G G GG R Sbjct: 160 GGFGGGSRGGFGGGSRGGSRG-GFRGGSR 187 Score = 28.7 bits (61), Expect = 1.3 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGG--GGXGGXGDXGXXXGGXXXG 838 GG G G GG GG GG GG G G GG G Sbjct: 148 GGSRGGFGGNSRGGFGGGSRGGFGG-GSRGGSRGGFRGG 185 Score = 27.9 bits (59), Expect = 2.3 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGG--GXXXGGXGXG 852 G GG GG G GG G GGG G GG G Sbjct: 148 GGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGG 185 Score = 27.5 bits (58), Expect = 3.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGG 882 G GG GGG G GG G GG Sbjct: 164 GGSRGGFGGGSRGGSRGGFRGGSRGG 189 Score = 26.6 bits (56), Expect = 5.2 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GG GG G G G G GGG GG G G Sbjct: 141 GGFRGGRGGSRGGFG-GNSRGGFGGGS--RGGFGGG 173 Score = 26.6 bits (56), Expect = 5.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXG 899 GG GGG G GG GG G Sbjct: 168 GGFGGGSRGGSRGGFRGGSRG 188 Score = 25.8 bits (54), Expect = 9.1 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXG 838 G GG G G GG GGG G G G GG G Sbjct: 152 GGFGGNSRGGFGGGSRGG-FGGGSRG--GSRGGFRGGSRGG 189 >SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 331 Score = 28.7 bits (61), Expect = 1.3 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P+ P P P P P P P PP Sbjct: 108 PLPNEPVPEEPLPGEPPLPDEPVPEEPLPGEPP 140 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 28.7 bits (61), Expect = 1.3 Identities = 12/27 (44%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +3 Query: 858 PXXPXXLSPPXX-PXPQPPPPXPPXXP 935 P P +P P P PPPP PP P Sbjct: 221 PEIPPTYTPKQADPLPAPPPPPPPTLP 247 Score = 27.9 bits (59), Expect = 2.3 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 875 PXPPXPPPPXTPP 913 P PP PPPP PP Sbjct: 236 PAPPPPPPPTLPP 248 Score = 27.1 bits (57), Expect = 3.9 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP PP P PPP PPP Sbjct: 161 PNSMVSPPPSFQPPSAAAPATSLPSDYNPPPPPPP 195 Score = 27.1 bits (57), Expect = 3.9 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P + P PPP PPP Sbjct: 167 PPPSFQPPSAAAPATSLPSDYNPPPPPPPPP 197 Score = 26.2 bits (55), Expect = 6.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 880 PPPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP P P P P PPP PP P Sbjct: 224 PPTYTPKQADPLPAP--PPPPPPTLPP 248 Score = 26.2 bits (55), Expect = 6.9 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P+ PPPP P PP P P Sbjct: 229 PKQADPLPAPPPPPPPTLPPQSTNTSQLPMP 259 Score = 25.8 bits (54), Expect = 9.1 Identities = 11/31 (35%), Positives = 11/31 (35%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P P P PPP PP P P Sbjct: 229 PKQADPLPAPPPPPPPTLPPQSTNTSQLPMP 259 >SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1841 Score = 23.0 bits (47), Expect(2) = 3.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 900 PQPPPPXPP 926 P PPPP PP Sbjct: 945 PPPPPPPPP 953 Score = 22.2 bits (45), Expect(2) = 3.6 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 885 PXXPXPQPPPP 917 P P P PPPP Sbjct: 942 PAFPPPPPPPP 952 >SPAC26A3.09c |rga2||GTPase activating protein Rga2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1275 Score = 27.1 bits (57), Expect = 3.9 Identities = 11/30 (36%), Positives = 12/30 (40%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PPPP + P P P PP Sbjct: 412 PARPTESPPPPPISSSSTTPRPDDKPSLPP 441 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 27.1 bits (57), Expect = 3.9 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 562 SGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 S L P P PA A PP PK PP S P Sbjct: 905 STLPPPPPTASMTASAPAIASPPPPKVGETYHPPTASGTRVP 946 >SPCC645.07 |rgf1||RhoGEF for Rho1, Rgf1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1334 Score = 26.2 bits (55), Expect = 6.9 Identities = 11/32 (34%), Positives = 12/32 (37%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P P P P + P PP PP Sbjct: 49 PLPPPTRRLPRKPLPFRSTSLQPPSSQPPAPP 80 >SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccharomyces pombe|chr 2|||Manual Length = 884 Score = 26.2 bits (55), Expect = 6.9 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP P P PP P P PP Sbjct: 725 PQVTPAPPTPAPTPAVKHHPPPPPVRSSISPSMPP 759 Score = 25.8 bits (54), Expect = 9.1 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 SP P P PP P P P PP Sbjct: 720 SPAIKPQVTPAPPTPAPTPAVKHHPPPP 747 >SPAC20G4.02c |fus1||formin Fus1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1372 Score = 25.8 bits (54), Expect = 9.1 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXP 919 P PP P PP PP P Sbjct: 802 PFKAPPPAPLPPPAPPLP 819 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,725,147 Number of Sequences: 5004 Number of extensions: 27629 Number of successful extensions: 1006 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 537 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 493304942 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -