BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_B05 (962 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 55 7e-08 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 50 4e-06 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 49 6e-06 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 48 1e-05 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 48 1e-05 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 47 3e-05 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 45 8e-05 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 45 8e-05 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 44 2e-04 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 44 2e-04 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 42 6e-04 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 42 6e-04 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 42 7e-04 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 40 0.002 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 40 0.002 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 39 0.005 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 39 0.007 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 39 0.007 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 38 0.009 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 38 0.009 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 38 0.009 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 38 0.009 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 38 0.009 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 38 0.012 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 38 0.016 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 38 0.016 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 37 0.021 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 37 0.028 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 37 0.028 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 37 0.028 SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.028 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 37 0.028 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.028 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 36 0.037 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 36 0.037 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 36 0.037 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 36 0.037 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 36 0.037 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 36 0.049 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 36 0.065 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.065 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 36 0.065 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 36 0.065 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 35 0.086 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.086 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.086 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 35 0.11 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 35 0.11 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 35 0.11 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 35 0.11 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 35 0.11 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 34 0.15 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 34 0.15 SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 34 0.15 SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 34 0.20 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 34 0.20 SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 33 0.26 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 33 0.26 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 33 0.35 SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) 33 0.35 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 33 0.35 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 33 0.35 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 33 0.35 SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) 33 0.35 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 33 0.35 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 33 0.46 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 32 0.60 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.60 SB_27284| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.60 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 32 0.60 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 32 0.60 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.60 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 32 0.60 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 32 0.60 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 32 0.60 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.60 SB_55729| Best HMM Match : YajC (HMM E-Value=0.56) 32 0.80 SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.80 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.80 SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) 32 0.80 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 32 0.80 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.80 SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) 32 0.80 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.80 SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) 32 0.80 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 31 1.1 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 31 1.1 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 31 1.1 SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 31 1.1 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 31 1.1 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_38491| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 31 1.4 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 31 1.4 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 31 1.4 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 31 1.4 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) 31 1.8 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 31 1.8 SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0) 31 1.8 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 30 2.4 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 30 2.4 SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) 30 2.4 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) 30 2.4 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 30 3.2 SB_51094| Best HMM Match : VWA (HMM E-Value=0) 30 3.2 SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) 30 3.2 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 30 3.2 SB_42044| Best HMM Match : ubiquitin (HMM E-Value=1.2e-06) 30 3.2 SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_5925| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) 29 4.2 SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) 29 4.2 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 4.2 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) 29 4.2 SB_1944| Best HMM Match : DUF1482 (HMM E-Value=7.3) 29 4.2 SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_23371| Best HMM Match : SRCR (HMM E-Value=0) 29 4.2 SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) 29 4.2 SB_51163| Best HMM Match : Adeno_PIX (HMM E-Value=0.96) 29 5.6 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_41099| Best HMM Match : VWA (HMM E-Value=0) 29 5.6 SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 29 5.6 SB_40783| Best HMM Match : MH2 (HMM E-Value=0) 29 5.6 SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) 29 5.6 SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) 29 7.4 SB_45113| Best HMM Match : CemA (HMM E-Value=6) 29 7.4 SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) 29 7.4 SB_32416| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0021) 29 7.4 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 29 7.4 SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) 29 7.4 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 29 7.4 SB_11987| Best HMM Match : OTU (HMM E-Value=1.1e-24) 29 7.4 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 29 7.4 SB_1528| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 29 7.4 SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) 28 9.8 SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) 28 9.8 SB_37033| Best HMM Match : Annexin (HMM E-Value=0) 28 9.8 SB_34601| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_31904| Best HMM Match : Extensin_2 (HMM E-Value=0.5) 28 9.8 SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) 28 9.8 SB_22851| Best HMM Match : Sad1_UNC (HMM E-Value=0) 28 9.8 SB_20016| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) 28 9.8 SB_32762| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 28 9.8 SB_25705| Best HMM Match : PH (HMM E-Value=2e-17) 28 9.8 SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) 28 9.8 SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_3180| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) 28 9.8 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 55.2 bits (127), Expect = 7e-08 Identities = 21/38 (55%), Positives = 21/38 (55%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PPPP P PP P P PPP PPP P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 55.2 bits (127), Expect = 7e-08 Identities = 21/38 (55%), Positives = 21/38 (55%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PPPP P PP P P PPP PPP P Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 55.2 bits (127), Expect = 7e-08 Identities = 21/38 (55%), Positives = 21/38 (55%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PPPP P PP P P PPP PPP P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 53.6 bits (123), Expect = 2e-07 Identities = 20/38 (52%), Positives = 21/38 (55%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PPPP P +PP P PPP PPP P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 52.4 bits (120), Expect = 5e-07 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PPP P PP P P PPP PPP P Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 52.0 bits (119), Expect = 7e-07 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PPPP P P P P PPP PPP P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 52.0 bits (119), Expect = 7e-07 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PPPP PP P P PPP PPP P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 52.0 bits (119), Expect = 7e-07 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP P PP P PP P P PPP PPP P Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 52.0 bits (119), Expect = 7e-07 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PPPP PP P P PPP PPP P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 52.0 bits (119), Expect = 7e-07 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PPP P PP P P PPP PPP P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 52.0 bits (119), Expect = 7e-07 Identities = 21/38 (55%), Positives = 21/38 (55%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PPPP P PP P P PPP PPP P Sbjct: 385 PPPSPPPP-PQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 52.0 bits (119), Expect = 7e-07 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PPPP P PP P P PP PPP P Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 52.0 bits (119), Expect = 7e-07 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PPPP P PP P P PP PPP P Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 51.6 bits (118), Expect = 9e-07 Identities = 21/39 (53%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPP-PXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PPP P P PP P P PPP PPP P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 50.4 bits (115), Expect = 2e-06 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PP PPPP PP P P P PPP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPP 401 Score = 50.4 bits (115), Expect = 2e-06 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PP PPPP PP P P P PPP P Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 48.8 bits (111), Expect = 6e-06 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PPP P PP P P PP PPP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 48.8 bits (111), Expect = 6e-06 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PPPP P PP P P PPP P P P Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 48.8 bits (111), Expect = 6e-06 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P PPPP P PP P P PPP PP P Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 44.0 bits (99), Expect = 2e-04 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 +SPP P P PPPP PP P PP PP Sbjct: 363 MSPPPPPPPPPPPPSPPPPPPPPPPSPPP 391 Score = 41.9 bits (94), Expect = 7e-04 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 871 IXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 I PPP P PP P P PPP PPP P Sbjct: 361 INMSPPPPPPPPPPPPSPPPPPPPPPPSPP 390 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/32 (53%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +2 Query: 872 SPXPPX--PPPPXTPPXPXPXXPXXXPPPXXP 961 SP PP PPPP +PP P P P PPP P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQP 395 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P+P P P P + PP P+ P P PPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P PS P P P P P P PP P P P PPP Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P+P P P P P P P PP P P P PPP Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P P+ PP P P P PPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P P PP P P P PPP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P P PP P P P PPP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P P PP P P P PPP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P P PP P P P PPP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P P PP P P P PPP Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P P PPPP PP P P PP Sbjct: 408 PPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P PS P P P P P PP P P P PPP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 37.5 bits (83), Expect = 0.016 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P + P Q PP P P P PPP P PP Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P PP P P P PPP P APP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 36.3 bits (80), Expect = 0.037 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P P A PP P P P PPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPPPP--PPPPPPPP 432 Score = 35.9 bits (79), Expect = 0.049 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P PP P P P PPP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 35.9 bits (79), Expect = 0.049 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P P P P P P PP P P P PPP P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 35.9 bits (79), Expect = 0.049 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P P P P P P PP P P P PPP + P Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 35.9 bits (79), Expect = 0.049 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P P PP P P PPP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 35.9 bits (79), Expect = 0.049 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPP 663 P P P P P P P P PP P P P PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 35.5 bits (78), Expect = 0.065 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 583 PAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P + PP P P P PPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPP 392 Score = 35.5 bits (78), Expect = 0.065 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P PP P P P PPP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 35.5 bits (78), Expect = 0.065 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P PP P P P +PPP P PP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P PP P P P PPP P PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPP 398 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P PP P P P PPP P PP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P PP P P P PPP P PP Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P PP P P P PPP P PP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P PP P P P PPP P PP Sbjct: 400 PPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P PP P PPPP PP P PP Sbjct: 407 PPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +1 Query: 568 LXPXXPAPXPXXP--XPAXAXPPXPKXPXPXXPPP 666 + P P P P P P PP P P P PPP Sbjct: 363 MSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPP 397 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P + P PP P P PPP P PP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P+P P P P P P PPP P PP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P PP P P P PPP PP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPP 399 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P PP P P P P P P PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPP 402 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 587 RPTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 +P P P PP P P P P P P PP Sbjct: 394 QPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P PP P P PPP P PP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPP 400 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P PP P P PPP P PP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P PP P P P PP P PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P PP P P PPP P PP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGA 682 P P P PP P P P PPP P A Sbjct: 403 PPPPPPPPPPPPPPPPAPPPPPPPPPPPPPA 433 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 49.6 bits (113), Expect = 4e-06 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GGG G G G GG GGGG GG G G GG GGGA Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGA 702 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GGG G G G GG GGGG GG G G GG GGA Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGA 705 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GGG G G G GG GGGG GG G G GG G GA Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGA 707 Score = 46.8 bits (106), Expect = 3e-05 Identities = 21/38 (55%), Positives = 21/38 (55%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G GG G GGGG GG G G G Sbjct: 673 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 45.6 bits (103), Expect = 6e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GGGG GG G G GG G G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 45.2 bits (102), Expect = 8e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G G GG GGGG GG G G GG GGG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GGG G G G GG GGGG GG G G G G GA Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGA 709 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GGGG GG G G G G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G GGG G G G GG GGGG GG G G G G Sbjct: 675 GGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GGGG GG G G G Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G GG G G G G G G + G G Sbjct: 673 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G GG G G G G G G G G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G GG G G G G G G G G Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -1 Query: 671 EXGGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 + GGG G G G GG G G G G G G G G Sbjct: 661 DGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G GG G G G G G G G G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G GG G G G G G G G G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 31.9 bits (69), Expect = 0.80 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G GG G G GAG +G G Sbjct: 679 GGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 687 GGAPXGXGGGRXGXXGLGXGGXCXGRVXAXGVG 589 GG G GGG G G G GG G A G G Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 687 GGAPXGXGGGRXGXXGLGXGGXCXGRVXAXGVG 589 GG G GGG G G G GG G G G Sbjct: 676 GGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGX-GGXGD 871 G GGG G G G GG G G G GD Sbjct: 687 GGGGGGGGGGGGGGGAGGAGAGAGDDDGDGD 717 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 48.8 bits (111), Expect = 6e-06 Identities = 21/39 (53%), Positives = 22/39 (56%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 G GGG GGG G G GG G GGGG GG G G G+ Sbjct: 91 GGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGS 129 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G G GG GGGG GG G G GG GGG Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGG 124 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G GG G GGGG GG G G G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGG 118 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G GGG G G G GG GGGG GG G G GG GG Sbjct: 86 GFGGGGGFGGGGGGGFGG-GGGGGFGGGGGGGGGFGGGGGGG 126 Score = 37.1 bits (82), Expect = 0.021 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG GGG GG G GG GGG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGG 123 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GGG G GG GGG G G G G G Sbjct: 94 GGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEG 558 GGG G G G GG G G G G G G G Sbjct: 90 GGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXG 573 GGG G G G GG G G G G G G Sbjct: 98 GGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G GG G G G G G G G G Sbjct: 89 GGGGFGGG--GGGGFGGGGGGGFGGGGGGGGGFGGGGG 124 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 47.6 bits (108), Expect = 1e-05 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P P PP PPPP P PP P P PPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 47.6 bits (108), Expect = 1e-05 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PPPP P PP P P PPP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 46.4 bits (105), Expect = 3e-05 Identities = 19/34 (55%), Positives = 19/34 (55%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PPPP P PP P P PPP PPP P Sbjct: 464 PPPP---PPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 46.0 bits (104), Expect = 5e-05 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P PP PPPP PP P P P PPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 45.2 bits (102), Expect = 8e-05 Identities = 16/28 (57%), Positives = 17/28 (60%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 +PP P P PPPP PP P PPP PP Sbjct: 463 APPPPPPPPPPPPPPPPPPPPPPPPFPP 490 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 565 GLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 G P P P P P P PP P P P PPP Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 565 GLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 G+ P P P P P PP P P P PPP Sbjct: 459 GVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 903 QPPPPXPPXXPXXXPPPXPP 962 Q PPP PP P PPP PP Sbjct: 462 QAPPPPPPPPPPPPPPPPPP 481 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P PP P P P P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 620 QXPPXPXPXXPXRPPPXPXGAPP 688 Q PP P P P PPP P PP Sbjct: 462 QAPPPPPPPPPPPPPPPPPPPPP 484 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 614 PXQXPPXPXPXXPXRPPPXPXGAPP 688 P PP P P P PPP P PP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 614 PXQXPPXPXPXXPXRPPPXPXGAPP 688 P PP P P P PPP P PP Sbjct: 470 PPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 614 PXQXPPXPXPXXPXRPPPXPXGAPP 688 P PP P P P PPP P PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPP 490 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 614 PXQXPPXPXPXXPXRPPPXPXGAPP 688 P PP P P P PPP P PP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 586 APXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPL 690 AP P P P PP P P P P P PL Sbjct: 463 APPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTPL 497 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXP 645 P P P P P P P P PP P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/38 (55%), Positives = 21/38 (55%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PPPP P PP P P PPP PPP P Sbjct: 205 PPPPPRPP-PSPPPPPP---PPSPSPPRPPPPPPPSPP 238 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P SP PP PPP +PP P P P P P Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 42.7 bits (96), Expect = 4e-04 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P SP PP PPPP P P P PP P Sbjct: 216 PPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPP-PXPPXXPXXXPPPXPP 962 P P ++ P P P+PPP P PP P PP PP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPP 230 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P I PPPP P PP P P PPP P P P Sbjct: 195 PTSPSQITQPPPPPPRP-PPSPPPPPPPPSPSPPRP 229 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 7/42 (16%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNP-------PXPXPXXPPPXPPP 951 P P P PP PPPP P P P P PP PPP Sbjct: 220 PPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 + P P PP P PP P PP P P P P PPP P Sbjct: 201 ITQPPPPPPRPPPSPPPP---PPPPSPSPPRP-PPPPPP 235 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P PP PPP PP P P P PP P Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPP 233 Score = 37.1 bits (82), Expect = 0.021 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXP--PPPXPXXNPPXPXP---XXPPPXP--PPXXP 960 P P P PP P PPP P +PP P PPP P PP P Sbjct: 215 PPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLP 259 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 583 PAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P P P P+ PP P P P PPP P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 35.5 bits (78), Expect = 0.065 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXP----PPXPPP 951 P P P PP P PP P PP P P P P PPP Sbjct: 213 PSPPPPPPPPSPSPPRPPP-PPPPSPPRPLAAKLPEPPP 250 Score = 35.1 bits (77), Expect = 0.086 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXS 672 P P P P P PP P P P PPP S Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPS 236 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXP 660 P P P P P P P P+ PP P P P P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 S P P PP PP P PPP PP Sbjct: 193 SHPTSPSQITQPPPPPPRPPPSPPPPPP 220 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +2 Query: 593 TPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 +P T P PP P P P PPP P +PP Sbjct: 197 SPSQITQPPPPPPRPPPSPPP-PPPPPSPSPP 227 Score = 28.3 bits (60), Expect = 9.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXA-----XPPXPKXPXPXXPPP 666 P PS P P P P P A PP P P P PPP Sbjct: 220 PPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMP-PTLPPP 261 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 47.2 bits (107), Expect = 2e-05 Identities = 29/112 (25%), Positives = 29/112 (25%) Frame = +2 Query: 626 PPXPXPXXPXRPPPXPXGAPPXGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 805 PP P P P PPP P PP Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPP 151 Query: 806 XXXXXXXXXXXXXXXPPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP PPPP PP P P P PPP P Sbjct: 152 PNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPP-NPPYPPPPNPPYPPPPNAP 202 Score = 46.8 bits (106), Expect = 3e-05 Identities = 35/134 (26%), Positives = 37/134 (27%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPLGXXXXXXXXXXXXXXX 738 P+ P P P P P P PP P P P PPP + P Sbjct: 85 PTNFSPNPPYPPPPYP-PYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPS 143 Query: 739 XXXXXXXXXXXXX*XXXXXXXXXXXXXXXXXXXXXVPXPXPXPPIXXPPPPXPXXNPPXP 918 P P P PP PPPP P PP Sbjct: 144 PNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPP-PNPP--YPPPPNPPYPPPPN 200 Query: 919 XPXXPPPXPPPXXP 960 P PPP PP P Sbjct: 201 APNPPPPNPPYPPP 214 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PP PPPP PP P P PPP P Sbjct: 175 PPPPYPPPPNPPYPPPP-NPPYPPPPNAPNPPPPNPP 210 Score = 41.9 bits (94), Expect = 7e-04 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXPP--PPXTPPXPXPXXPXXXPPPXXP 961 PP P P PP PP PP P P P P PPP P Sbjct: 180 PPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAP 218 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P P PP PPPP PP P P P PPP P Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYP---PPPNAP 123 Score = 41.5 bits (93), Expect = 0.001 Identities = 35/136 (25%), Positives = 35/136 (25%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPLGXXXXXXXXXXXXX 732 P P P P P P P P PP P P P PPP P Sbjct: 93 PYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYP--PPPNPPYPPPPNAPYPPSPNAPYPP 150 Query: 733 XXXXXXXXXXXXXXX*XXXXXXXXXXXXXXXXXXXXXVPXPXPXPPIXXPPPPXPXXNPP 912 P P P P PPP P NPP Sbjct: 151 PPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYP---PPPNAP--NPP 205 Query: 913 XPXPXXPPPXPPPXXP 960 P P PPP P P Sbjct: 206 PPNPPYPPPPNAPNPP 221 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P P PP PPPP P P P P PP P Sbjct: 199 PNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPP 235 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPP--PXPPPXXP 960 P P PP PPP NPP P P P P PPP P Sbjct: 202 PNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P PP P PPPP PP P PPP P Sbjct: 133 PPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNP 167 Score = 39.1 bits (87), Expect = 0.005 Identities = 30/127 (23%), Positives = 30/127 (23%), Gaps = 3/127 (2%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPPXGXXXXXXXXXXXXXXXXXXXXXXXXX 769 P P P P P P P PPP P PP Sbjct: 103 PPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYP 162 Query: 770 XXXXXXXXXXXXXXXXXXXXXXXXXXXPP-XXXPXSPXPPXPPPPXT--PPXPXPXXPXX 940 PP P P P PPPP PP P P Sbjct: 163 PPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPY 222 Query: 941 XPPPXXP 961 PPP P Sbjct: 223 PPPPNAP 229 Score = 38.7 bits (86), Expect = 0.007 Identities = 30/115 (26%), Positives = 32/115 (27%) Frame = +1 Query: 343 PXPPCXXXXPPVPXXXXXVLPAXXNRPNXPRQXXXXXXXLFRFPPXXXXXXXXXXXXXXX 522 P PP PP P P N P P L+ PP Sbjct: 123 PYPP--PPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYP 180 Query: 523 XXXXXXXXXXPRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P P AP P P P PP P P P PPP + P Sbjct: 181 PPPNPPYPPPPNPP-YPPPPNAPNPPPPNPPY--PPPPNAPNPPYPPPPNAPNPP 232 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PPP PP P PP PPP P Sbjct: 194 PYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAP 229 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 872 SPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 SP PP PPPP P P P P PP P Sbjct: 89 SPNPPYPPPPYPPYPPPPPYPPPPNPPYPP 118 Score = 37.5 bits (83), Expect = 0.016 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P PP P P PP P P PPP Sbjct: 204 PPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 36.7 bits (81), Expect = 0.028 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 PP P PP P PP P PPP PP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPP 110 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 46.8 bits (106), Expect = 3e-05 Identities = 21/38 (55%), Positives = 21/38 (55%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G GG G GGGG GG G G G Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDG 102 Score = 46.8 bits (106), Expect = 3e-05 Identities = 21/38 (55%), Positives = 21/38 (55%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G GG G GGGG GG G G G Sbjct: 74 GGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 45.2 bits (102), Expect = 8e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG G G GG GD G GG GGG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGG 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G G G GG GGGG G GD G GG GGG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGG 100 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G GG G GGGG GG G G G Sbjct: 72 GGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXG 838 G GGG G G G GG GGGG GG G G GG G Sbjct: 74 GGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXG--GGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG G GGG GG G G GG GGG Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G GGG GG G G GG GGG Sbjct: 69 GGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG GGG GG GD G GG G G Sbjct: 72 GGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG G G GG G G G GGG Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -1 Query: 671 EXGGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 + GGG G G G GG G G G G G G G G Sbjct: 61 DGGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGG 100 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXG 884 GG GGG G GG GGGG G G Sbjct: 94 GGGGGGGDGGGGGGGGGGGVGRARFG 119 Score = 32.7 bits (71), Expect = 0.46 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G GG G G G G G G G G Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGG 105 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G GG G G G G G G G G Sbjct: 70 GGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G G G G G G G G G G Sbjct: 73 GGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGR 555 GGG G G G GG G G G G G G GR Sbjct: 81 GGGDDGDGGGGDGG--GGGGGGDGGGGGGGGGGGVGR 115 Score = 28.3 bits (60), Expect = 9.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXX-GXGAGXXGXSPEGRG 552 GGG G G G GG G G G G G G G G Sbjct: 76 GGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 46.0 bits (104), Expect = 5e-05 Identities = 19/35 (54%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXN--PPXPXPXXPPPXPPP 951 P P PP PPPP P N PP P P PP PPP Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPP 399 Score = 46.0 bits (104), Expect = 5e-05 Identities = 19/35 (54%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXN--PPXPXPXXPPPXPPP 951 P P PP PPPP P N PP P P PP PPP Sbjct: 375 PPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 45.6 bits (103), Expect = 6e-05 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXP--XXPPPXPPP 951 P P P P PPPP P PP P P PPP PPP Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXN--PPXPXPXXPPPXPPP 951 P P PP PPP P N PP P P PP PPP Sbjct: 355 PSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPP 389 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P + PP PPPP P P P PPP P Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXN--PPXPXPXXPPPXPPP 951 P PP PP P P N PP P P PP PPP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPP 379 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P + PP PPP PP P P P PPP P Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPPP--PTNGPPPPPP 399 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PPPP P N P P P PP PP Sbjct: 385 PPPPPPTNGPPPPPPPTNGPPPPP--PPTNGPP 415 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 5/42 (11%) Frame = +2 Query: 851 PPXXXPXSPXPPX-----PPPPXTPPXPXPXXPXXXPPPXXP 961 PP P SP PP PPPP P P P PPP P Sbjct: 349 PPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPP 390 Score = 36.7 bits (81), Expect = 0.028 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P P PPPP P PP P P P PP Sbjct: 384 PPPPPPPTNGPPPPPPPTNGPPPPPP--PTNGPP 415 Score = 36.3 bits (80), Expect = 0.037 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPP----XPXPXXPXXXPPPXXP 961 PP P P PP PP PP P P P PPP P Sbjct: 369 PPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P +PP P P P PP PPP PP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPP 380 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +1 Query: 883 PPPXPXXNPPXPXPXX--PPPXPPP 951 PPP P NPP P P PP PPP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPP 370 Score = 33.1 bits (72), Expect = 0.35 Identities = 18/49 (36%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +1 Query: 553 PRPSGLXPXXPAPX--PXXPXPAXAXPPXPKXP--XPXXPPPXSXGGXP 687 P P+ P P P P P P PP P P P PPP + G P Sbjct: 358 PPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPP 406 Score = 31.9 bits (69), Expect = 0.80 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = +1 Query: 553 PRPSGLXPXXPAPX--PXXPXPAXAXPPXPKXP--XPXXPPPXSXG 678 P P+ P P P P P P PP P P P PPP + G Sbjct: 368 PPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNG 413 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 ++PP P PP P PP PPP PP Sbjct: 344 VNPPPPPTNNPPSPPPP--TNNTPPPPPP 370 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPP---PXTPPXPXPXXPXXXPPPXXP 961 P P + PP PPP P PP P P PP P Sbjct: 355 PSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGP 394 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P PP P PP P P PPP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPP 380 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +1 Query: 553 PRPSGLXPXXPAPX---PXXPXPAXAXPPXPKXPX-PXXPPPXSXGGXP 687 P P+ P P P P P P PP P P PPP + G P Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPP 396 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXP 925 P +P PP PPPP + P P Sbjct: 72 PSTPAPPPPPPPPSSGPPLP 91 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +1 Query: 553 PRPSGLXPXXPAPX--PXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPLG 693 P P+ P P P P P P PP P P P G P G Sbjct: 378 PPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPSEGKCGRKPAG 426 Score = 28.7 bits (61), Expect = 7.4 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 872 SPXPPXPPPPXTPPXPXPXXP 934 +P P PPPP PP P P Sbjct: 71 APSTPAPPPPPPPPSSGPPLP 91 Score = 28.7 bits (61), Expect = 7.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXP 918 P P PPPP P PP P Sbjct: 72 PSTPAPPPPPPPPSSGPPLP 91 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 PS P P P P PP P P PPP + P Sbjct: 355 PSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPP 397 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 45.6 bits (103), Expect = 6e-05 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PPPP P PP P P PPP PP P Sbjct: 683 PPPPPP---PPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 +P PP PPPP P PP P PP PPP P Sbjct: 676 IPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 41.5 bits (93), Expect = 0.001 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P + PPPP P PP P P P P PP P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PPPP P + P P P PP P Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 Score = 37.5 bits (83), Expect = 0.016 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P + P PPPP PP P PPP PP Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPP 701 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P PP P P P PPP P PP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P +P PP P P P PPP PP Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPP 707 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXS 672 P + P P P P P PP P P PPP S Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPS 712 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXG--GXPLG 693 P P P P P P P P P P PP G G P G Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAG 727 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPK-XPXPXXPPPXSXGGXPLG 693 P P P P P P P P+ PP P P P S G P G Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSG 731 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +2 Query: 851 PPXXXPXSPXP--PXPPPPXTPPXPXPXXP 934 PP P P P P PPPP TPP P Sbjct: 693 PPPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPL 690 P P P P P P P PP P P P PPP P+ Sbjct: 675 PIPIQTMVPPPPPPPPPPPP----PPPPPPPQPSTPPPPPPSTPPV 716 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GG G GG G GG G G G Sbjct: 572 GNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTG 609 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GG G GG G GG G G G Sbjct: 598 GNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTG 635 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXG--GXXXGG 835 G GG G G GG GG GG + G G G GG Sbjct: 567 GNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGG 610 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXG--GXXXGG 835 G GG G G GG GG GG + G G G GG Sbjct: 593 GNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGG 636 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = -3 Query: 951 GGGXXXGXXGXGX-GGVXGGGGXGGXGDXGXXXGGXXXGG 835 GG G G GG GG GG + G GG GG Sbjct: 423 GGNTNGGNNNGGNNGGNNNGGNTGGDNNGGNNYGGNNNGG 462 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GG GG G GG G GG G G Sbjct: 563 GNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGG 598 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GG GG G GG G GG G G Sbjct: 589 GNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGG 624 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/35 (57%), Positives = 20/35 (57%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG GGG G G GG G GGGG GG G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/35 (57%), Positives = 20/35 (57%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG GGG G G GG G GGGG GG G G G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GGG G G GG G GGGG GG G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GGG G GG GGGG G G GG G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -3 Query: 933 GXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G GG GGGG GG G G GG GGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -3 Query: 933 GXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G GG GGGG GG G G GG GGG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GGG G GG GGGG G G GG G G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G GGG G G G GG GGGG GG G G G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = -1 Query: 671 EXGGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEG 558 + GGG G G G GG G G G G G G +G Sbjct: 131 DGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPE 561 GGG G G G GG G G G G G G E Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDE 170 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 671 EXGGGXXGXGXLGXGGXAXAGXGXXGXGAGXXG 573 + GGG G G G GG G G G G G G Sbjct: 130 DDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEG 558 GGG G G G GG G G G G G +G Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 45.2 bits (102), Expect = 8e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G G GG GGGG GG GD G G GGG Sbjct: 774 GDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGG 816 Score = 45.2 bits (102), Expect = 8e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GGGG G G G GG GGG Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGG 819 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG G GG G GD G GG GGG Sbjct: 782 GGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGG 824 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GG G G GG G GGGG GG G G G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGG 806 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G G G GGGG GG G G G Sbjct: 792 GGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXG-GVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G G GGGG GG G G GG GGG Sbjct: 792 GGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G G GG GGGG GG G G GG GGG Sbjct: 839 GGGYADGDGGGGGGG--GGGGGGGGGGGGGGGGGGGGGGG 876 Score = 42.3 bits (95), Expect = 6e-04 Identities = 32/109 (29%), Positives = 32/109 (29%) Frame = -3 Query: 933 GXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGAXXXXXXXXXXXXXXXXXXXXXXXXX 754 G G G GG GGGG GG G G GG GGG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Query: 753 XXXXXXXXXXXXXXXXXXXGPXGGAPXGXGGGRXGXXGLGXGGXCXGRV 607 G GG G GGG G G G GG G V Sbjct: 829 GYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGV 877 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G G GG GGGG GG G G G GGG Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGG 815 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G G GG GGG GG GD GG GGG Sbjct: 780 GGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGG 822 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GGG G G GG G GGGG GG G G Sbjct: 790 GGGGGGGGGGGGGDG-GGYGDGDGGGGGGGGGGGGG 824 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G GG GGGG GG G G GG GGG Sbjct: 831 GDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 873 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGX-GGXGDXG--XXXGGXXXGGG 832 G GGG G G G GG GGGG GG GD G GG GGG Sbjct: 796 GGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGG 841 Score = 40.7 bits (91), Expect = 0.002 Identities = 32/108 (29%), Positives = 32/108 (29%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGAXXXXXXXXXXXXXXXXXXXX 769 GG G G G GG GGGG GG G G GG GGG Sbjct: 769 GGGGGGDGGDGGGGGDGGGG-GGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG 827 Query: 768 XXXXXXXXXXXXXXXXXXXXXXXXGPXGGAPXGXGGGRXGXXGLGXGG 625 G GG G GGG G G G GG Sbjct: 828 GGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXG-GXXXGGG 832 G G G G G G GG GGGG GG G G G G GGG Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGG 814 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGG 864 G GGG GGG G G GG G GGGG GG Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGG---GXGGXGDXGXXXGGXXXGGG 832 GGG G G G GG GGG G GG G G GG GGG Sbjct: 787 GGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G GGG G G GG GGGG GG G G GG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDG 810 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/39 (53%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -1 Query: 959 GXXGGGXG-GGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG G GG G G GG G GGGG GG G G G Sbjct: 824 GGDGGGYGDGGGFGDG-GGYADGDGGGGGGGGGGGGGGG 861 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G G GGG G G GG G GGGG GG G G Sbjct: 840 GGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG G GG GD G GG GGG Sbjct: 817 GGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGG 859 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G G GGG G G GG G GGGG GG G G Sbjct: 841 GYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 38.7 bits (86), Expect = 0.007 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G G GG GGGG GG G G GG G G Sbjct: 770 GGGGGDGGDGGG-GGDGGGGGGGGGGGGGGGGGGDGGGYG 808 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G G GGGG GG G G GG GGG Sbjct: 828 GGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGG 870 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGG---GXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G GGG G GG G G GG GGG Sbjct: 819 GGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGG 864 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXG 865 G GGG G G G GG GGGG GG G G Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G G G GGG GG G G Sbjct: 810 GDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDG 847 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG GGG G G GG GGG Sbjct: 812 GGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGG 854 Score = 36.7 bits (81), Expect = 0.028 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G GG G G GG G G GG GGG Sbjct: 824 GGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGG 866 Score = 36.3 bits (80), Expect = 0.037 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGG-GGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GG G GG GD G G GGG Sbjct: 810 GDGGGG--GGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGG 851 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G GG G G G G G G +G G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGG 806 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G GG G G G G G G +G G Sbjct: 792 GGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Score = 32.7 bits (71), Expect = 0.46 Identities = 28/106 (26%), Positives = 28/106 (26%) Frame = -3 Query: 906 VXGGGGXGGXGDXGXXXGGXXXGGGAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 727 V GGGG G GD G G GGG Sbjct: 767 VVGGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGD 826 Query: 726 XXXXXXXXXXGPXGGAPXGXGGGRXGXXGLGXGGXCXGRVXAXGVG 589 G GG G GGG G G G GG G G G Sbjct: 827 GGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGG 872 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -1 Query: 686 GXPPXEXGGGXXGXGXLGXGGXAXAGXGXXGXGAG 582 G + GGG G G G GG G G G G G Sbjct: 841 GYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G GG G G G G G G G G Sbjct: 827 GGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGG 864 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G GG G G G G G G G Sbjct: 787 GGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGG 824 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G GG G G G G G G G Sbjct: 788 GGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G G G G G G G G G G Sbjct: 790 GGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG 827 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G G G G G G G +G G Sbjct: 798 GGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAG 582 GGG G G G GG G G G G G Sbjct: 849 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 28.3 bits (60), Expect = 9.8 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -1 Query: 686 GXPPXEXGGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 G + GGG G G G GG G G G G G G G Sbjct: 773 GGDGGDGGGGGDGGGG-GGGGGGGGGGGGGGDGGGYGDGDGGGGG 816 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGL 903 G GGG GGG G G GG+ Sbjct: 859 GGGGGGGGGGGGGGGGGGV 877 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP PPP P PP P PP PPP Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PPPP P PP PPP PPP Sbjct: 305 PPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P P P PPPP PP PPP PP Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P P PPPP P PP PPP PP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +1 Query: 847 PXPXPXPP---IXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P PPPP P P P P PPP PPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPP--PPPPPPP 325 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +2 Query: 866 PXSPXPPX--PPPPXTPPXPXPXXPXXXPPPXXP 961 P P PP PPPP PP P P PPP P Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 35.9 bits (79), Expect = 0.049 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP P P PP PPP PPP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPP 325 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 586 APXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 AP P P P PP P P P PPP G P Sbjct: 301 APAPPPPPPPGGAPPPP--PPPPPPPPGDGGAPP 332 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 7/42 (16%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPP-------PXPPXXPXXXPPPXPP 962 P P ++ P P PPP P PP P PPP PP Sbjct: 278 PEVPDIVTGGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPP 319 Score = 32.3 bits (70), Expect = 0.60 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 872 SPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 +P PP PP + P P P P PP P Sbjct: 289 APVPPPPPADGSAPAPPPPPPPGGAPPPPP 318 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P G P P P P P A PP P P PPP GG P Sbjct: 295 PPADGSAPAPPPP----PPPGGAPPP----PPPPPPPPPGDGGAP 331 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPPXG 694 P P + P PP P P PPP P P G Sbjct: 294 PPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDG 328 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXP 636 P P G P P P P P A PP P Sbjct: 308 PPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P A PP P P PPP P PP Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPP 325 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 565 GLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 G P P P PA PP P P PPP Sbjct: 287 GGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPP 320 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 43.6 bits (98), Expect = 2e-04 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P+ PP P PP P P PPP PPP Sbjct: 177 PAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPP 209 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P S PP PPPP PP P P PPP Sbjct: 190 PPSGGPPPPPPPPPPPPPPPILELAAPPP 218 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P PP P + PPP PP P PP PP Sbjct: 124 PSPPPPPTSPATRAPPPPPPIAPATGGPPPPP 155 Score = 35.9 bits (79), Expect = 0.049 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 9/47 (19%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXP-----XXNPPXPXPXXP----PPXPPPXXP 960 P P P P PPP P PP P P P PP PPP P Sbjct: 126 PPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAP 172 Score = 35.9 bits (79), Expect = 0.049 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPP---IXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P + P P +PP P PPP PPP P Sbjct: 165 PPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPP 205 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P P P PP PP P PP PP Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPP 142 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXN-PPXPXPXXP----PPXPPPXXP 960 P P PP PPP P PP P P P PP PPP P Sbjct: 120 PSQAPSPP---PPPTSPATRAPPPPPPIAPATGGPPPPPPIAP 159 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/46 (32%), Positives = 18/46 (39%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPL 690 P P + P P P P A + PP P P PPP P+ Sbjct: 165 PPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPI 210 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXP----PPXPPPXXP 960 P P PP P P +PP P P P PP PPP P Sbjct: 108 PTPPPPPRAPETPSQAPSPP-PPPTSPATRAPPPPPPIAP 146 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P + P P PPPP PP PPP PP Sbjct: 179 PAVPLAAASPPPPSGGPPPPPPP----PPPPPPPP 209 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P + P P P P A P P P PP GG P Sbjct: 152 PPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPP 196 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PP PPPP P PP P P PP Sbjct: 189 PPPSGGPP---PPPPPPPPPPPPPILELAAPPPP 219 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P P P PPPP PP PP P Sbjct: 189 PPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 31.9 bits (69), Expect = 0.80 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPP--PXT--PPXPXPXXP-XXXPPPXXP 961 PP P + PP PPP P T PP P P P P P P Sbjct: 141 PPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVP 182 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P PP PP P PPP PP Sbjct: 177 PAPAVPLAAASPPPPSGGPPPPPPPPPPPPPP 208 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P PPPP PP P PP Sbjct: 191 PSGGPPPPPPPPPPPPPPPILELAAPP 217 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P P P PP P P PPP Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPP 142 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +2 Query: 590 PTPXAXTLPXQXP-PXPXPXXPXR--PPPXPXGAPPXG 694 P P A P Q P P P P P PPP P AP G Sbjct: 112 PPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATG 149 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P P P P P P PPP P Sbjct: 96 PTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSP 133 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P A + PP P P PPP Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPP 140 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 894 PXPQPPPPXPPXXPXXXPPPXPP 962 P P PPPP PP P PP Sbjct: 196 PPPPPPPPPPPPPPILELAAPPP 218 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG GGG G G GG G GGG GG G G G Sbjct: 1807 GGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAG 1841 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GGG G G G GG GGG G G G G GGGA Sbjct: 1797 GMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGA 1840 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXG---DXGXXXGGXXXGGG 832 G GGG G G G G GGGG GG G G GG GGG Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGG 1801 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXG 838 GGG G G G GG+ GGGG G G G GG G Sbjct: 1788 GGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMG 1825 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/40 (47%), Positives = 21/40 (52%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G G GG+ GGG G G+ G GG GGG Sbjct: 1770 GGGMAGGGGGMGGGGMAAGGGEFGGGE-GMGGGGMAGGGG 1808 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GGG G G G G GG G GG G G Sbjct: 1811 GGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG G G G GG G GGGG GG G G Sbjct: 1790 GEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMG 1825 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXG--GLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G G G G GGGG GG G G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGG 1795 Score = 37.5 bits (83), Expect = 0.016 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = -1 Query: 950 GGGXGGGXXGXGXG--GLXXGXGGGGXXXGGXGXGXG 846 GGG GGG G G G G GGGG GG G G G Sbjct: 1777 GGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGG 1813 Score = 37.5 bits (83), Expect = 0.016 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GGG G G GG GGG GG G G G G GA Sbjct: 1790 GEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGA 1833 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG G G G G G G G GG G G G G Sbjct: 1809 GMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/42 (47%), Positives = 21/42 (50%), Gaps = 4/42 (9%) Frame = -1 Query: 959 GXXGGGXG--GGXXGXGXGGLXXGXG--GGGXXXGGXGXGXG 846 G GGG G GG G G GG+ G G GGG GG G G Sbjct: 1765 GGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGG 1806 Score = 35.5 bits (78), Expect = 0.065 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GGGG G G GG GGG Sbjct: 1779 GMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGG 1821 Score = 35.5 bits (78), Expect = 0.065 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG G G G G GG GGG Sbjct: 1802 GMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGG 1844 Score = 35.5 bits (78), Expect = 0.065 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G G GG G GG G G G GGG Sbjct: 1807 GGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 35.1 bits (77), Expect = 0.086 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG GGG G G G GG GGG Sbjct: 1772 GMAGGGGGMGGGGMAAGGGEFGGGE-GMGGGGMAGGGGGMGGG 1813 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G G GG G GG G G G GGG Sbjct: 1777 GGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGG 1816 Score = 32.3 bits (70), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G GG G G G G G G EG G Sbjct: 1788 GGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMG 1825 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGG 850 G GGG G G G G GG G GG G GG Sbjct: 1811 GGGGGG--MGGGGEGMGAAGGGMGAGGEGGGAGGGGG 1845 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G GG G G G GA G G G Sbjct: 1800 GGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEG 1837 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G GG G G GAG G G G Sbjct: 1807 GGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGG 1844 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G GGGG G G G GG GGG Sbjct: 70 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 112 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G V GG G G G G GGG Sbjct: 51 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGG 93 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGG--GXGGXGDXGXXXGGXXXGGG 832 G G G GG GGG G GG G G GG GGG Sbjct: 65 GDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGG 106 Score = 32.7 bits (71), Expect = 0.46 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -1 Query: 950 GGGXG-GGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG G GG G G GG G GGGG GG G Sbjct: 83 GGGDGDGGGGGDGDGG-GGGDGGGGGDGGGGNDDDG 117 Score = 31.9 bits (69), Expect = 0.80 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 GG GGG G G G G G G GG G G Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGG 79 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 8/51 (15%) Frame = -3 Query: 960 GXXGGGXXXG----XXGXG----XGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GGG GG GD GG GGG Sbjct: 49 GDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGG 99 Score = 28.3 bits (60), Expect = 9.8 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G G GD G GG GGG Sbjct: 48 GGDGGG------GGGDGDGDDDDGDGNVGDDGGGDGGGCDGGG 84 Score = 28.3 bits (60), Expect = 9.8 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = -1 Query: 959 GXXGGG--XGGGXXGXGXGGL-XXGXGGGGXXXGGXGXGXG 846 G GGG G G G G + G G GG GG G G G Sbjct: 49 GDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDG 89 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 42.3 bits (95), Expect = 6e-04 Identities = 17/31 (54%), Positives = 18/31 (58%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP PPPP P + P P P PPP PPP Sbjct: 1157 PPPP---PPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 +P P P PP PPPP PP P P PPP P Sbjct: 1156 IPPPPPPPP---PPPPSSPSPPPPPPPPPPPPTP 1186 Score = 41.5 bits (93), Expect = 0.001 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 PP P P PPPP P P PPP PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 871 IXXPPPPXPXXNPPXPXPXXPPPXPPP 951 I PPPP P P P P PPP PPP Sbjct: 1156 IPPPPPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 + PP P P PPP P P PPP PP Sbjct: 1156 IPPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXP 925 PP P SP PP PPPP PP P P Sbjct: 1163 PPPPPPSSPSPPPPPPP-PPPPPTP 1186 Score = 35.9 bits (79), Expect = 0.049 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXP 925 PP P P P PPPP PP P P Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 35.1 bits (77), Expect = 0.086 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 PP P P P P PP P PPP P Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXP 934 PP P P PP P P PP P P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 32.3 bits (70), Expect = 0.60 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 583 PAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P + P P P P PPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 32.3 bits (70), Expect = 0.60 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 583 PAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P+ PP P P P P P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 614 PXQXPPXPXPXXPXRPPPXPXGAPP 688 P PP P P P PPP P PP Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPP 663 P P P P P + + PP P P P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 614 PXQXPPXPXPXXPXRPPPXPXGAPP 688 P PP P P PPP P PP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPP 1182 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G GGGG G G G GG GGG Sbjct: 85 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 127 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G V GG G G G G GGG Sbjct: 66 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGG 108 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGG--GXGGXGDXGXXXGGXXXGGG 832 G G G GG GGG G GG G G GG GGG Sbjct: 80 GDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGG 121 Score = 32.7 bits (71), Expect = 0.46 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -1 Query: 950 GGGXG-GGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG G GG G G GG G GGGG GG G Sbjct: 98 GGGDGDGGGGGDGDGG-GGGDGGGGGDGGGGNDDDG 132 Score = 31.9 bits (69), Expect = 0.80 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 GG GGG G G G G G G GG G G Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGG 94 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 8/51 (15%) Frame = -3 Query: 960 GXXGGGXXXG----XXGXG----XGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GGG GG GD GG GGG Sbjct: 64 GDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGG 114 Score = 28.3 bits (60), Expect = 9.8 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G G GD G GG GGG Sbjct: 63 GGDGGG------GGGDGDGDDDDGDGNVGDDGGGDGGGCDGGG 99 Score = 28.3 bits (60), Expect = 9.8 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = -1 Query: 959 GXXGGG--XGGGXXGXGXGGL-XXGXGGGGXXXGGXGXGXG 846 G GGG G G G G + G G GG GG G G G Sbjct: 64 GDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDG 104 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 42.3 bits (95), Expect = 6e-04 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP+ PPPP P P PP PPP Sbjct: 363 PPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPP 397 Score = 35.5 bits (78), Expect = 0.065 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P ++PP PPPP PP P PPP PP Sbjct: 347 PPPSMGMAPPPVGGAAPPPPPPP--PVGGPPPPPP 379 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PPPP PP PPP PPP Sbjct: 339 PPPSRGAPPPPSMGMAPPPVGGAAPPPPPPP 369 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PPI PP PP P P P P P P Sbjct: 375 PPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIP 410 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXP---XXPPPXPPP 951 P P + PPP PP P P PPP PPP Sbjct: 347 PPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPP 380 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P +PP P PP PP PPP PP Sbjct: 297 PPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPP 331 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP +P PP PPP PP P P P PP Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPPPPP--PIEGRPP 386 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P G P P P P + PP P P PPP Sbjct: 368 PPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPP 405 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPP PP P P PPP Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPP 319 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 4/42 (9%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPPXXP 960 P P P PPPP PP PPP PPP P Sbjct: 327 PPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPP 368 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPP---XPPXXPXXXPPPXPP 962 P PP P PPPP PP PPP PP Sbjct: 364 PPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P + PP P RPPP GAPP Sbjct: 315 PPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPP 347 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 + P P PPPP PP P PP PP Sbjct: 285 IQPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPP 319 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXX---PPPXPPP 951 P P PPPP + P P P PP PPP Sbjct: 298 PPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPP 331 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP P + P P PPP Sbjct: 315 PPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPP 349 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +1 Query: 859 PXPPIXXPPPPXP---XXNPPXPXPXXPPPXPPP 951 P PP PPP P PP P P PPP Sbjct: 297 PPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPP 330 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXN-PPXPXPXXPPPXPPP 951 P P P PPPP PP P P PPP Sbjct: 305 PPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPP 340 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P PPP PP PPP PP Sbjct: 346 PPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPP 380 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P PS P P+ P A PP P P PPP Sbjct: 339 PPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPP 376 Score = 28.7 bits (61), Expect = 7.4 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +1 Query: 553 PRPS-GLXPXX---PAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P PS G+ P AP P P P PP P P PP S G P Sbjct: 347 PPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPP--PPIEGRPPSSLGNPP 393 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 9/44 (20%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXP---------XXPPPXPPP 951 P P PPPP PP P P PPP PPP Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPLG 693 P P P P P P P PPP G P G Sbjct: 367 PPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPG 406 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P S P P+ P PP P PPP GG P Sbjct: 331 PSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPP 375 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P PP P P PPP G PP Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPPPPPPI-EGRPP 386 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG G G GG G G GG GGG Sbjct: 185 GHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGG 227 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG GGGG GG G G GG GGG Sbjct: 153 GYRGGGGGYRGRGRGGGG-YGGGGYGGGGYGGGGHGGGGYGGG 194 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GGGG GG G G GG GGG Sbjct: 147 GYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGG 189 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGG-GXGGXGDXGXXXGGXXXGGG 832 G GG G G G GG GGG G GG G G GG GGG Sbjct: 168 GGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGG 211 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXG-GGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G G GGG GG G G GG GGG Sbjct: 175 GYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGG 218 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -3 Query: 960 GXXGG--GXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G G G GG GGGG GG G G GG GGG Sbjct: 156 GGGGGYRGRGRGGGGYGGGG-YGGGGYGGGGHGGGGYGGGGYGGG 199 Score = 38.7 bits (86), Expect = 0.007 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGG-GXGGXGDXGXXXGGXXXGG 835 G GG G G G GG GGG G GG G G GG GG Sbjct: 163 GRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGG 205 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXG-GGGXXXGGXGXGXG 846 G GGG GGG G G G G G GGG GG G G Sbjct: 190 GYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGG--XGGXGDXGXXXGGXXXGGG 832 G GGG G GG GGGG GG G G GG GGG Sbjct: 130 GGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGG 174 Score = 36.7 bits (81), Expect = 0.028 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXG-DXGXXXGGXXXGGG 832 G GGG G G G G GGGG GG G G GG GGG Sbjct: 180 GYGGGGHGGGGYGGGGYG-GGGGGYGGSGYGGGGGYGGGGYGGG 222 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGG-GXGGXGDXGXXXGGXXXGGG 832 G GG G G G GG GGG G GG G G GG GG Sbjct: 173 GGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGG 216 Score = 35.9 bits (79), Expect = 0.049 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 689 RGXPPXEXGGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 RG GGG G G G GG G G G G G G G G Sbjct: 164 RGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYG 209 Score = 35.5 bits (78), Expect = 0.065 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGX-GGXGDXGXXXGGXXXGGG 832 GGG G G GG GGGG G G G GG GGG Sbjct: 139 GGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGG 179 Score = 35.5 bits (78), Expect = 0.065 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G GG G G GG G G GG GGG Sbjct: 145 GGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGG 184 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G G GGG GG G G Sbjct: 126 GRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRG 163 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXG--GGGXXXGGXGXGXG 846 G GGG GGG GG G G GGG G G G G Sbjct: 130 GGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGG 169 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GGG GG GGG G GG R G G Sbjct: 134 GGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGG 168 Score = 33.1 bits (72), Expect = 0.35 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGG-GXGGXGDXGXXXGGXXXGG 835 GGG G G G GGG G GG G G GG GG Sbjct: 151 GGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGG 190 Score = 32.3 bits (70), Expect = 0.60 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG GG G G GG GGG GG G G Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGG 158 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G G GG GGGG G G GG GGG Sbjct: 123 GGG---GRRGGGYGGGRGGGG-GYRSGGGYRGGGGYRGGG 158 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGG-GXGXGXXGGXRXXG 866 GG GGG G GGG G G G GG R G Sbjct: 194 GGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGG 226 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 952 GGGXXXGXXGGXGGGGXGXGXXGGXRXXG 866 GGG G GG GGG G GG R G Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGGGYRGGG 152 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G GG G G G G G G G G Sbjct: 133 GGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGG 170 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G GG G G G G G G G G Sbjct: 158 GGGYRGRGR-GGGGYGGGGYGGGGYGGGGHGGGGYGGG 194 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PPPP P PP P P P P PPP P Sbjct: 75 PPPPAAPPAA-PPPPPPLPAPP-PPPAQPAPQPPPAPP 110 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPP P PP P P P P PPP P Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPP-LPAPPPPPAQP 101 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPP-PPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP P PP P P P P PP PP P Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPP 89 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXPP---PPXTPPXPXPXXPXXXPPPXXP 961 PP P +P PP P PP PP P P P P P P Sbjct: 67 PPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPP 106 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +2 Query: 851 PPXXXPXSP--XPPXPPPPXTPP--XPXPXXPXXXPPPXXP 961 PP P P P PPPP P P P P PPP P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPP 90 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP P PP P P P P PPP PP P Sbjct: 81 PPAAPPPPPPLPAPPPP---PAQPAP-QPPPAPPHFLP 114 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXP--PXPKXPXPXXPPP 666 P + P PA P P P A P P P P P PPP Sbjct: 58 PAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPP 97 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPP 663 P P P P P A PP P P P PP Sbjct: 78 PAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P PA PP P P PP Sbjct: 75 PPPPAAPPAAPPPPP--PLPAPPPPPAQPAPQPPPAPP 110 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 3/39 (7%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPP---XTPPXPXPXXPXXXPPPXXP 961 P SP PP P PP P P P PPP P Sbjct: 43 PHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAP 81 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAPX-PXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P P AP P P A A PP P P PPP P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPP 95 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXP 934 PP P P PP P P PP P P Sbjct: 87 PPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P + P P P P A A PP P PPP + P Sbjct: 43 PHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAP 85 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P A PP P P PPP P PP Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPP 97 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 583 PAPXPXXPXPAXAXPPXPKXPXPXXPP 663 PA P P A PP P P P PP Sbjct: 72 PAAPPPPAAPPAAPPPPPPLPAPPPPP 98 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 900 PQPPPPXPPXXPXXXPPP 953 P PPPP PP PPP Sbjct: 50 PPPPPPSPPAAAPAAPPP 67 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 590 PTPXAX-TLPXQXPPXPXPXXPX-RPPPXPXGAPP 688 P P A P PP P P P +P P P APP Sbjct: 76 PPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXN-PPXPXPXXPPPXPP 948 P P PP PPP P PP P P PPP PP Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPLPPLPPPPPP 981 Score = 35.9 bits (79), Expect = 0.049 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PPPP P P P P PPP PP Sbjct: 901 PKPTTPAPPPPLPLA--PEPPPPLPPPPPP 928 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 885 PXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P PP P P P PPP PP Sbjct: 903 PTTPAPPPPLPLAPEPPPPLPPPPPP 928 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 880 PPPPXPXXNPPXPXPXXPPPXPPPXXP 960 PPPP PP P PPP PP P Sbjct: 951 PPPPTSALPPPIPATQVPPPPLPPLPP 977 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 PT T P PP P P P PPP P PP Sbjct: 898 PTTPKPTTPA--PPPPLPLAPEPPPPLPPPPPP 928 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P PA PP P P P PPP Sbjct: 951 PPPPTSALPPPIPATQVPPPPLPPLPPPPPP 981 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPP 913 PP P +P PP P PP PP Sbjct: 908 PPPPLPLAPEPPPPLPPPPPP 928 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P PP P Q PPP P P PPP PP Sbjct: 951 PPPPTSALPPPIPATQVPPP--PLPPL--PPPPPP 981 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 880 PPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP P PPP PP P Sbjct: 901 PKPTTPAPPPPLPLAPEPPPPLPPPPP 927 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P P P PPP Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPPPPLPPPPPP 928 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXP 919 P P P P PPPP PP P Sbjct: 906 PAPPPPLPLAPEPPPPLPPPPP 927 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P P P P TP P P PPP P Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPPPPLPLAPEPPPPLP 923 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 596 PXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P T P P P P P PPP P P Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPPPPLPLAPEP 918 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXPP-PPXTPPXPXPXXPXXXPPPXXP 961 PP P PP PP PP PP P P P Sbjct: 960 PPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPPASCMP 997 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 596 PXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P T P P P P P P P P PP Sbjct: 895 PTTPTTPKPTTPAPPPPLPLAPEPPPPLPPP 925 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPKXPXP 651 P+ P PAP P P PP P P P Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPPPPLPPPPPP 928 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P P P P PP PP P P P P P Sbjct: 903 PTTPAPPPPLPLAPEPP--PPLPPPPPPIQTTRPTVP 937 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P PPPP P PP P P Sbjct: 909 PPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTP 940 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXG 838 G GG G G G GGV GGGG GG G GG G Sbjct: 76 GDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 Score = 37.5 bits (83), Expect = 0.016 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G G GG GGGG GG G G G GG Sbjct: 74 GGGDTDGGGGCGGGG-GGGGGVGGGGGGGGGGGDDCEDGG 112 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 GGG G G G G GGGG GG D G GG+ Sbjct: 81 GGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGS 121 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G GGG GGG G G GG G GGG G G Sbjct: 83 GCGGGGGGGGGVGGGGGG---GGGGGDDCEDGGG 113 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G GG GGG G G Sbjct: 88 GGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDG 125 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GGG GG GGGG G G G G Sbjct: 85 GGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDG 119 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -1 Query: 671 EXGGGX-XGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 + GGG G G G GG G G G G G G E G Sbjct: 72 DDGGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGG 112 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G GGG GGG GG G GG G G Sbjct: 95 GGGGGGGGGGGDDCEDGGGDDGEDGGSDNDGDEG 128 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GGGG GG G GG GGG Sbjct: 205 GSGGGGYGGGRGGGGYGGGHGGGGYGGGG--RHDYGGGSKGGG 245 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G G GG GGG GG G G GG GGG Sbjct: 191 GGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGG 233 Score = 35.5 bits (78), Expect = 0.065 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G GGG G G G GGG GG G G GG GG Sbjct: 182 GSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGG 223 Score = 35.1 bits (77), Expect = 0.086 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G GG G G G G G GG GGG Sbjct: 180 GGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGG 219 Score = 34.7 bits (76), Expect = 0.11 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = -3 Query: 960 GXXGGGXXXG----XXGXGXGGVXGG-GGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GG GG G G G GG GGG Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGG 223 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GG GG G G GG GG Sbjct: 200 GGYGGGSGGGGYGGGRGG---GGYGGGHGGGGYGGGGRHDYGG 239 Score = 31.9 bits (69), Expect = 0.80 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGG 864 G GG GG G G GG G GGGG GG Sbjct: 203 GGGSGG-GGYGGGRGGGGYGGGHGGGGYGGGG 233 Score = 28.3 bits (60), Expect = 9.8 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -1 Query: 692 PRGXPPXEXGGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 PRG GGG G G GG G G G+G G GRG Sbjct: 174 PRGD---SGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYG-GGRG 216 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 844 VPXPXPXPPIXXPP--PPXPXXNPPXPXPXXPPPXPPPXXP 960 VP P P P PP PP P P P PP PPP P Sbjct: 1015 VPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDP 1055 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P P P P TPP P P PP P Sbjct: 1023 PPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P PP PP P P PP P P PP P Sbjct: 1028 PTDPPTPPPTEPPTPPPT-EPPTPPPTDPPTQP 1059 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P + P P PP PP P PP PP Sbjct: 1006 PTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPP 1040 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 608 TLPXQXPPXPXPXXPXRPPPXPXGAPP 688 T P PP P P P PPP PP Sbjct: 1025 TEPPTDPPTPPPTEPPTPPPTEPPTPP 1051 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 3/39 (7%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXP---PPXPPPXXP 960 P + P P P PP P P PP PPP P Sbjct: 1009 PGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEP 1047 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 +P P P P P P P PP PPP P Sbjct: 1001 LPTSGPTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEP 1039 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GG G G GG G GGG GG G G G Sbjct: 163 GGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRG 200 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G GGG GGG G G GG G GG G G G Sbjct: 170 GGRGGGEGGGGRGRGTGGGSRGGGGDGRGRGRGG 203 Score = 35.5 bits (78), Expect = 0.065 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G G G GGG GG G GG GGG Sbjct: 152 GRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGG 194 Score = 35.1 bits (77), Expect = 0.086 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = -1 Query: 959 GXXGGGXGGG---XXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G G GGG G G GG G GG G GG G G G Sbjct: 137 GGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEG 177 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGD-XGXXXGG 850 G GGG G G G G GGG GG GD G GG Sbjct: 166 GGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRGRGG 203 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGG--GGXGGXGDXGXXXGGXXXGGG 832 G G G G G G GG GG GG G G GG GGG Sbjct: 136 GGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGG 180 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 GGG G G GG G GG G G+ G G GG Sbjct: 150 GGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGG 188 Score = 31.9 bits (69), Expect = 0.80 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -1 Query: 689 RGXPPXEXGGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 RG E G G G G GG G G G G G +GRG Sbjct: 153 RGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRG 198 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXG-GGGXGGXGDXGXXXGGXXXGGG 832 G G G G G GG G GGG G G G G GGG Sbjct: 128 GRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGG 171 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = -1 Query: 950 GGGXG-GGXXGXGXG-GLXXGXGGGGXXXGGXGXGXG 846 GGG G GG G G G G G GG G GG G G Sbjct: 144 GGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGG 180 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P PP P P P P PP PPP P Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PPP P PP P P PPP P Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPP--PPPVKKP 253 Score = 36.7 bits (81), Expect = 0.028 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 V P P PPPP PP P PPP PPP Sbjct: 213 VNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPP 248 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAP-XPXXPXPAXAXPPXPKXPXPXXPP 663 P P L P P P P P P A PP P P P P Sbjct: 216 PEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P +P PP P P PP P P PP P Sbjct: 218 PDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXP 934 PP P P PP PP PP P P Sbjct: 226 PPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 587 RPTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 + TP P P P P PPP P APP Sbjct: 209 KATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPP 242 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP---PPXXP 960 P P+ P P PP P PPP P PP P Sbjct: 205 PKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPP 245 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P P P PPPP PP P P P Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 595 PXXPXPAXAXPPXPKXPXPXXPPP 666 P P PA PP P P PPP Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPP 246 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 924 GXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G GGV GGGG GG G GG GGG Sbjct: 33 GVGGGGVGGGGGNGGGAGNGVGAGGCGCGGG 63 Score = 38.7 bits (86), Expect = 0.007 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G GG G GG D G GG GGG Sbjct: 38 GVGGGGGNGGGAGNGVGA--GGCGCGGGNDGGNGGGGAGNGGG 78 Score = 35.9 bits (79), Expect = 0.049 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXG 865 G G G G G G GG GGGG GG G G Sbjct: 80 GGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNG 111 Score = 35.5 bits (78), Expect = 0.065 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G G G G G GG GG GG G GG GG A Sbjct: 48 GAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAA 88 Score = 35.5 bits (78), Expect = 0.065 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGG---XGGXGDXGXXXGGXXXGGGA 829 GGG G G G G GGGG G G G GG GGG+ Sbjct: 61 GGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGS 104 Score = 35.5 bits (78), Expect = 0.065 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G G GG G G G G+ G G G G Sbjct: 69 GGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNG 111 Score = 35.1 bits (77), Expect = 0.086 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G G G G G GG GGG G G G GG GG Sbjct: 29 GVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGG 67 Score = 35.1 bits (77), Expect = 0.086 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -1 Query: 959 GXXGGGXGGGXXGX-GXGGLXXGXGGGGXXXGGXGXGXG 846 G G G GGG G G GG G GGGG GG G Sbjct: 54 GAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAG 92 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVX-GGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G GG GGG GG G G GG G G Sbjct: 40 GGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAG 83 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GGG G GG G G GG GG G Sbjct: 33 GVGGGGVGGG--GGNGGGAGNGVGAGGCGCGGGNDG 66 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 GGG G G G GG G G GG G G GG GG Sbjct: 35 GGGGVGGGGGNG-GGAGNGVGAGGCGCGGGNDGGNGGGG 72 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G G GG G G G G G G G Sbjct: 62 GGNDGGNGGGGAGNGGGG---GGAGNGGAAGAAGAGAG 96 Score = 32.7 bits (71), Expect = 0.46 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = -1 Query: 959 GXXGGG--XGGGXXGXGXGGL--XXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G GG G G GG GG G G Sbjct: 67 GNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVG 108 Score = 32.3 bits (70), Expect = 0.60 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G GG G GG GG G G G G Sbjct: 54 GAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAG 96 Score = 31.9 bits (69), Expect = 0.80 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GG G G G G GG GG G G G G G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCG 61 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GGG G G GGGG G G G G G Sbjct: 66 GGNGGG---GAGNGGGGGGAGNGGAAGAAGAGAGG 97 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GG G G G G G GG G G G GA Sbjct: 52 GVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGA 95 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 G GG GG G G GGGG G G G+ Sbjct: 77 GGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGGSGS 115 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G GG G G G G G Sbjct: 63 GNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVG 100 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEG 558 GGG G G G G A AG G G G G G Sbjct: 76 GGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNG 111 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGD 871 G G G G G GGV G GG G D Sbjct: 89 GAAGAGAGGNVGGGGSGGVGGNGGSGSDDD 118 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEG 558 GGG G G G G G G G G G G + G Sbjct: 36 GGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGG 71 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GG G G G G G G G G G G G+ Sbjct: 72 GAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGGSGS 115 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXG-DXGXXXGGXXXGG 835 G G G G GG GG G G G GG GG Sbjct: 67 GNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGG 106 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 918 GXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G GGGG GG G G G GG Sbjct: 29 GVGVGVGGGGVGGGGGNGGGAGNGVGAGG 57 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 SP P PPPP PP P PPP PP Sbjct: 189 SPMAGMPPPPPPPPPPGFPGGAPPPPPP 216 Score = 36.3 bits (80), Expect = 0.037 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P P P P P P A PP P P PPP GG P Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPP-PFGAPPPPALNGGPP 231 Score = 35.9 bits (79), Expect = 0.049 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PPPP P P P PPP PP P Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAP 221 Score = 35.1 bits (77), Expect = 0.086 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 3/37 (8%) Frame = +2 Query: 587 RPTPXAXTLPXQXPPXPXPXXP---XRPPPXPXGAPP 688 +P+P A +P PP P P P PPP P GAPP Sbjct: 187 KPSPMAG-MPPPPPPPPPPGFPGGAPPPPPPPFGAPP 222 Score = 35.1 bits (77), Expect = 0.086 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P PP PPP P PP P P P PP Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP P P P PP PP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPP 222 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +1 Query: 847 PXPXPXPPIXX----PPPPXPXXNPPXPXPXXPPP 939 P P P PP PPPP P PP P PP Sbjct: 197 PPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGPP 231 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 904 NPPXPXPXXPPPXPPPXXP 960 N P P PPP PPP P Sbjct: 186 NKPSPMAGMPPPPPPPPPP 204 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GG G G G GG GGGG GG G G GGG+ Sbjct: 105 GSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGS 148 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GG G GG GGGG G G GG G G Sbjct: 101 GGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGG 135 Score = 37.5 bits (83), Expect = 0.016 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -1 Query: 959 GXXGGGXGGGXXGXG-XGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G GG G GGG GG G G Sbjct: 114 GRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGSKGGG 152 Score = 37.1 bits (82), Expect = 0.021 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVX-GGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GGG GG G GG GGG Sbjct: 109 GGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGSKGGG 152 Score = 36.3 bits (80), Expect = 0.037 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 GGG G G GG GGGG GG G G GG GG Sbjct: 99 GGGGYGGSSRGGYGGGRGGGGYGG-GRGGGGYGGGRGGG 136 Score = 35.9 bits (79), Expect = 0.049 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G G GG G GGGG GG G G G Sbjct: 105 GSSRGGYGGGRGGGGYGG---GRGGGGYG-GGRGGGYG 138 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G G G GG G G G GG GGG Sbjct: 90 GSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGG 132 Score = 32.3 bits (70), Expect = 0.60 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXG-GXXXGGG 832 GGG G GG GGG GG G G G G GGG Sbjct: 100 GGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGG 140 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 6/44 (13%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXG------GGGXGGXGDXGXXXGGXXXGG 835 GG G G GG G GGG GG G G GG GG Sbjct: 89 GGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGG 132 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXP 934 P SP PP PPPP PP P P P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 Score = 37.1 bits (82), Expect = 0.021 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXPPP 953 + PP P P PPPP PP P P P Sbjct: 1305 IQPPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 35.5 bits (78), Expect = 0.065 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +3 Query: 900 PQPPPPXPPXXPXXXPPPXPP 962 P+ PPP PP P PPP PP Sbjct: 1308 PESPPPPPPPPPPPPPPPLPP 1328 Score = 33.5 bits (73), Expect = 0.26 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXP 919 P P P PP PPPP PP P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 Score = 32.3 bits (70), Expect = 0.60 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXP 925 P P P PP PPPP P P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 868 PIXXPPPPXPXXNPPXPXPXXPPP 939 P PPPP P PP P P P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 903 QPPPPXPPXXPXXXPPPXPP 962 QPP PP P PPP PP Sbjct: 1306 QPPESPPPPPPPPPPPPPPP 1325 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 883 PPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP P PP P P PPP P P P Sbjct: 1307 PPESPP--PPPPPPPPPPPPPLPPTP 1330 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 620 QXPPXPXPXXPXRPPPXPXGAPP 688 Q P P P P PPP P PP Sbjct: 1306 QPPESPPPPPPPPPPPPPPPLPP 1328 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 614 PXQXPPXPXPXXPXRPPPXP 673 P PP P P P PPP P Sbjct: 1308 PESPPPPPPPPPPPPPPPLP 1327 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 GGG GGG G GG G GGG GG G G Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGG 344 Score = 37.9 bits (84), Expect = 0.012 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXG-GGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G GGG GG G G GG GGG Sbjct: 95 GSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGG 138 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGG-XGGXGDXGXXXGGXXXGGGA 829 GGG G G GG GGGG GG G G GG GGA Sbjct: 104 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGRRDYGGA 145 Score = 36.7 bits (81), Expect = 0.028 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXG 866 GG GG G GG GGGG G G GG G Sbjct: 106 GGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGG 137 Score = 35.1 bits (77), Expect = 0.086 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXG 866 GG GGG G GG GGG G GG R G Sbjct: 313 GGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGG 344 Score = 32.3 bits (70), Expect = 0.60 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGD--XGXXXGGXXXGGGA 829 G GGG G GG GG GG G G GG GGG+ Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGS 134 Score = 31.9 bits (69), Expect = 0.80 Identities = 19/43 (44%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGG--XXXGGGA 829 GGG G G GG GGG GG G G GG GGG+ Sbjct: 312 GGGRGGGYRSGGGGGY-GGGRGGGRGYGGGRGGGGRRDYGGGS 353 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GG GGG G G GG G GG G G G Sbjct: 94 GGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGG 128 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXG-GLXXGXGGGGXXXGGXGXGXG 846 G GG GG G G G G G GGGG G G G Sbjct: 318 GYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGGGSRSG 356 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = +1 Query: 844 VPXPXPXP---PIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 VP P P P PPPP P + P P P P PPP P Sbjct: 539 VPIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPP 580 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PPP P P P P PPP PP P Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPP--PPPEPPEECP 587 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNP-PXPXPXXPPPXPPPXXP 960 P P P + PPP P +P P P P PP PP P Sbjct: 555 PPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P I P PP PP P P P PPP Sbjct: 555 PPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPP 589 Score = 35.5 bits (78), Expect = 0.065 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPP 936 V P P PP P PP P PP P PP Sbjct: 561 VDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +2 Query: 872 SPXPPXPPP--PXTPPXPXPXXPXXXPPPXXP 961 S PP PPP PP P P PPP P Sbjct: 551 SEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEP 582 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P +P PP P P PP P PP Sbjct: 556 PPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPP 588 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P G+ P P P P PP P+ P PPP Sbjct: 556 PPPPGVDIPPPLPPSEDPKP---PPPPPEPPEECPPPP 590 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GGG G G G GG GGGG G D G GG A Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDGDDDDDDDDGGDA 96 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Frame = +1 Query: 853 PXPXPPIXXP---PPPXPXXNPPXPXPXXPPPXPPP 951 P P PPI P PPP P +PP P PP PP Sbjct: 181 PPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPP 216 Score = 36.7 bits (81), Expect = 0.028 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Frame = +2 Query: 851 PPXXXPXSPXPPXPP--PPXTPPXPXPXX--PXXXPPPXXP 961 PP P + PP PP PP T P P P P PPP P Sbjct: 185 PPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFP 225 Score = 35.9 bits (79), Expect = 0.049 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = +1 Query: 853 PXPXPPIXXP---PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PPI P PPP P +PP P PP P P P Sbjct: 194 PPPIPPIDPPRTQPPPIPPIDPPRTQP--PPIFPQPTTP 230 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 +SP P QPPP P P PPP PP Sbjct: 158 ISPIDPPRTQPPPIFPIDPPRTQPPPIPP 186 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P + P P QPPP P P PPP PP Sbjct: 181 PPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPP 212 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +1 Query: 853 PXPXPPIXXP---PPPXPXXNPPXPXPXXPPPXPPP 951 P P PI P PPP P +PP P PP PP Sbjct: 168 PPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPP 203 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P + P P QPPP P P PPP PP Sbjct: 168 PPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPP 199 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPX---PXXNPPXPXPXXPPPXPPPXXP 960 P P PPI PP P P P PPP PP P Sbjct: 150 PAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPP 190 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 +P P P PPP +PP P PP PP Sbjct: 155 LPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPP 190 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G GG G GGG GG G G Sbjct: 205 GGYGGGRGGGGYGGGRGG-GGGYGGGRRDYGGGSKGGG 241 Score = 37.9 bits (84), Expect = 0.012 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXG-GGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G GGG GG G G GG GGG Sbjct: 186 GSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGG 229 Score = 36.3 bits (80), Expect = 0.037 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXG 866 GG GG G GG GGGG G G GG G Sbjct: 197 GGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGG 228 Score = 35.1 bits (77), Expect = 0.086 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGG-XGGXGDXGXXXGGXXXGGG 832 GGG G G GG GGGG GG G G GG GG Sbjct: 195 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGG 235 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGG---GGXGGXGDXGXXXGGXXXGGG 832 GGG G GG GG GG GG G GG GGG Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGG 225 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GG GGG G G GG G GG G G G Sbjct: 185 GGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGG 219 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGG--GGXXXGGXGXGXG 846 G GGG GGG G G+ G GG GG GG G G G Sbjct: 443 GGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDG 482 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 GGG GGG G G G G GG GG G G Sbjct: 452 GGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 933 GXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G GG GGGG G GD G GGG Sbjct: 439 GDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGG 472 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXG 899 GG GGG G GG GGG G Sbjct: 463 GGDGGGDGGGDGGGDGGGDGG 483 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPP 949 PP P PP PPPP TP P P P P Sbjct: 97 PPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXP-PPXPPPXXP 960 P PP PPP P PP P P P P P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P PPPP PP P P P P P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTP 124 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P P PP P P P P P PP Sbjct: 96 PPPATP--PPPTMPPTPPPPQTPAPPGPDTPAPP 127 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P P P P P PP P P P P P G P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAP--PAPGGCGAKP 136 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXP-PXXPXXXPPPXP 959 P P PP P PPP P P P PP P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPX-PKXPXPXXPPPXSXGG 681 P PA P P PP P P P P P + GG Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAPGG 131 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P A P PP P P PP APP Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPP 127 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 37.9 bits (84), Expect = 0.012 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 883 PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP P P PPP PPP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 36.3 bits (80), Expect = 0.037 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PPPP PP P P PPP PPP Sbjct: 860 PRPRPRRPPPP-----PPPPPPPPPPPPPPP 885 Score = 36.3 bits (80), Expect = 0.037 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXP 925 P P P PP PPPP PP P P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPP 883 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P PPPP PP P PPP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXP 924 P P P P PPPP P PP P P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 583 PAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPLG 693 P P P P P PP P P P PPP S G G Sbjct: 860 PRPRPRRPPPPPPPPPPP--PPPPPPPPASSTGSTPG 894 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +2 Query: 587 RPTPXAXTLPXQXPPXPXPXXPXRPPP-XPXGAPPXG 694 RP P P PP P P P PPP G+ P G Sbjct: 859 RPRPRPRRPPPPPPPPPPPPPPPPPPPASSTGSTPGG 895 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXP 925 PP P P PP PPPP + P Sbjct: 869 PPPPPPPPPPPPPPPPPASSTGSTP 893 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNP---PXPXPXXPPPXPPPXXP 960 P P P P P P P NP P P P P P P Sbjct: 487 PSPNPSPNPSSDPSPNPSSNPSSDPSPNPSSNPSSEPSPNP 527 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNP---PXPXPXXPPPXPPPXXP 960 P P P P P P P NP P P P P P P Sbjct: 475 PRPHPSPHPSSNPSPNPSPNPSSDPSPNPSSNPSSDPSPNP 515 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G GGG G G G GG GGG GG G GG GG Sbjct: 101 GRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 35.9 bits (79), Expect = 0.049 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G GG G GG GG G G GG GGG Sbjct: 92 GGGGRRERGGRGGGG--GYGGGGGYGGGGRSYGGGGGGGG 129 Score = 35.9 bits (79), Expect = 0.049 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGG 881 GG GGG G GG GGGG G GG Sbjct: 100 GGRGGGGGYGGGGGYGGGGRSYGGGGG 126 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -1 Query: 959 GXXGGGXG-GGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG G GG G G GG G GGGG G G Sbjct: 100 GGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGG 138 Score = 28.3 bits (60), Expect = 9.8 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGG-GXGGXGDXGXXXGGXXXGGG 832 GG G G GG GGG GG G G GGG Sbjct: 100 GGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGG 139 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +1 Query: 853 PXPXPPIXXPPP-PXPXXNPPXPXPXXPPPXPP 948 P P PP PPP P N P P P PPP P Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLPAGPPPDEP 543 Score = 34.3 bits (75), Expect = 0.15 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 884 PXPPPPXTPPXPXPXXPXXXPPP 952 P PPPP +PP P P PPP Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPP 533 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXP 959 SPP P PPPP P PPP P Sbjct: 510 SPPPPPPASPPPPL-PAEEDNSPPPLP 535 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 1/26 (3%) Frame = +2 Query: 614 PXQXPPXPXPXXPXR-PPPXPXGAPP 688 P PP P P PPP P G PP Sbjct: 515 PPASPPPPLPAEEDNSPPPLPAGPPP 540 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXP-PIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P+ PPPP P PP PPP PPP Sbjct: 359 PPPGRAPQPLGGPPPPPPGRRPPS-GKINPPPPPPP 393 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 6/42 (14%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXP------PPXPPPXXP 960 P P PP+ PPP P P P P PP PP P Sbjct: 308 PAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKP 349 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 881 PPXPPPPXTPPXPXPXXPXXXPPP 952 PP PPPP PP P PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 32.7 bits (71), Expect = 0.46 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ PPP P PP PPP PP P Sbjct: 329 PLPPPPLRGQIAPPPPPISKPPTSTRSAPPP-PPGRAP 365 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 6/40 (15%) Frame = +1 Query: 859 PXPPIXXPP------PPXPXXNPPXPXPXXPPPXPPPXXP 960 P PPI PP PP P P P PPP PP P Sbjct: 342 PPPPISKPPTSTRSAPPPPPGRAPQPL-GGPPPPPPGRRP 380 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P PP PPPP + P P P PP Sbjct: 263 PPPPKNAPPPPKRGSSNPPPPPTRGPP 289 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PPPP PP P P PPP Sbjct: 299 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPP 333 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P PPPP P PPP PP Sbjct: 342 PPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPP 376 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXPP 950 + PP P PPPP P P PP Sbjct: 1 MPPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P P PPP P PPP PP Sbjct: 358 PPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 392 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P PP PP PPP PP Sbjct: 367 PLGGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXGXXGG 881 G GGG G G GGGG G GG Sbjct: 76 GGGGGFSGGGGGSMGGGGLGGLFAGG 101 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPP--XPXXNPPXPXPXXPPPXP 945 P P P P PPPP P P P PP P Sbjct: 239 PLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPP 273 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +1 Query: 859 PXPPIXXPP----PPXPXXNPPXPXPXXPPPXPPP 951 P PP+ P PP P PP P P PPP Sbjct: 250 PPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPP 284 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXP 924 P P PP PPPP P P P Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPP PP PP PP P Sbjct: 251 PPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGP 288 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPP 949 PP P P PPPP P P PP Sbjct: 318 PPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPP 350 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP +P PP P P P P PPP Sbjct: 310 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPP 343 Score = 28.3 bits (60), Expect = 9.8 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 9/42 (21%) Frame = +1 Query: 853 PXPXPP----IXXPPPPXPXXNPPXPXPXXPPP-----XPPP 951 P P PP + PPPP P P P PP PPP Sbjct: 318 PPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPP 359 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXP-PIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P+ PPPP P PP PPP PPP Sbjct: 271 PPPGRAPQPLGGPPPPPPGRRPPS-GKINPPPPPPP 305 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 6/42 (14%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXP------PPXPPPXXP 960 P P PP+ PPP P P P P PP PP P Sbjct: 220 PAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKP 261 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +1 Query: 853 PXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXP 945 P P PP+ PPP P PP PPP P Sbjct: 241 PLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPP 273 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 6/40 (15%) Frame = +1 Query: 859 PXPPIXXPP------PPXPXXNPPXPXPXXPPPXPPPXXP 960 P PPI PP PP P P P PPP PP P Sbjct: 254 PPPPISKPPTSTRSAPPPPPGRAPQPL-GGPPPPPPGRRP 292 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P PP PPPP + P P P PP Sbjct: 175 PPPPKNAPPPPKRGSSNPPPPPTRGPP 201 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PPPP PP P P PPP Sbjct: 211 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPP 245 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P PPPP P PPP PP Sbjct: 254 PPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPP 288 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P P PPP P PPP PP Sbjct: 270 PPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 304 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P PP PP PPP PP Sbjct: 279 PLGGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPP--XPXXNPPXPXPXXPPPXP 945 P P P P PPPP P P P PP P Sbjct: 151 PLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPP 185 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +1 Query: 859 PXPPIXXPP----PPXPXXNPPXPXPXXPPPXPPP 951 P PP+ P PP P PP P P PPP Sbjct: 162 PPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPP 196 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPP PP PP PP P Sbjct: 163 PPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGP 200 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPP 949 PP P P PPPP P P PP Sbjct: 230 PPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPP 262 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP +P PP P P P P PPP Sbjct: 222 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPP 255 Score = 28.3 bits (60), Expect = 9.8 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 9/42 (21%) Frame = +1 Query: 853 PXPXPP----IXXPPPPXPXXNPPXPXPXXPPP-----XPPP 951 P P PP + PPPP P P P PP PPP Sbjct: 230 PPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPP 271 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 37.5 bits (83), Expect = 0.016 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GGG G G GV GG GG G G G GGGA Sbjct: 294 GATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGA 337 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G GG G GGG GG G G Sbjct: 248 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 285 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G GG G GGG GG G G Sbjct: 255 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 292 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G GG G GGG GG G G Sbjct: 262 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 299 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G GG G GGG GG G G Sbjct: 269 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 306 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G GG G GGG GG G G Sbjct: 276 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVG 313 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G GG G GGG GG G G Sbjct: 283 GGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGG 320 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G GG G GGG GG G G Sbjct: 290 GGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGG 327 Score = 36.7 bits (81), Expect = 0.028 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G GGGG G G GG GGG Sbjct: 245 GATGGGG--GATGGGGGATGGGGGATGGGGGATGGGGGATGGG 285 Score = 36.7 bits (81), Expect = 0.028 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G GGGG G G GG GGG Sbjct: 252 GATGGGG--GATGGGGGATGGGGGATGGGGGATGGGGGATGGG 292 Score = 36.7 bits (81), Expect = 0.028 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G GGGG G G GG GGG Sbjct: 259 GATGGGG--GATGGGGGATGGGGGATGGGGGATGGGGGATGGG 299 Score = 36.7 bits (81), Expect = 0.028 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G GGGG G G GG GGG Sbjct: 266 GATGGGG--GATGGGGGATGGGGGATGGGGGATGGGGGATGGG 306 Score = 36.7 bits (81), Expect = 0.028 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G GGGG G G GG GGG Sbjct: 280 GATGGGG--GATGGGGGATGGGGGATGGGGGATGVGGGATGGG 320 Score = 36.7 bits (81), Expect = 0.028 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G GGGG G G GG GGG Sbjct: 287 GATGGGG--GATGGGGGATGGGGGATGVGGGATGGGGGATGGG 327 Score = 35.9 bits (79), Expect = 0.049 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 6/50 (12%) Frame = -3 Query: 960 GXXGGGXXXGXXGX---GXGGVXGGGG---XGGXGDXGXXXGGXXXGGGA 829 G GGG G G G GG GGGG GG G G G GGGA Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGA 288 Score = 35.9 bits (79), Expect = 0.049 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGX--GGXGDXGXXXGGXXXGGGA 829 G GGG G G G G GGGG GG G G G GGGA Sbjct: 273 GATGGGG--GATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGA 316 Score = 35.9 bits (79), Expect = 0.049 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G GGGG G G GG GGG Sbjct: 301 GATGGGG--GATGVGGGATGGGGGATGGGVGATGGGGGATGGG 341 Score = 35.9 bits (79), Expect = 0.049 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G GG G GGG GG G G Sbjct: 318 GGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGG 355 Score = 35.5 bits (78), Expect = 0.065 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GG GGG G GG G GGG GG G G Sbjct: 244 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 278 Score = 35.5 bits (78), Expect = 0.065 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G GGGG G G GG GGG Sbjct: 315 GATGGGG--GATGGGVGATGGGGGATGGGGGVTGGGGGATGGG 355 Score = 35.1 bits (77), Expect = 0.086 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 5/46 (10%) Frame = -3 Query: 951 GGGXXXGXXGX--GXGGVXGGGG---XGGXGDXGXXXGGXXXGGGA 829 GGG G G G GG GGGG GG G G G GGGA Sbjct: 250 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGA 295 Score = 35.1 bits (77), Expect = 0.086 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 5/46 (10%) Frame = -3 Query: 951 GGGXXXGXXGX--GXGGVXGGGG---XGGXGDXGXXXGGXXXGGGA 829 GGG G G G GG GGGG GG G G G GGGA Sbjct: 257 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGA 302 Score = 35.1 bits (77), Expect = 0.086 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 5/46 (10%) Frame = -3 Query: 951 GGGXXXGXXGX--GXGGVXGGGG---XGGXGDXGXXXGGXXXGGGA 829 GGG G G G GG GGGG GG G G G GGGA Sbjct: 264 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGA 309 Score = 35.1 bits (77), Expect = 0.086 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 5/46 (10%) Frame = -3 Query: 951 GGGXXXGXXGX--GXGGVXGGGG---XGGXGDXGXXXGGXXXGGGA 829 GGG G G G GG GGGG GG G G G GGGA Sbjct: 278 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGA 323 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG GG G GG+ GGGG GG G G Sbjct: 313 GGGATGGGGGATGGGVGATGGGGGATGGGGGVTGG 347 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G GGGG G G GG GG Sbjct: 322 GATGGGV--GATGGGGGATGGGGGVTGGGGGATGGGGGPGSGG 362 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG G G GG GGGG GG G G Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATG 276 Score = 33.5 bits (73), Expect = 0.26 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXG-GGGXGGXGDXGXXXGGXXXGGGA 829 GGG G G GGV GGG G G G GG GGGA Sbjct: 313 GGGATGGGGGATGGGVGATGGGGGATGGGGGVTGG---GGGA 351 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G GG GGG G GG G GGGG GG G Sbjct: 332 GGGGGATGGGGGVTGGGGGATG-GGGGPGSGGCG 364 Score = 31.9 bits (69), Expect = 0.80 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G GGG G G GGV GGGG G G GG G Sbjct: 329 GATGGG---GGATGGGGGVTGGGGGATGGGGGPGSGGCGEDG 367 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 951 GGGXXXGXXGX---GXGGVXGGG-GXGGXGDXGXXXGGXXXGGG 832 GGG G G G GG GGG G G G GG GGG Sbjct: 305 GGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGG 348 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G GG GGG G G G GG GGG Sbjct: 318 GGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGG---GGG 357 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GGG G G G GG G GG G+ G G G+ Sbjct: 336 GATGGGGGVTGGGGGATGGGGGPGSGGCGEDGTENVSLEFGSGS 379 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 37.1 bits (82), Expect = 0.021 Identities = 19/41 (46%), Positives = 20/41 (48%), Gaps = 5/41 (12%) Frame = +1 Query: 844 VPXPXPXPPIXXP-PPPXPXXN----PPXPXPXXPPPXPPP 951 VP P P P P PPP P + PP P PPP PPP Sbjct: 919 VPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPP 959 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXPPPP--XPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PPP PP P PPP PPP P Sbjct: 954 PPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPP 991 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP P P P P PPP PPP Sbjct: 964 PPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP +P PP PP P P P PPP P Sbjct: 923 PPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPP 959 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PPPP P + P P PP PPP Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPP 977 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP P P PP PPP Sbjct: 942 PSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPP 976 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P G P P P P P P P P PPP Sbjct: 957 PPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 553 PRPSG-LXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P G P P P P P PP P P PPP Sbjct: 946 PPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPP 984 Score = 31.9 bits (69), Expect = 0.80 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPP----PXSXGGXP 687 P P G P P P P P+ PP P P PP P GG P Sbjct: 924 PPPGGNAPLPPPP-PGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAP 971 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXG 678 P S P AP P P P + PP P P P PP G Sbjct: 959 PGGSAPPPGGGAP-PLPPPPGGSAPPPPPPPPPPPPPMRKLG 999 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P P P PPP PP P P PPP Sbjct: 964 PPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 5/39 (12%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPP-----PXTPPXPXPXXPXXXPPP 952 P P PP PPP P PP P P PPP Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPP 948 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +3 Query: 858 PXXPXXLSPPXX----PXPQPPPPXPPXXPXXXPPPXPP 962 P P +PP P P PP P P PPP PP Sbjct: 956 PPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXP---XXPPPXPPP 951 P P PPPP P N P P P P PPP Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPP 947 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 SPP P PPPP P PPP Sbjct: 913 SPPGGSVPPPPPPPGGNAPLPPPPP 937 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPPXG 694 P P + P Q PP P PPP PP G Sbjct: 934 PPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGG 968 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP +P P PP PP P PPP P Sbjct: 956 PPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = +1 Query: 553 PRPSGLXPXXPAPX-----PXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P G P P P P P P + PP P P PPP P Sbjct: 935 PPPGGSAPSQPPPPGGNAPPPPPPPGGSAPP-PGGGAPPLPPPPGGSAPP 983 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PPP P P P PP P P Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQP 945 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P P PPPP P P P PP Sbjct: 933 PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPP 965 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPP 949 PP +P P PP PP P P PP Sbjct: 934 PPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPP 966 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 2/45 (4%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAX--PPXPKXPXPXXPPPXSXGGXP 687 PS P P P P A PP P P PPP P Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPP 954 Score = 28.3 bits (60), Expect = 9.8 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXP---XXPPP--XPPPXXP 960 +P P P PPP PP P P PPP PP P Sbjct: 932 LPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPP 975 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 37.1 bits (82), Expect = 0.021 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 GG G G G GG GGGG GG G GG GG+ Sbjct: 757 GGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGS 797 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G G GGG GG G G GG GGG Sbjct: 749 GGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGG 791 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGG 850 GGG G G G GG GGGG GG G G G Sbjct: 768 GGGGYRGGGGYG-GGHRGGGGYGGGGHRGGSYSG 800 Score = 32.3 bits (70), Expect = 0.60 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GGG G G G GG GGG Sbjct: 735 GGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGG 777 Score = 32.3 bits (70), Expect = 0.60 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -1 Query: 950 GGGXGGGXXGX-GXGGLXXGX-GGGGXXXGGXGXG 852 GGG GGG G G GG G GGGG GG G Sbjct: 762 GGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGG 796 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 GGG G G GG GGG GG G G G G Sbjct: 762 GGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSG 800 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXG 866 GG GGG G GG GGG G G GG G Sbjct: 766 GGGGGGYRGG--GGYGGGHRGGGGYGGGGHRG 795 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -2 Query: 961 GGXGGGXXXGXXGG-XGGGGXGXGXXGGXRXXG 866 G GGG G GG GGGG G G GG G Sbjct: 758 GYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGG 790 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 G GG GGG G G G G GGGG G G+ Sbjct: 767 GGGGGYRGGGGYGGGHRG-GGGYGGGGHRGGSYSGYRGS 804 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GG GGG G GG G GGG GG G Sbjct: 762 GGGYGGGGGGY--RGGGGYGGGHRGGGGYGGGGHRG 795 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PPP P P P PPP PPP Sbjct: 301 PPPPPPTDFAPPPPP----PEPTSELPPPPPPP 329 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 PP P PPP PP PPP PP Sbjct: 302 PPPPPTDFAPPPPPPEPTSELPPPPPP 328 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 PP PPPP P PPP PP Sbjct: 303 PPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXP 934 PP P PP PPP T P P P Sbjct: 301 PPPPPPTDFAPPPPPPEPTSELPPPPPP 328 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPP--XPXPXXPPPXPPP 951 P P PPPP P N P PP PPP Sbjct: 270 PIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPP 306 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 562 SGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 SG P P P P P PP P P PPP Sbjct: 297 SGFQPPPPPPTDFAPPP---PPPEPTSELPPPPPP 328 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPP 901 PP P S PP PPPP Sbjct: 313 PPPPEPTSELPPPPPPP 329 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 36.7 bits (81), Expect = 0.028 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P PP P P P P PP P P P Sbjct: 177 PKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETP 212 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P PP PP P P P P P P P P Sbjct: 262 PPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIP 297 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 4/40 (10%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXP----XPXXPXXXPPPXXP 961 P P P PP P P TPP P P P P P P Sbjct: 188 PPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHP 227 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP P P P P PP P P P Sbjct: 316 PAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIP 351 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P SP P PP P P P P P P P Sbjct: 259 PFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNP 294 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPP-XPXPXXPXXXPPPXXP 961 P P +P PP P P PP P P P P P P Sbjct: 243 PNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIP 280 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P PP P P P P P P P P Sbjct: 186 PTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIP 221 Score = 32.3 bits (70), Expect = 0.60 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP----PPXXP 960 +P P P I P PP P P P P PP P PP P Sbjct: 323 IPTAPPNPSIP-PAPPNPSIPPAPPNPSIPPAPPNLFIPPATP 364 Score = 31.9 bits (69), Expect = 0.80 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P P P P P TPP P P P PP P Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAP-PSPPIPTAPPTPP 207 Score = 31.9 bits (69), Expect = 0.80 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 +P P P I P PP P P P PP P P P Sbjct: 305 IPSAPPNPHIP-PAPPNPYIPTAPPNPSIPPAPPNPSIP 342 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP P P P P PP P P P Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAP 203 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 5/41 (12%) Frame = +1 Query: 853 PXPXPPIXXPPPPXP-----XXNPPXPXPXXPPPXPPPXXP 960 P P P P PP P NPP P PP P P P Sbjct: 222 PAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIP 262 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/36 (38%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 844 VPXPXPXPPIXXPP-PPXPXXNPPXPXPXXPPPXPP 948 +P P PP+ P PP PP P PP PP Sbjct: 199 IPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPP 234 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 872 SPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 +P PP P P P P P P P P P Sbjct: 242 TPNPPMPETPLPPATPNPFIPPASPNPSIP 271 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P I PP P +PP P PP P P Sbjct: 177 PKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLP 214 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP--PPXXP 960 +P P P I PP PP P PP P PP P Sbjct: 261 IPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPP 301 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPP-XPXPXXPXXXPPPXXP 961 P P P P P PP +P P P P P P P Sbjct: 200 PTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNP 236 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP--PP 951 +P P P PP P PP P PP P PP Sbjct: 185 IPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPP 222 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P P P P PP P PP PP Sbjct: 312 PHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPP 346 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P P P P PP P PP PP Sbjct: 321 PYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPP 355 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +1 Query: 556 RPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPLG 693 +P P PAP P PP P P PP P G Sbjct: 171 KPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPG 216 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP+ P P NP P P P P PP P Sbjct: 243 PNPPMPETPLPPATPNPFIP-PASPNPSIPPAPP 275 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPP--PPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP P PP P P P P P P P P Sbjct: 294 PYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIP 333 Score = 28.3 bits (60), Expect = 9.8 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +1 Query: 553 PRPSGLX--PXXPAPXPXXPXP-AXAXPPXPKXPXPXXPP 663 P PS + P PAP P P P A PP P+ P P P Sbjct: 180 PAPSTIPTPPTPPAP-PSPPIPTAPPTPPMPETPLPPGSP 218 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXP-PIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P P P P P P P P P P P P Sbjct: 251 PLPPATPNPFIPPASPNPSIPPAPPNPSIPAP-PNPSIP 288 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG G G G G GG G GGG G G G G Sbjct: 308 GGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDG 342 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG GGG G G GG G G G G G G G Sbjct: 310 GGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDG 344 Score = 36.3 bits (80), Expect = 0.037 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G GGG G GG G GGGG GG G G G Sbjct: 304 GDGDGGGGGDGGGGG--GGGGGGGGDGGGDGDGDG 336 Score = 35.5 bits (78), Expect = 0.065 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G G G G G G G G G Sbjct: 311 GGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDG 348 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG GGG G GG G G G G G G G Sbjct: 316 GGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDG 350 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXG-GXGDXGXXXGGXXXGGG 832 GGG G G G GG GGG G G GD G G G Sbjct: 310 GGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDG 350 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGG 881 G GGG G GG GGGG G G G Sbjct: 306 GDGGGGGDGGGGGGGGGGGGGDGGGDG 332 Score = 32.7 bits (71), Expect = 0.46 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G G G G G G G G Sbjct: 315 GGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDG 352 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 918 GXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G GGGG G G G GG GGG Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGG 330 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXG-GGGXGXGXXGG 881 GG GGG G GG G GGG G G G Sbjct: 311 GGDGGGGGGGGGGGGGDGGGDGDGDGDG 338 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 36.7 bits (81), Expect = 0.028 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXGXXGGXRXXG 866 G GGG G GG GGGG G G GG G Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 Score = 35.1 bits (77), Expect = 0.086 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G G GGG G G GG G GGGG GG G Sbjct: 338 GSGRGGGGGGGGGGG---GGGGGGGRGGGGG 365 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 GGG GGG G G GG GGGG G G Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 918 GXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G GGGG GG G G GG GGG Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGG 879 G GG GGG G G GG G GGGG Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGG 364 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G G G GGG G G GG G GGG G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXG 874 G GGG G G G GG GGGG G Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GG G G G GG G G G G G S GRG Sbjct: 337 GGSGRGGGGGGGGGGGGGGGG--GGRGGGGGFSSRGRG 372 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -3 Query: 693 PXGGAPXGXGGGRXGXXGLGXGGXCXG 613 P GG+ G GGG G G G GG G Sbjct: 335 PRGGSGRGGGGGGGGGGGGGGGGGGRG 361 >SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.7 bits (81), Expect = 0.028 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGG-XGDXGXXXGGXXXGG 835 GGG G G G GG GGG G GD G GG GG Sbjct: 6 GGGDGDGGDGDGGGGGDGGGDGGDCDGDGGDCDGGDDDGG 45 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 36.7 bits (81), Expect = 0.028 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPP--PPXPXXNPPXPXPXXPPPXPPP 951 P P P P+ PP PP P P P PPP P P Sbjct: 856 PPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRP 892 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 36.7 bits (81), Expect = 0.028 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G GG GGG GG G+ G GG GG Sbjct: 144 GGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGG 186 Score = 32.7 bits (71), Expect = 0.46 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G GG GG GG G G GG GGG Sbjct: 143 GGGYRGGYRGGYRGGYRGGRDRGG-GYGGGGEGGYGMGGG 181 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXG-GXGDXGXXXGGXXXGGG 832 G GGG G G G G GG G G G G GG GGG Sbjct: 166 GGYGGG-GEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGG 208 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGG--XGGXGDXGXXXGGXXXGGG 832 GGG G G G G GGGG GG G G G GGG Sbjct: 179 GGGDYSG--GCGYGSSYGGGGDYGGGPGYGGGQGYGSYSGGG 218 Score = 29.5 bits (63), Expect = 4.2 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 9/44 (20%) Frame = -1 Query: 950 GGGXGGGXXG---------XGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG GGG G G G GGGG GG G G G Sbjct: 165 GGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGG 208 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 36.3 bits (80), Expect = 0.037 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G GG G G G G G G Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGG 79 Score = 36.3 bits (80), Expect = 0.037 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXG---GLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G G GGGG GG G G G Sbjct: 49 GGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDG 89 Score = 35.5 bits (78), Expect = 0.065 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG G G G + GG GGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGG 83 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG G G G GGGG G G G G Sbjct: 54 GGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P L P P PPPP PP PPP P Sbjct: 698 PPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSP 732 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P PPP P P PPP PPP Sbjct: 714 PPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 35.9 bits (79), Expect = 0.049 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P PP PPPP P + P P PPP PP Sbjct: 694 PPPP---PPPPPPLLSGTLPMPPPPPPPPP 720 Score = 35.1 bits (77), Expect = 0.086 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 5/41 (12%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXX-----PPPXPPP 951 +P P P PP PPP PP P P PPP PPP Sbjct: 709 LPMPPPPPP---PPPGCAGLPPPPPSPQPGCAGLPPPPPPP 746 Score = 35.1 bits (77), Expect = 0.086 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 5/39 (12%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXP-----PPXPPPXXP 960 P PP PPPP PP P P PP PPP P Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 35.1 bits (77), Expect = 0.086 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 5/37 (13%) Frame = +2 Query: 866 PXSPXPPXPPP-----PXTPPXPXPXXPXXXPPPXXP 961 P P PP PPP P PP P P PPP P Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPP 746 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP PP P P PPP PPP Sbjct: 713 PPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPP 747 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P P P PPPP PP PPP P Sbjct: 726 PPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 7/52 (13%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKX-------PXPXXPPPXSXGGXP 687 P SG P P P P P A PP P P P PPP G P Sbjct: 703 PLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLP 754 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 7/34 (20%) Frame = +3 Query: 882 PPXXPXPQP-------PPPXPPXXPXXXPPPXPP 962 PP P PQP PPP PP PPP PP Sbjct: 726 PPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 LS P P P PPP P PPP PP Sbjct: 691 LSVPPPPPPPPPPLLSGTLPMPPPPPPPP 719 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P PPP P PP PPP PP P Sbjct: 728 PPPSPQPGCAGLPPPPPP--PPPGCAGLPPPPPPIDVP 763 Score = 33.1 bits (72), Expect = 0.35 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 7/43 (16%) Frame = +1 Query: 844 VPXPXPXPP-------IXXPPPPXPXXNPPXPXPXXPPPXPPP 951 VP P P PP + PPPP P PP PPP P P Sbjct: 693 VPPPPPPPPPPLLSGTLPMPPPPPP---PPPGCAGLPPPPPSP 732 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +1 Query: 847 PXPXPXPPIXX-----PPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P I PPPP P P PP PPP P Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPP 720 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P PP PPPP P PPP PP Sbjct: 714 PPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPP 745 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 871 IXXPPPPXPXXNPPXPXPXXPPPXPPP 951 + PPPP P PPP PPP Sbjct: 676 VPPPPPPLPVIEGSSLSVPPPPPPPPP 702 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = +1 Query: 847 PXPXPX----PPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P P PP PPPP PP P P P P Sbjct: 730 PSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKP 766 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXP--PPXPP 962 P P PP P PP PP P PP PP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPP 730 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P PP PPPP P PP PP Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPP 744 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 36.3 bits (80), Expect = 0.037 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP+ PP P P P P PP PP P Sbjct: 131 PPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAP 164 Score = 35.5 bits (78), Expect = 0.065 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PPPP TP P P P PP P Sbjct: 131 PPPPVTPPPGPETPPPPDTPAPPVP--PTEAPPTAPP 165 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PP PPP PP P PP PP Sbjct: 132 PPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PPP P PP P PP P P P Sbjct: 123 PPPPTGTLPPP-PVTPPPGPETPPPPDTPAPPVP 155 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPP 663 P P+G P P P P P PP P P P PP Sbjct: 124 PPPTGTLP----PPPVTPPPGPETPPPPDTPAPPVPP 156 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P TLP PP P P PPP APP Sbjct: 123 PPPPTGTLPP--PPVTPPPGPETPPPPDTPAPP 153 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P PP PPP P P P PP Sbjct: 123 PPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPP 156 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P PP P PP P P P PP PP Sbjct: 123 PPPPTGTLPPP-PVTPPPGPETPPPPDTPAPPVPP 156 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 36.3 bits (80), Expect = 0.037 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGG--XGDXGXXXGGXXXGG 835 G GGG G G G GG+ GGG GG G GG GG Sbjct: 142 GGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGG 185 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGX--GGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG+ GGG GG G G GG G G Sbjct: 192 GGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGMEDGGKEGGMG 236 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/43 (44%), Positives = 20/43 (46%), Gaps = 5/43 (11%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXG-----GGGXXXGGXGXGXG 846 G GGG GGG G GG+ G GGG GG G G G Sbjct: 180 GGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMG 222 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGG--GGXXXGGXGXG 852 GG GGG GG+ G GG GG GG G G Sbjct: 163 GGSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMGGG 197 Score = 31.9 bits (69), Expect = 0.80 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGG 864 GGG GGG G GG G GGG GG Sbjct: 141 GGGMGGGMSMGGMGGGMGGMMGGGSMGGG 169 Score = 31.9 bits (69), Expect = 0.80 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GG G GG GGG GG G G G Sbjct: 151 GGMGGGMGGMMGGGSMGGGMMSMAGGG-MGGGMGGGMG 187 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGG--GGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG+ GG G G G G G GGG Sbjct: 176 GGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGG 220 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGG----GGXGXGXXGGXRXXGXXG 857 GG GGG G GG GG G G G GG G G Sbjct: 180 GGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMG 218 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 GG GG G G GG G GGG G G G Sbjct: 175 GGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMG 206 Score = 28.3 bits (60), Expect = 9.8 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G GG GGG GG G G GG GGG Sbjct: 159 GMMGGGSMGGGMMSMAGGGMGGGMGGGMG--GGMEGG--MGGG 197 Score = 28.3 bits (60), Expect = 9.8 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = -1 Query: 959 GXXGGGXGG--GXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GG G G GG G GGG G G Sbjct: 211 GMMGGGMGGGMGFNGMEDGGKEGGMGGGMLQMGDSNGG 248 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P +P PP P P T P P P PPP P Sbjct: 335 PSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPP 371 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP P P PP P P PPP PPP Sbjct: 343 PQPPTPTTPKTHPQLGPPPPPP-PPPPTPPP 372 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +2 Query: 590 PTPXAX-TLPXQXPPXPXPXXPXRPPP 667 PTP T P PP P P P PPP Sbjct: 346 PTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P S P P P TP P PPP P Sbjct: 330 PPSDSP-STTTPTTPQPPTPTTPKTHPQLGPPPPPPP 365 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/30 (36%), Positives = 11/30 (36%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPP 663 P P P P PP P P P PP Sbjct: 343 PQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P L+PP P PPP P PPP PP Sbjct: 181 PAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +1 Query: 853 PXPXPPIXXPPPPXP--XXNPP--XPXPXXPPPXPPP 951 P P PP PPP P PP P PPP PP Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +1 Query: 865 PPIXXPPPPXP--XXNPPXPXPXXPPPXPPP 951 P I PPP P PP P PPP PP Sbjct: 174 PGILAPPPAPPGVLAPPPAPPGVLPPPPAPP 204 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 35.9 bits (79), Expect = 0.049 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P PP P PP P PP P P P P P Sbjct: 1358 PRPRPPTP-PRPPTPRPRPPTPRPGPPTPRP 1387 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNP-PXPXPXXPPPXPPPXXP 960 P P P PP P P P P P P P PP P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P +P P PP P PP P P P P P P Sbjct: 1355 PSTPRP-RPPTPPRPPTPRPRPPTPRPGPPTP 1385 Score = 32.3 bits (70), Expect = 0.60 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXP 924 P P PP P PP P PP P P Sbjct: 1362 PPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXPP 949 P +P PP P PP TPP P P P Sbjct: 1575 PITPPPPTPSPPQTPP-PVNTPPRPETP 1601 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 586 APXPXXPXPAXAXPPXPKXPXPXXPPP 666 +P P P P PP P P P P P Sbjct: 1352 SPIPSTPRPRPPTPPRPPTPRPRPPTP 1378 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +2 Query: 851 PPXXXPXSPXPPX-PPPPXTPPXPXPXXP 934 P P +P PP PPP TPP P P Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P+ P P PP Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPP 1383 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXP 959 PP P P P P PP P P P Sbjct: 1362 PPTPPRPPTPRPRPPTPRPGPPTPRP 1387 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 35.9 bits (79), Expect = 0.049 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXG--GGGXGGXGDXGXXXGGXXXGGGA 829 GGG G G GG G GGG G GD G GG GGGA Sbjct: 64 GGGGATGGGGGATGGHGGATGGGGGATGDGGGATGG---GGGA 103 Score = 35.5 bits (78), Expect = 0.065 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGG--XGGXGDXGXXXGGXXXGGGA 829 G GG G G G GGGG GG G G G GGGA Sbjct: 44 GGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGA 89 Score = 35.1 bits (77), Expect = 0.086 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G G G G G G G G G G Sbjct: 51 GGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGG 88 Score = 35.1 bits (77), Expect = 0.086 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GG GGG G GG G GGG GG G Sbjct: 77 GGHGGATGGGGGATGDGGGATGGGGGATGGGGGATG 112 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGG--XGGXGDXGXXXGGXXXGGGA 829 G GG G G G G GGGG G G G G GGGA Sbjct: 51 GGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGA 96 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GG G GG GGGG GG G G Sbjct: 47 GGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATG 84 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GG G GG G GGG GG G G Sbjct: 70 GGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGG 107 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GGGG G G GG GGG Sbjct: 67 GATGGGG--GATGGHGGATGGGGGATGDGGGATGGGGGATGGG 107 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = -3 Query: 960 GXXGGGXXXGXXGX--GXGGVXGG--GGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GG G GG G GG GGG Sbjct: 55 GATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGG 101 Score = 32.7 bits (71), Expect = 0.46 Identities = 32/126 (25%), Positives = 32/126 (25%), Gaps = 2/126 (1%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGAXXXXXXXXXXXXXXXX 781 G G G G GG GGG GG G GG G G Sbjct: 38 GHGGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGAT 97 Query: 780 XXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXGGAPXGXGGGRXGXXGL--GXGGXCXGRV 607 G GGA G GG G G G GG G Sbjct: 98 GGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGG 157 Query: 606 XAXGVG 589 A G G Sbjct: 158 GATGGG 163 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -1 Query: 959 GXXGGGXGG-GXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG G G G GG GGGG GG G G Sbjct: 81 GATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATG 119 Score = 32.3 bits (70), Expect = 0.60 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 G GG GG G GG G GGG GG G T Sbjct: 133 GGHGGATGGHGGATGGGGGATGGGGGATGGGGGATGGVT 171 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G GG GGGG G G GG GG Sbjct: 127 GHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGGGATGG 169 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -3 Query: 960 GXXGG-GXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GG G G G GG GG GG G G G GGGA Sbjct: 123 GATGGHGGATGGHGGATGG-HGGATGGGGGATGGGGGATGGGGGA 166 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GG G G G GGG GG G G Sbjct: 126 GGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGG 163 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = -1 Query: 959 GXXGGGXGGGXXG-XGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G GG G GG GG G G Sbjct: 112 GGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGG 150 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 35.9 bits (79), Expect = 0.049 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PPPP PP P P PPP PPP Sbjct: 93 PACPPACCAPPPP-----PPPPPPPPPPPPPPP 120 Score = 35.9 bits (79), Expect = 0.049 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXP 925 PP P PP PPPP PP P P Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 35.5 bits (78), Expect = 0.065 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P +P P PPP PP P PPP PP Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPP 119 Score = 35.1 bits (77), Expect = 0.086 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 906 PPPPXPPXXPXXXPPPXPP 962 PPPP PP P PPP PP Sbjct: 102 PPPPPPPPPPPPPPPPPPP 120 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 12/50 (24%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXP------------XPXXPPPXPPPXXP 960 P P P PP PPPP P PP P PPP PPP P Sbjct: 102 PPPPPPPPPPPPPPPPP---PPITLHHEQHVVSHVMHPAPPPPPPPPPAP 148 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPP 949 P P P PPP PP P P P PP Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 PT A P P P P PPP P PP Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 583 PAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 PA P P PP P P P PPP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 25.8 bits (54), Expect(2) = 3.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 875 PXPPXPPPPXTPPXP 919 P PP PPPP PP P Sbjct: 136 PAPPPPPPP--PPAP 148 Score = 22.2 bits (45), Expect(2) = 3.9 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +2 Query: 896 PPXTPPXPXPXXPXXXPP 949 PP PP P P P P Sbjct: 168 PPGPPPAPMPAPPPMVVP 185 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 35.5 bits (78), Expect = 0.065 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 PP+ PPPP P PP P P P P Sbjct: 74 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXP 934 PP P P PP PPPP P P P Sbjct: 74 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 889 PXPXXNPPXPXPXXPPPXPPP 951 P P PP P P PPP PPP Sbjct: 73 PPPLCAPPPPPPPPPPPPPPP 93 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P L P P P PPPP PP P P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPP--PGAKKPDDP 101 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPP 913 PP P PP PPPP PP Sbjct: 73 PPPLCAPPPPPPPPPPPPPPP 93 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P PPPP PP P P P Sbjct: 75 PLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 604 PXPAXAXPPXPKXPXPXXPPP 666 P P A PP P P P PPP Sbjct: 73 PPPLCAPPPPPPPPPPPPPPP 93 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P PPPP P PP P P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 35.5 bits (78), Expect = 0.065 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P PP P PP P P P PP P Sbjct: 1254 PPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPP 1287 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P PP PPP P P P P P Sbjct: 1256 PPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGP 1289 Score = 32.7 bits (71), Expect = 0.46 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPP 663 P P G+ P P P P P P PP P P P PP Sbjct: 1254 PPPPGMRPMPPQP-PFMPPPPRMQPPGP--PGPPGPP 1287 Score = 31.9 bits (69), Expect = 0.80 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 8/46 (17%) Frame = +1 Query: 847 PXPXPXPPIXXP-----PPPXPXXNPPXPXPXXPPPXP---PPXXP 960 P P PP P PPP P P P P PP P PP P Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPP 1281 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PP P PP P PP P P Sbjct: 1257 PGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP PP PP P P P P P Sbjct: 1253 PPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGP 1289 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXP-PPXSXGGXP 687 P+ GL P P P P P PP P+ P P PP G P Sbjct: 1247 PKFMGLPPPPPGMRPMPPQPPF-MPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +1 Query: 859 PXPPIXXPP--PPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PP PP PP P P P PP P Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMP 1270 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 909 PPPXPPXXPXXXPPPXPP 962 PPP PP P PP PP Sbjct: 996 PPPAPPSEPAIRLPPLPP 1013 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 35.5 bits (78), Expect = 0.065 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 PP+ PPPP P PP P P P P Sbjct: 275 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXP 934 PP P P PP PPPP P P P Sbjct: 275 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 889 PXPXXNPPXPXPXXPPPXPPP 951 P P PP P P PPP PPP Sbjct: 274 PPPLCAPPPPPPPPPPPPPPP 294 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P L P P P PPPP PP P P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPP--PGAKKPDDP 302 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPP 913 PP P PP PPPP PP Sbjct: 274 PPPLCAPPPPPPPPPPPPPPP 294 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P PPPP PP P P P Sbjct: 276 PLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 604 PXPAXAXPPXPKXPXPXXPPP 666 P P A PP P P P PPP Sbjct: 274 PPPLCAPPPPPPPPPPPPPPP 294 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P PPPP P PP P P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 35.5 bits (78), Expect = 0.065 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +1 Query: 847 PXPXPXPP---IXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PP + PPP P N P P PPP PP Sbjct: 283 PVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPP 319 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP-PPXXP 960 VP P P + PPP P P P PPP P PP P Sbjct: 284 VPPMTPPPAVVTAPPPAPPL-PNFTSPSPPPPPPLPPAMP 322 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +1 Query: 859 PXPPIXXPPP--PXPXXNPPXPXPXXPPPXPPPXXP 960 P PP+ PP P PP P P P PPP P Sbjct: 283 PVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLP 318 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 5/40 (12%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPP-----XPXPXXPPPXPPP 951 P P P PPPP P P P PPP PPP Sbjct: 302 PLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPP 341 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXP 673 P P T P PP P P PPP P Sbjct: 289 PPPAVVTAPPPAPPLPNFTSPSPPPPPP 316 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 5/35 (14%) Frame = +2 Query: 872 SPXPPXPPPP--XTPPXPXPXXP---XXXPPPXXP 961 +P PP PPP T P P P P PPP P Sbjct: 282 APVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPP 316 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P SP PP P PP P P PP P Sbjct: 304 PNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPP 339 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 35.1 bits (77), Expect = 0.086 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGG-GXXXGGXGXGXG 846 G G G GGG GG+ G GGG G GG G G G Sbjct: 282 GGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMGRGPG 320 Score = 31.9 bits (69), Expect = 0.80 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G G GGG G GG+ G GGG G G G G Sbjct: 298 GGMGRGPGGGW-GRMQGGMGRGPGGGWGRMQGGGMGRG 334 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 4/39 (10%) Frame = -1 Query: 950 GGGXG---GGXXGXGXGG-LXXGXGGGGXXXGGXGXGXG 846 GGG G GG G G GG L G GGG G G G G Sbjct: 320 GGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQGGGMGRG 358 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G G G GGG GG+ G GGG G G G Sbjct: 313 GGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWG 348 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXG-GLXXGXGGGGXXXGGXGXG 852 G G G GGG G G G G+ G GGG G G G Sbjct: 258 GGWGQGPGGG-WGRGQGRGMGRGPGGGWGRGSGGGWG 293 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXG-GXGXGXG 846 G G G GGG GG+ G G G G G G G G Sbjct: 337 GGLGRGPGGGWGRMQGGGMGRGPGQGWGCRGMGCGWGCG 375 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 35.1 bits (77), Expect = 0.086 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G GG G G G G G GG GGG Sbjct: 153 GDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGG 195 Score = 35.1 bits (77), Expect = 0.086 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G G GGG GG GD G GG GGG Sbjct: 167 GDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGG---GGG 206 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGG-XGDXGXXXGGXXXGG 835 GGG G G GG GGG GG G G GG GG Sbjct: 176 GGGDDGGDGGDDGGGSGGGGDDGGSDGGGGGNDGGRDDGG 215 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGG 881 GG GGG G G GGG G GG Sbjct: 189 GGSGGGGDDGGSDGGGGGNDGGRDDGG 215 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 35.1 bits (77), Expect = 0.086 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXP-PPPXPXXNPPXPXPXXPP--PXPPPXXP 960 P P PP P PPP PP P PP P PPP P Sbjct: 1036 PSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQP 1076 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 VP P P P P P P P P P P PPP P Sbjct: 1054 VPIPPPRKPSPPPSEPAPPPRQP-PPPSTSQPVPPPRQP 1091 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP P PP +PP P PP PPP Sbjct: 1047 PSP-PPSAVPIPPPRKPSPPPSEPAPPPRQPPP 1078 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPP--PXPPP 951 VP P P P PP +PP P PP P PPP Sbjct: 1014 VPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPP 1051 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPX-----PXXNPPXPXPXXP--PPXPPPXXP 960 P P PP PPPP P P P P P P PPP P Sbjct: 1065 PPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQP 1109 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PPP P P P P PPP P Sbjct: 1035 PPSAQPLPPPRKPSPPPSAVPIPPPRKP--SPPPSEP 1069 Score = 32.3 bits (70), Expect = 0.60 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPP---PXPPPXXP 960 P P PP PP PP P PP P PPP P Sbjct: 1022 PTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKP 1062 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP P P P P P PPP PP Sbjct: 1043 PPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPP 1077 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +1 Query: 553 PRPSGLX---PXXPAPXPXXPXPAXAXPPXPKXPXPXXPP 663 P PS + P P+P P P P PP P P PP Sbjct: 1049 PPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPP 1088 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +1 Query: 844 VPXPX-PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 +P P P PP P PP PP PPP P P Sbjct: 1056 IPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIP 1095 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPP 953 P + PP P P P P PP P PPP Sbjct: 1050 PPSAVPIPPPRKPSPPPSEPAPP--PRQPPPP 1079 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P PP +PP PPP P P Sbjct: 1029 PKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPP 1066 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 556 RPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXS 672 +PS P P P P P PP P P PPP S Sbjct: 1046 KPSPPPSAVPIPPPRKPSP----PPSEPAPPPRQPPPPS 1080 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 583 PAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P P P P P Sbjct: 1084 PVPPPRQPDPIPTNPAHPTEPPPRQPKP 1111 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +1 Query: 859 PXPPIXXPPP-PXPXXNPPXPXPXXPPPXPPP 951 P PP P P P +P P P P P P P Sbjct: 1084 PVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAP 1115 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +1 Query: 553 PRPSGLXPXXPAPXP-XXPXPAXAXP-PXPKXPXPXXPPP 666 PR P PAP P P P+ + P P P+ P P P Sbjct: 1059 PRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNP 1098 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 885 PXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P PPPP PP PPP PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPP 102 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 880 PPPPXPXXNPPXPXPXXPPPXPPP 951 PPPP P N P P P PPP PP Sbjct: 85 PPPPPPASNVPAPPP--PPPVMPP 106 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PPPP P PP PPP PP P Sbjct: 77 PAAVIPPPPPPP--PPASNVPAPPPPPPVMPP 106 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 875 PXPPXPPPPXTPPXPXPXXPXXXP 946 P PP PPP P P P P P Sbjct: 83 PPPPPPPPASNVPAPPPPPPVMPP 106 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 875 PXPPXPPPPXTPPXPXPXXPXXXPP 949 P PP PPPP + P P PP Sbjct: 82 PPPPPPPPPASNVPAPPPPPPVMPP 106 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PP PPPP P P P P P PP Sbjct: 206 PRSGPLPPTAAPPPP-PTTGAPPPTPVTNKPPPP 238 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXN-PPXPXPXXPPPXPPPXXP 960 P PP PPP P N PP P P PP P Sbjct: 218 PPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAP 252 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +2 Query: 875 PXPPX--PPPPXTPPXPXPXXPXXXPPPXXP 961 P PP PPPP T P P PPP P Sbjct: 210 PLPPTAAPPPPPTTGAPPPTPVTNKPPPPRP 240 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/41 (29%), Positives = 15/41 (36%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGG 681 P+ P P P P PP P+ PPP + G Sbjct: 213 PTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAPG 253 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 V P P PP PPPP P PP P P P P Sbjct: 422 VQPPPPPPPAPLPPPPPP---PPQPTTALPDPLQGP 454 Score = 33.5 bits (73), Expect = 0.26 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXP 925 PP P +P PP PPPP P P Sbjct: 424 PPPPPPPAPLPPPPPPPPQPTTALP 448 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 903 QPPPPXPPXXPXXXPPPXPP 962 QPPPP PP P PPP PP Sbjct: 423 QPPPP-PPPAPLPPPPPPPP 441 Score = 32.3 bits (70), Expect = 0.60 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPP 950 PP P P PPPP PP P P Sbjct: 426 PPPPPAPLPPPPPPPPQPTTALP 448 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 900 PQPPPPXPPXXPXXXPPPXP 959 P PPPP P P PPP P Sbjct: 424 PPPPPPPAPLPPPPPPPPQP 443 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 880 PPPPXPXXNPPXPXPXXPPPXPPPXXP 960 PPPP P P P P PPP P P Sbjct: 424 PPPPPPPA--PLPPPPPPPPQPTTALP 448 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXP-PPXPPPXXP 960 VP P PP PP +PP P P PP PP P Sbjct: 214 VPTQAPRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPP 253 Score = 31.9 bits (69), Expect = 0.80 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +1 Query: 847 PXPXPXPPIXXPP-PPXPXXNPPXP--XPXXPPPXPP 948 P PP P PP P NPP P P PP PP Sbjct: 221 PPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPP 257 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXP 918 P P PP+ PP P NPP P Sbjct: 236 PVPPTNPPVPPTNPPAPPTNPPKP 259 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPP 939 PP+ PP P NPP P P P Sbjct: 235 PPVPPTNPPVPPTNPPAPPTNPPKP 259 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P +P P P PP PP P PP PP Sbjct: 227 PPTKAPTDPPVPPTNPPVPPTNP-PAPPTNPP 257 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G GGG G GG G GGGG G G G Sbjct: 41 GAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRG 75 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G GGG GGG G G G G GG GG G Sbjct: 50 GPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGGRG 83 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 G GGG GG GGG G G R G G Sbjct: 43 GRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGG 76 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG GGG GG G GG GGG Sbjct: 333 GDHGGGDPGG--GDPGGGDPGGGDPGGGDPGGGDHGGGDHGGG 373 Score = 31.9 bits (69), Expect = 0.80 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G GG GGG GG G GG GGG Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGG 363 Score = 31.9 bits (69), Expect = 0.80 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G GG GGG GG G GG GGG Sbjct: 328 GDHGDGDHGG--GDPGGGDPGGGDPGGGDPGGGDPGGGDHGGG 368 Score = 31.9 bits (69), Expect = 0.80 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG GGG GG G G GGG Sbjct: 343 GDPGGGDPGG--GDPGGGDPGGGDHGGGDHGGGDHGDGDHGGG 383 Score = 31.9 bits (69), Expect = 0.80 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG GGG GG GG GGG Sbjct: 348 GDPGGGDPGG--GDPGGGDHGGGDHGGGDHGDGDHGGGDHGGG 388 Score = 31.9 bits (69), Expect = 0.80 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG GGG G G GG GGG Sbjct: 353 GDPGGGDPGG--GDHGGGDHGGGDHGDGDHGGGDHGGGDHGGG 393 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PPPP P P P PP P P P Sbjct: 29 PPPPPPYEAPPPP-----PGPPGPDGPPGFPGPQGP 59 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 884 PXPPPPXTPPXPXPXXPXXXPPPXXP 961 P PPPP P P P P PP P Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFP 54 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P L P P P PP PP P PP P Sbjct: 621 PAGLPGPPGPASPPSPPGPPGPPGPKGPPGP 651 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P L P P P PP PP P PP P Sbjct: 706 PPGLPGPPGPASPPSPPGPPGPPGPNGPPGP 736 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P L P P P PP PP P PP P Sbjct: 791 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGP 821 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P L P P P PP PP P PP P Sbjct: 876 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGP 906 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPP-XPXPXXPXXXP-PPXXP 961 PP P PP PP P PP P P P PP P Sbjct: 31 PPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLP 69 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXP--PPXPP 948 P P P+ P PP P P P P PP PP Sbjct: 179 PGPNGPLGPPGPPGDMGPPGLPGPQGPQMPPGPP 212 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PP P P P PP P P P Sbjct: 38 PPPPPGPPGPDGPPGFPGPQGPN-GPKGPPGLPGPPGP 74 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXP-XPXXPXXXPPP 952 P P P PP PP P PP P P P P Sbjct: 630 PASPPSPPGPPGPPGPKGPPGPNGPLGPPGESGP 663 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPP--PPXPPXXPXXXPPPXPP 962 P + PP P P P PP PP P P PP Sbjct: 868 PGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPP 904 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +3 Query: 876 LSPPXXPXPQPP--PPXPPXXPXXXPPPXPP 962 + PP P P P PP PP P P PP Sbjct: 109 MGPPGPPGPPGPQMPPGPPGLPGPPGPAGPP 139 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXP 919 P P P PP PP P PP P Sbjct: 715 PASPPSPPGPPGPPGPNGPPGP 736 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXP 919 P P P PP PP P PP P Sbjct: 800 PASPPSPPGPPGPPGPKGPPGP 821 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXP 919 P P P PP PP P PP P Sbjct: 885 PASPPSPPGPPGPPGPKGPPGP 906 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPP--PPXPPXXPXXXPPPXPP 962 P P PP P PQ P P PP P PP PP Sbjct: 42 PGPPGPDGPPGFPGPQGPNGPKGPPGLPG---PPGPP 75 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P P P PP P P P P P P P P Sbjct: 621 PAGLPGPPGPASPPSP--PGPPGPPGPKGPPGPNGP 654 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P P P PP P P P P P P P P Sbjct: 706 PPGLPGPPGPASPPSP--PGPPGPPGPNGPPGPNGP 739 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P P P PP P P P P P P P P Sbjct: 791 PPGLPGPPGPASPPSP--PGPPGPPGPKGPPGPNGP 824 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPP-IXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP I PP P PP P P P PP P Sbjct: 345 PNGQPGPPGINGPPGPLGDVGPPG-LPGPPGPQMPPGPP 382 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPP-IXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP I PP P PP P P P PP P Sbjct: 430 PNGQPGPPGINGPPGPLGDVGPPG-LPGPPGPQMPPGPP 467 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPP-IXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP I PP P PP P P P PP P Sbjct: 515 PNGQPGPPGINGPPGPLGDVGPPG-LPGPPGPQMPPGPP 552 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +1 Query: 868 PIXXPPPPXPXXNPPXPXPXXPP-PXPPP 951 P P PP P P P P PP P PP Sbjct: 621 PAGLPGPPGPASPPSPPGPPGPPGPKGPP 649 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 595 PXXPXPAXAXPPXPKXPXPXXPP 663 P P P A PP P P P PP Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPP 51 Score = 28.3 bits (60), Expect = 9.8 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPK-XPXPXXP--PPXSXG 678 P+GL P P P P PP PK P P P PP G Sbjct: 621 PAGL-PGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPPGESG 662 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +1 Query: 868 PIXXPPPPXPXXNPPXPXPXXPP-PXPPP 951 P P PP P P P P PP P PP Sbjct: 706 PPGLPGPPGPASPPSPPGPPGPPGPNGPP 734 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +1 Query: 868 PIXXPPPPXPXXNPPXPXPXXPP-PXPPP 951 P P PP P P P P PP P PP Sbjct: 791 PPGLPGPPGPASPPSPPGPPGPPGPKGPP 819 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +1 Query: 868 PIXXPPPPXPXXNPPXPXPXXPP-PXPPP 951 P P PP P P P P PP P PP Sbjct: 876 PPGLPGPPGPASPPSPPGPPGPPGPKGPP 904 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 +P P PP PPP P P PP PPP P Sbjct: 247 MPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPP 285 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P PPPP + P P P PPP P Sbjct: 228 PPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFP 264 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 +P P PP PP P P P PPP PP P Sbjct: 252 MPPPGMMPPPGFPPMGMPGMG-GMPPPGMPPPMPPGGMP 289 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 + PP P P PP PP PPP PP Sbjct: 274 MPPPGMPPPMPPGGMPPN--MEQPPPPPP 300 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P G+ P P P P P P P PPP GG P Sbjct: 249 PPGMPPPGMMPPPGFPP--MGMPGMGGMPPPGMPPPMPPGGMP 289 Score = 29.1 bits (62), Expect = 5.6 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 10/48 (20%) Frame = +1 Query: 847 PXPXPXPPIXXPPP--PXPXXNPPXPXP--------XXPPPXPPPXXP 960 P P PP PPP P P PP P PPP PP P Sbjct: 237 PMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMP 284 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 +P PP PPP P P P PPP PP Sbjct: 268 MPGMGGMPPPGMPPPMPPGGMP--PNMEQPPPPPP 300 >SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXG-GXXXGGG 832 G GG G G G GGV G GG GG G G G G GGG Sbjct: 227 GGLGGLGGLGGVG-GLGGVGGLGGIGGLGGGGVIAGAGAGIGGG 269 Score = 32.3 bits (70), Expect = 0.60 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G GG+ G GG GG G G G GGG Sbjct: 214 GVIGTGVIGAGAVGGLGGLGGLGGVGGLGGVGGLGGIGGLGGG 256 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXP----XPXXPXXXPPPXXP 961 PP P PP PP P PP P P P PP P Sbjct: 456 PPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSP 496 Score = 32.7 bits (71), Expect = 0.46 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP P PP PP P P PP PP P Sbjct: 450 PLPSDEPP---PLPPDEEKPPPPPAPALPPLPLPPELP 484 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQ--PPPPXPPXXPXXXPPPXP 959 P P PP P + PPPP P P PP P Sbjct: 449 PPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPELP 484 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPPP P PP P P P P P Sbjct: 456 PPPLPPDEEKPPPPPAPAL-PPLPLPPELPGSPGDSPP 492 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +1 Query: 847 PXPXPX-PPIXXPP--PPXPXXNPPXPXPXXPPPXP 945 P P P PP+ PP P P +PP P PP P Sbjct: 468 PPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPP 503 >SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXG 838 G GG G G G GG GGG GG D G GG G Sbjct: 166 GDGGGDDDDGGDGDG-GGDDGGGADGGGADGGDDDGGDGDG 205 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXP 947 PP P P PPPP PP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 33.5 bits (73), Expect = 0.26 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXP 934 P P PP PPPP PP P P Sbjct: 56 PPPPPPPPPPPPPPPPSSSPSRP 78 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXP 918 P P P PP PPPP P +P P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 875 PXPPXPPPPXTPPXPXPXXPXXXP 946 P PP PPPP PP P P P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 32.7 bits (71), Expect = 0.46 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 Query: 904 NPPXPXPXXPPPXPPPXXP 960 +PP P P PPP PPP P Sbjct: 53 DPPPPPPPPPPPPPPPPPP 71 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 885 PXXPXPQPPPPXPPXXPXXXPPPXP 959 P P P PPPP PP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 32.7 bits (71), Expect = 0.46 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 875 PXPPXPPPPXTPPXPXP 925 P PP PPPP PP P P Sbjct: 54 PPPPPPPPPPPPPPPPP 70 Score = 32.3 bits (70), Expect = 0.60 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXP 919 P P PP PPPP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPP 912 P P P PP PPPP P + P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXP 925 PP P P PP PPPP + P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 626 PPXPXPXXPXRPPPXPXGAP 685 PP P P P PPP P +P Sbjct: 56 PPPPPPPPPPPPPPPPSSSP 75 Score = 28.7 bits (61), Expect = 7.4 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 626 PPXPXPXXPXRPPPXPXGAPP 688 PP P P P PPP P + P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSP 75 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 625 PPXPKXPXPXXPPPXSXGGXPL 690 PP P P P PPP S PL Sbjct: 58 PPPPPPPPPPPPPPSSSPSRPL 79 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +1 Query: 847 PXPXPXPP---IXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P PP PPP P PP P PPP PP Sbjct: 661 PPPPPPPPGGQAGGAPPPPP---PPLPGGAAPPPPPP 694 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = +3 Query: 882 PPXXPXPQ----PPPPXPPXXPXXXPPPXPP 962 PP P Q PPPP PP PPP PP Sbjct: 664 PPPPPGGQAGGAPPPPPPPLPGGAAPPPPPP 694 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 6/39 (15%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXN--PPXPXPXXP----PPXPPP 951 P PP PPPP PP P P P PP PPP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPP 694 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 7/34 (20%) Frame = +3 Query: 882 PPXXPXPQP-------PPPXPPXXPXXXPPPXPP 962 PP P P P PPP PP P PP PP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPP 693 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 885 PXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P PPPP P PPP PP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPP 681 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXP 959 PP P PPP PP PPP P Sbjct: 680 PPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXG 678 P P G P P P P P A PP P PPP G Sbjct: 666 PPPGGQAGGAPPPPPP-PLPGGAAPPPPPPIGGGAPPPPPPG 706 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 614 PXQXPPXPXPXXPXRPPPXPXGAPP 688 P PP P P PPP GAPP Sbjct: 677 PPPPPPLPGGAAPPPPPPIGGGAPP 701 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 7/33 (21%) Frame = +2 Query: 875 PXPPXPPP-------PXTPPXPXPXXPXXXPPP 952 P PP PPP P PP P P PPP Sbjct: 661 PPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPP 693 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXP-XPXXPPPXSXGGXP 687 P + P PAP P P A A PP P P P PP GG P Sbjct: 155 PSIASQPPQPPAP-PAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPP 199 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 881 PPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP PP P P P P PPP P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAP 187 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPP P P P P PPP P Sbjct: 171 PFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPP--XPPXXPXXXPPPXPP 962 P P PP P P PP PP P PPP PP Sbjct: 175 PAAPPAPPPPGAPAAPPAPPFGGPPSAP--PPPPAPP 209 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PP PP P P P PPP PP Sbjct: 179 PAPPPPGAPAAPPAPPFGGPPSAPP-PPPAPP 209 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP +P P PPP P P P PP P Sbjct: 167 PPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPP 203 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPP--XXPXXXPPPXP 959 +PP P P PPP PP P PPP P Sbjct: 429 TPPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 875 PXPPXPPPPXTPPXPXPXXPXXXPPP 952 P PP PPP PP P P PPP Sbjct: 432 PTPPPTPPPTPPPTTLP--PTTQPPP 455 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P PP PP P P PP PPP P Sbjct: 430 PPPTPPPTPPPTPPPTTLPP---TTQPPPQP 457 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +2 Query: 851 PPXXXPXSPXPPXPP---PPXTPPXPXP 925 PP P +P P PP PP T P P P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 PP P PP P P P PP P Sbjct: 431 PPTPPPTPPPTPPPTTLPPTTQPPPQP 457 >SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 GGG GG G GG G GGGG GG G G Sbjct: 13 GGGDGGDSGGGSDGGGDGGDGGGG-SDGGDGEG 44 Score = 31.9 bits (69), Expect = 0.80 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GG GGG G G GG G G G G G G Sbjct: 22 GGSDGGGDGGDGGGGSDGGDGEGDDDGDGEGDDDG 56 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGG 881 G GGG G GG GGGG G G Sbjct: 18 GDSGGGSDGGGDGGDGGGGSDGGDGEG 44 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXG 867 GGG GGG G G GG G G GG G Sbjct: 3698 GGGYGGGGGGYGGGGGGYGDGTGGAAFG 3725 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXG 865 GGG G G G G GGGG GG G G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGG 53 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGG 864 GGG GG G G G G GGGG GG Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGG 53 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G GGG G G GG GGGG GG + G G Sbjct: 27 GGHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNGKEYSG 68 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 GGG GGG G GG G GGGG GG G G Sbjct: 26 GGGHGGGH---GYGGGPNGGGGGG--GGGGGGG 53 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G GGG G G G GGG GG G G GG GG Sbjct: 119 GQAGGG---GQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGG 157 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -3 Query: 951 GGGXXXGXXGX-GXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 GGG G G GG GGGG G G G GG G + Sbjct: 123 GGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSS 164 Score = 31.9 bits (69), Expect = 0.80 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G GG GGGG G G G GG GGG Sbjct: 105 GTAEGGGEAGGEAGGQAGGGGQAG-GQAGSQAGGGAAGGG 143 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GGG G G G GG GG G G GG G + Sbjct: 138 GAAGGG---GQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSGSS 178 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 GG GGG G GG G GG GG G Sbjct: 143 GGQEGGGQGGAQAGGSTSGSSSGGATSGGGG 173 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GGG G G GG G G G GGG+ Sbjct: 144 GQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSGSSGTSIAGGGS 187 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQ---PPPPXPPXXPXXXPPPXPP 962 P L PP P PPPP P P PPP PP Sbjct: 285 PLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP 939 +P P P PPPP P P P PPP Sbjct: 291 LPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 10/43 (23%) Frame = +1 Query: 853 PXPXPPI---XXPPP--PXPXXNPPXP-----XPXXPPPXPPP 951 P P PP+ PPP P PP P P PPP PPP Sbjct: 280 PPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +1 Query: 589 PXPXXPXPAXAXPPXP---KXPXPXXPPPXSXGGXP 687 P P PA A PP P P P PPP G P Sbjct: 292 PPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP P PP P P P P P P P P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAP 785 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PP P P P P P P P P Sbjct: 754 PPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAP 790 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP P PP PP P PP P P Sbjct: 759 PKP-PAPPQFAPVPPPCAPIPPMPCSAPLPPAPAP 792 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PI PP P PP P P P PP Sbjct: 769 PVPPPCAPI--PPMPCSAPLPPAPAPFSAAPHLPP 801 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P SP P PP TP P P PPP P Sbjct: 740 PSEVTTKSPPAPPLPPKVTPKPPAPPQFAPVPPPCAP 776 Score = 28.3 bits (60), Expect = 9.8 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 553 PRPSGLXPXXPAP--XPXXPXPAXAXPPXP-KXPXPXXPPPXS 672 P P + P PAP P P PP P P P P P S Sbjct: 752 PLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFS 794 Score = 24.6 bits (51), Expect(2) = 6.1 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPP 926 SPP PPPP PP Sbjct: 877 SPPTGADDFPPPPPPP 892 Score = 22.6 bits (46), Expect(2) = 6.1 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +3 Query: 900 PQPPPPXPPXXPXXXPPPXPP 962 P PPPP PP PP Sbjct: 926 PLPPPPPELLGSDADLPPPPP 946 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 33.1 bits (72), Expect = 0.35 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 GGG GGG G G GG G GG G GG G G Sbjct: 368 GGGRGGG-RGGGRGGFRGGRGGRG--GGGRGAG 397 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXG 867 G GGG GGG G G G GGGG G Sbjct: 369 GGRGGGRGGGRGGFRGG--RGGRGGGGRGAG 397 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 PP P PP PP P PPP PP Sbjct: 415 PPWQTTPGYIPPPPPGFPQFQPPPPPP 441 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP + P PPP PP P P PPP P Sbjct: 309 PPAASEPAAFAPAPPPSQAPP-PPKTIPSTLPPPPVP 344 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +1 Query: 556 RPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 +P G+ P P P P A + PP P PPP Sbjct: 392 KPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPP 428 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +1 Query: 853 PXPXPPIXXPPPP--XPXXNPPXPXPXXPPPXPP 948 P P PP PPPP P PP P P PP Sbjct: 320 PAP-PPSQAPPPPKTIPSTLPPPPVPSATSAPPP 352 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 882 PPXXPXPQPPPPXPP 926 PP P QPPPP PP Sbjct: 428 PPGFPQFQPPPPPPP 442 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P + PPPP P PP P P PPP Sbjct: 190 PWTSVPPPPPPGPGGIPPPPPPIRGGVPPPP 220 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGG 681 P+ P P P P P PP P PPP GG Sbjct: 185 PTEDTPWTSVPPPPPPGPGGIPPPPPPIRGGVPPPPPMGGG 225 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPP-PXTPPXPXPXXPXXXPPP 952 P P + PP PPP P P P P PPP Sbjct: 185 PTEDTPWTSVPPPPPPGPGGIPPPPPPIRGGVPPP 219 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXP 959 PP P P PP PP PPP P Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 894 PXPQPPPPXPPXXPXXXPPPXPP 962 P PPP PP P PPP PP Sbjct: 190 PWTSVPPP-PPPGPGGIPPPPPP 211 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXP 924 VP P P P PPPP P P P Sbjct: 194 VPPPPPPGPGGIPPPPPPIRGGVPPPP 220 >SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) Length = 556 Score = 33.1 bits (72), Expect = 0.35 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXG-GXXXGGG 832 G G G G GG G GG G GD G G G GGG Sbjct: 504 GGDDGATVDGDDGAIGGGAIGDGGDNGGGDDGGDDGAGNSDGGG 547 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 GG GGG G G G GGGG GG G Sbjct: 526 GGDNGGGDDG-GDDGAGNSDGGGGNDNGGGG 555 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 595 PXXPXPAXAXPPXPKXPXPXXPPPXSXG 678 P P P PP P P P PPP S G Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPPSGG 86 Score = 32.3 bits (70), Expect = 0.60 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 881 PPXPPPPXTPPXPXPXXPXXXPPP 952 P P PP PP P P P PPP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPP 82 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 885 PXXPXPQPPPPXPPXXPXXXPPPXP 959 P P P PP PP P PPP P Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 31.9 bits (69), Expect = 0.80 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXP 919 P P PP PPPP PP P Sbjct: 65 PTLPPPPPPPPPPLPPPP 82 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P PP PPP PP P P PPP Sbjct: 59 PTVPIPPTLPPPPPPPPP----PLPPPPP 83 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXP 919 P P PP PPPP PP P Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPP 83 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPP 936 P PP PPPP PP P P PP Sbjct: 62 PIPPTLPPPPPP----PPPPLPPPPP 83 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXP 925 P P + PP PPPP P P P Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 880 PPPPXPXXNPPXPXPXXPPPXP 945 P PP PP P P PPP P Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPP 83 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 906 PPPPXPPXXPXXXPPPXPP 962 P P PP P PPP PP Sbjct: 59 PTVPIPPTLPPPPPPPPPP 77 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 875 PXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P PP PPPP P P P P P P P Sbjct: 1660 PAPP-PPPPPAPGPPGPDGPMGLPGPQGP 1687 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXP-XPXXPXXXP-PPXXP 961 PP P +P PP P P P P P P P PP P Sbjct: 1662 PPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLP 1700 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPX-PXXP--PPXPP 948 P P PP PP P P P P P PP PP Sbjct: 1663 PPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPP 1697 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 595 PXXPXPAXAXPPXPKXPXPXXPPPXSXG 678 P P P PP P P P PPP S G Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPPSGG 310 Score = 32.3 bits (70), Expect = 0.60 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 881 PPXPPPPXTPPXPXPXXPXXXPPP 952 P P PP PP P P P PPP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPP 306 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 885 PXXPXPQPPPPXPPXXPXXXPPPXP 959 P P P PP PP P PPP P Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 31.9 bits (69), Expect = 0.80 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXP 919 P P PP PPPP PP P Sbjct: 289 PTLPPPPPPPPPPLPPPP 306 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P PP PPP PP P P PPP Sbjct: 283 PTVPIPPTLPPPPPPPPP----PLPPPPP 307 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXP 919 P P PP PPPP PP P Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPP 307 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPP 936 P PP PPPP PP P P PP Sbjct: 286 PIPPTLPPPPPP----PPPPLPPPPP 307 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXP 925 P P + PP PPPP P P P Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 880 PPPPXPXXNPPXPXPXXPPPXP 945 P PP PP P P PPP P Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPP 307 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 906 PPPPXPPXXPXXXPPPXPP 962 P P PP P PPP PP Sbjct: 283 PTVPIPPTLPPPPPPPPPP 301 >SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) Length = 185 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGG 881 GG GGG G G GGGG G GG Sbjct: 125 GGDGGGGSDGGGGSDGGGGDGEDDDGG 151 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 GGG GGG G GG G G G GG G Sbjct: 124 GGGDGGG-GSDGGGGSDGGGGDGEDDDGGDG 153 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G G GGG GG+ G GGG G G G G Sbjct: 38 GGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGMGRG 75 Score = 31.9 bits (69), Expect = 0.80 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G G G GGG GG+ G GGG G G G Sbjct: 14 GGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWG 49 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 G G G GGG GG G GGG G G G G+ Sbjct: 6 GGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGS 44 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G G GGG GG G GGG G G G G Sbjct: 22 GGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRG 59 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G G G GGG GG+ G GGG G G G Sbjct: 54 GGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWG 89 Score = 29.5 bits (63), Expect = 4.2 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 6/41 (14%) Frame = -1 Query: 950 GGGXG---GGXXGXGXGG-LXXGXGG--GGXXXGGXGXGXG 846 GGG G GG G G GG L G GG G GG G G G Sbjct: 61 GGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQEGGMGRGPG 101 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXG-GXGXGXG 846 G G G GGG GG+ G G G G G G G G Sbjct: 78 GGLGRGPGGGWGRMQEGGMGRGPGQGWGCRGMGCGWGCG 116 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG+ GGG G G GGG Sbjct: 270 GNAGGGAGEGSTG-GPGGINAGGGGGDSTTDSDDGAGGGGGGG 311 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPP 913 P P SP PP PPPP T P Sbjct: 463 PPPPPMSPPPPTPPPPATSP 482 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXP 919 P P PP PPP TPP P Sbjct: 461 PIPPPPPMSPPPPTPPPP 478 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 881 PPXPPPPXTPPXPXPXXPXXXP 946 P PPPP +PP P P P P Sbjct: 461 PIPPPPPMSPPPPTPPPPATSP 482 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGGG-GXXXGGXGXGXG 846 GG GGG G G GG GGG GG G G G Sbjct: 424 GGPGGGYEGRGRGGRGGPRGGGPRGYDGGYGQGGG 458 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G G GG GGG G G G G GG Sbjct: 427 GGGYEGRGRGGRGGPRGGGPRGYDGGYGQGGGYEGYSGG 465 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG G G G GG G GG G G G Sbjct: 440 GPRGGGPRGYDGGYGQGGGYEGYSGGYRDDYGYGGG 475 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -1 Query: 959 GXXGGGXGGGXX-GXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GG G G G G GGGG G G G Sbjct: 63 GGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGG 101 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G GG GG GG G G GG GG G Sbjct: 60 GDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAG 93 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -1 Query: 959 GXXGGGX--GGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G GG GGG G G GG G GG GG G Sbjct: 67 GGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGG----GGXGGXGDXGXXXGG 850 G GG G G GG G GG G GD G GG Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGG 91 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGG 850 G GG G G GGGG G GD GG Sbjct: 66 GGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 32.7 bits (71), Expect = 0.46 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPP---XPPPXXP 960 P PP PPP PP P PPP PPP P Sbjct: 451 PPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGP 489 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXP---XPXXPXXXPPP 952 PP P PPPP PP P P P PPP Sbjct: 470 PPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPP 506 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 8/42 (19%) Frame = +2 Query: 851 PPXXXPXSPXPPX-----PPPPX---TPPXPXPXXPXXXPPP 952 PP P P PP PPPP PP P P PPP Sbjct: 451 PPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPP 492 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P P PP PPP PP P PPP Sbjct: 477 PPPRGFPPPPFGPPPPFYRGPPPPRGMPPPP 507 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 5/39 (12%) Frame = +1 Query: 847 PXPXPXPPIXXPPP-----PXPXXNPPXPXPXXPPPXPP 948 P P PP PPP P P PP P P PP Sbjct: 479 PRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQGPP 517 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P + PP P PPPP P P PP P Sbjct: 469 PPPPMGMYPP--PRGFPPPPFGPPPPFYRGPPPP 500 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +1 Query: 844 VPXPXPXPP---IXXPPPPXPXXNPPXPXPXXPPPXPPP 951 +P P PP PPPP PP P PPP PP Sbjct: 454 LPPNLPPPPGGMRGMPPPPMGMYPPPRGFP--PPPFGPP 490 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPX--PXPXXPPPXPPPXXP 960 P PP+ PPP PP P P P PP P Sbjct: 469 PPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMP 504 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP+ PPP P P PPP PPP P Sbjct: 2618 PMMLPPMLPLPPPGLPMQPEAPVQ--PPPLPPPGGP 2651 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P L PP P P P P P P PPP PP Sbjct: 2615 PMVPMML-PPMLPLPPPGLPMQPEAP-VQPPPLPP 2647 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 1/26 (3%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPP-XPXP 925 PP P P P PPP PP P P Sbjct: 2628 PPPGLPMQPEAPVQPPPLPPPGGPFP 2653 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 32.3 bits (70), Expect = 0.60 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 881 PPXPPPPXTPPXPXPXXPXXXPPP 952 P PPPP TPP P P P P Sbjct: 301 PQTPPPPQTPPPPQTPAPPQTPAP 324 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +2 Query: 866 PXSPXPPX-PPPPXTPPXPXPXXP 934 P +P PP PPPP TP P P Sbjct: 301 PQTPPPPQTPPPPQTPAPPQTPAP 324 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +3 Query: 879 SPPXXPXPQ-PPPPXPPXXPXXXPPP 953 +P P PQ PPPP P P PP Sbjct: 300 TPQTPPPPQTPPPPQTPAPPQTPAPP 325 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 32.3 bits (70), Expect = 0.60 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G G G G G G GGG G G G GGGA Sbjct: 418 GSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGA 461 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GGG G GG G G G GG GGG+ Sbjct: 422 GASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGS 465 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 GG G G G G GG GG G G GGA Sbjct: 417 GGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGA 456 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GG GG G GGG GG G G Sbjct: 412 GASSAGGSSAGASGGGHKGAGGGSAAGGGTGSG 444 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G G G G G G G G G G GG GG + Sbjct: 427 GHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGGAS 470 >SB_27284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 32.3 bits (70), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G G G GGG G G G G Sbjct: 124 GDDGGDDGGGDDDSGGVGDDGGDDGGGDDDSGSGVGGG 161 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GG G G G GGG GG G G Sbjct: 74 GDDGGDDSGGDDDSGGVGDDGGDGGGDDDSGGVGDDGG 111 >SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) Length = 188 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 903 QPPPPXPPXXPXXXPPPXPP 962 QPPPP PP P PPP PP Sbjct: 30 QPPPPSPPPSP---PPPSPP 46 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 903 QPPPPXPPXXPXXXPPPXPP 962 QPPPP PP P PPP PP Sbjct: 153 QPPPPSPPPSP---PPPSPP 169 Score = 30.7 bits (66), Expect = 1.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 882 PPXXPXPQPPPPXPP 926 PP P P PPPP PP Sbjct: 32 PPPSPPPSPPPPSPP 46 Score = 30.7 bits (66), Expect = 1.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 882 PPXXPXPQPPPPXPP 926 PP P P PPPP PP Sbjct: 155 PPPSPPPSPPPPSPP 169 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXP 925 P P PP PPP +PP P Sbjct: 31 PPPPSPPPSPPPPSPPLDCP 50 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXP 925 P P PP PPP +PP P Sbjct: 154 PPPPSPPPSPPPPSPPLDCP 173 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 880 PPPPXPXXNPPXPXPXXPPP 939 PPPP P +PP P P P Sbjct: 31 PPPPSPPPSPPPPSPPLDCP 50 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 907 PPXPXPXXPPPXPPPXXP 960 PP P P PPP PP P Sbjct: 33 PPSPPPSPPPPSPPLDCP 50 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 880 PPPPXPXXNPPXPXPXXPPP 939 PPPP P +PP P P P Sbjct: 154 PPPPSPPPSPPPPSPPLDCP 173 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 907 PPXPXPXXPPPXPPPXXP 960 PP P P PPP PP P Sbjct: 156 PPSPPPSPPPPSPPLDCP 173 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 32.3 bits (70), Expect = 0.60 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = -3 Query: 933 GXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G G G GG GGGG GG GD G G Sbjct: 320 GGGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDG 352 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GGG G G GG G G G G Sbjct: 321 GGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNG 356 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGG 905 GG GGG G GG GGGG Sbjct: 320 GGGGGGGGGGGGGGGGGGG 338 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGG 905 GG GGG G GG GGGG Sbjct: 321 GGGGGGGGGGGGGGGGGGG 339 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXG 899 G GGG G GG GGGG G Sbjct: 320 GGGGGGGGGGGGGGGGGGGG 339 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 952 GGGXXXGXXGGXGGGGXGXG 893 GGG G GG GGGG G G Sbjct: 320 GGGGGGGGGGGGGGGGGGGG 339 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 938 GGGXXGXGXGGLXXGXGGGG 879 GGG G G GG G GGGG Sbjct: 320 GGGGGGGGGGGGGGGGGGGG 339 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G G G G G G Sbjct: 323 GGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDG 360 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 S P P P+ PPP P PPP PP Sbjct: 779 SIPTTPPPEYPPPPPGLARPNPPPPNPP 806 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXP-PPXPP 962 PP P PPPP PP P P PP Sbjct: 792 PPGLARPNPPPPNPPLQVTSIPGEPAPP 819 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 32.3 bits (70), Expect = 0.60 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 880 PPPPXPXXNPPXPXPXXPPPXPPPXXP 960 PPPP P + P P P P P P P Sbjct: 138 PPPPTPPQSTPKPRRVLPTPPPKPPTP 164 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PP P P P P P P P PP Sbjct: 136 PTPPPPTPPQSTPKPRRVLPTPPPKPPTPRPP 167 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP PP P P P PP P P Sbjct: 136 PTPPPPTPPQSTPKPRRVLPTPPPKPPTPRP 166 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 PTP T P Q P P P PP P PP Sbjct: 136 PTPPPPT-PPQSTPKPRRVLPTPPPKPPTPRPP 167 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 32.3 bits (70), Expect = 0.60 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 +P P P PPI PPP P PP P PPP P P Sbjct: 78 MPFPPP-PPIYMPPP--PVYMPPPPV-YMPPPMPMGDVP 112 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P P PP PP PP P P PPP Sbjct: 75 PMMMPFPPPPPIYMPP--PPVYMPPPPVYMPPP 105 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPP 953 P P P PPP P P PPP Sbjct: 75 PMMMPFPPPPPIYMPPPPVYMPPP 98 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PP P P P P PP PP P Sbjct: 148 PPPGGYPPTSYPPQPYPAQ--PYPQQGYPPQPPPQAYP 183 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P+G P P P P A PP P PPP GG P Sbjct: 115 PTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPP---GGYP 154 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 5/42 (11%) Frame = +1 Query: 553 PRPSGLXPXX--PAPXPXXPXPAXAXPPXP---KXPXPXXPP 663 P P G P P P P P P PP P P P PP Sbjct: 148 PPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPP 189 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +2 Query: 866 PXSPXPPXPPPPXT--PPXPXPXXPXXXPPPXXP 961 P SP PP P P PP P P PP P Sbjct: 121 PYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYP 154 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP P P P + P PPP PPP P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPP 388 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 4/32 (12%) Frame = +3 Query: 879 SPPXXPXPQPPP----PXPPXXPXXXPPPXPP 962 +PP P P P P P P P PPP PP Sbjct: 356 NPPSTPAPTPAPLSSTPCAPFAPPPPPPPPPP 387 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P P P P P PP P P PPP P Sbjct: 361 PAPTPAPLSSTPCAPFA---PPPPPPPPPPPAP 390 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXP 925 P +P PP PPPP P P Sbjct: 375 PFAPPPPPPPPPPPAPGSTP 394 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPL 690 P PAP P P P P P PPP + G P+ Sbjct: 358 PSTPAPTPAPLSSTPCAPFAPPPPPP-PPPPPAPGSTPV 395 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXP 925 P P +P P PPPP PP P P Sbjct: 367 PLSSTPCAPFAPPPPPP-PPPPPAP 390 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 S P P PPPP PP P P Sbjct: 370 STPCAPFAPPPPPPPPPPPAPGSTP 394 >SB_55729| Best HMM Match : YajC (HMM E-Value=0.56) Length = 654 Score = 31.9 bits (69), Expect = 0.80 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGG----GXGGXGDXGXXXGGXXXGG 835 GGG G G GV GGG G G D G GG GG Sbjct: 4 GGGDGDDGDGGGDDGVDGGGVGDDGDGDDSDCGDDGGGDDDGG 46 >SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 881 PPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P PPPP +PP P P PPP P Sbjct: 363 PTPPPPPHSPPPPLPVI-QLNPPPARP 388 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +1 Query: 853 PXPXPPIXXPPPPXP--XXNPPXPXP 924 P P PP PPPP P NPP P Sbjct: 363 PTPPPPPHSPPPPLPVIQLNPPPARP 388 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 31.9 bits (69), Expect = 0.80 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXP-PPXPPPXXP 960 P P PP P P P P P PP PPP P Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKP 814 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP-PPXXP 960 P P P P PP PP P PPP P P P Sbjct: 779 PPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKP 817 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP P P N P P P PPP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPP 809 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 844 VPXPXPX-PPIXXP-PPPXPXXNPPXPXPXXPPPXPP 948 VP P PP P PPP P P P PP PP Sbjct: 791 VPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 >SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) Length = 506 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +2 Query: 872 SPXPPXPPPPX-TPPXPXPXXPXXXPPP 952 SP P PPPP T P P P PPP Sbjct: 220 SPDAPTPPPPVKTTAAPTPSPPQTPPPP 247 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 565 GLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPLG 693 GL P P P P A P P+ P PP S G P G Sbjct: 218 GLSPDAPTPPPPVKTTAAPTPSPPQTP---PPPTGSCGSKPSG 257 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PPPP P P P PP P Sbjct: 221 PDAPTPPPPVKTTAAPTPSPPQTPPPP 247 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P SP PP PP PP P P PP Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +2 Query: 851 PPXXXPXSPXPP-XPPPPXTPPXP 919 PP P +P PP PPPP TP P Sbjct: 232 PPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXP 934 P P + P PPPP TPP P P Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTPGP 254 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 885 PXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P PP P P PPP P Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTP 252 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPP 936 P PP P P P PP P PP Sbjct: 230 PKPPTAPPNTPPPPVTPPPPNTPGPP 255 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 31.9 bits (69), Expect = 0.80 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXG-----GGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG G GGG GG GD GG GGG Sbjct: 206 GRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGG---GGG 250 >SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) Length = 627 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPP 950 P SPP P P PPPP PP PP Sbjct: 156 PPRHSPPQTPVP-PPPPLPPFAQVSLPP 182 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +3 Query: 903 QPPPPX-PPXXPXXXPPPXPP 962 QPPP PP P PPP PP Sbjct: 154 QPPPRHSPPQTPVPPPPPLPP 174 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 31.9 bits (69), Expect = 0.80 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 583 PAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 PAP P P P PP P P PP GG P Sbjct: 580 PAPTPSYPQPGTYPPPHPSGGYPQPSPP--HGGHP 612 >SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) Length = 592 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P PPP PP PPP P P Sbjct: 71 PAPQPVPNNMGPPPHVNQGPPPNSANQAPPPNPGP 105 >SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) Length = 519 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP+ PP P P P P P P P Sbjct: 41 PRPLPPLREPPTPAPTPPPALPSTPTLPLAPRP 73 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP PP P P P P P P Sbjct: 35 PPIPHGPRPLPPLREPPTPAPTPPPALPSTPTLPLAP 71 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXG-XGXXGGXRXXGXXG 857 GG GGG GG GGGG G G G R G Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGG 503 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 GG G G GG GGGG G G GGG+ Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGGS 507 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXG 838 GG GG GGGG G G G GG G Sbjct: 455 GGAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGG 492 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = -1 Query: 959 GXXGGGXG-GGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 G GGG G G G G GG G G G G G+ Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGGS 507 >SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 924 GXGXGGVXGGGGXGGXGDXGXXXGG 850 G G GG GGGG GG G G G Sbjct: 186 GGGGGGTTGGGGSGGEGTTGGGVSG 210 >SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GG G G G G GGGG GG G Sbjct: 55 GGQGGGGQGGGQGVG-GQEVGGQGGGGQGVGGQEVG 89 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 924 GXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G GG GGGG GG G G GGG Sbjct: 51 GQGVGG-QGGGGQGGGQGVGGQEVGGQGGGG 80 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P I P P P +PP P PP P Sbjct: 928 PEPLPEVDIMRSPTPTPPPSPPPKEPTPPPSSKP 961 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 SP P P PPP P P P P Sbjct: 939 SPTPTPPPSPPPKEPTPPPSSKPSP 963 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXP 946 P P +P P PPP +PP P P P Sbjct: 524 PQPPSPPAPPPKPAPPPRSPPAAAPCNPAMAP 555 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +3 Query: 894 PXPQPP-PPXPPXXPXXXPPPXPP 962 P PQPP PP PP P PPP P Sbjct: 522 PAPQPPSPPAPP--PKPAPPPRSP 543 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 872 SPXPPXPPPPXTPPXPXPXXPXXXPP 949 +P PP PP P P P P P P Sbjct: 523 APQPPSPPAPPPKPAPPPRSPPAAAP 548 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 880 PPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P PP P P PP PP P Sbjct: 524 PQPPSPPAPPPKPAP--PPRSPPAAAP 548 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P PP PPP PP P P P Sbjct: 524 PQPPSPPAPPPKPAPPPRSPPAAAPCNPAMAP 555 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPP 950 P + PP P PQP P P P PP Sbjct: 171 PPEILPPTAPPPQPAPAISPSAPAISPP 198 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P P PP PP P P +P P P P Sbjct: 170 PPPEILPPTAPPPQPAPAISPSAPAISPPAP 200 >SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 858 PXXPXXLSPPXXPX--PQPPPPXPPXXPXXXPPPXPP 962 P P P P PQ P P P P PPP PP Sbjct: 58 PPGPGQPEMPGQPQVTPQTPSPASPGLPFMPPPPPPP 94 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGG 885 GGG GGG G G GG G GG Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGG 1024 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 PP P PPP P P PPP P Sbjct: 423 PPGGGVPSHPPPLPQPPPSIIPPPTTP 449 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXP-PPPXTPPXPXPXXPXXXPPPXXP 961 PP S PP P PPP P P P P P P Sbjct: 423 PPGGGVPSHPPPLPQPPPSIIPPPTTPLPQTVPTPPRP 460 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +2 Query: 851 PPXXXPXSPXP-PXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P P P P PPP PP P PP P Sbjct: 424 PGGGVPSHPPPLPQPPPSIIPPPTTPLPQTVPTPPRPP 461 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P PP PPP P P PP PP Sbjct: 432 PPPLPQPPPSIIPPP----TTPLPQTVPTPPRPP 461 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPP-XPXPXXPPPXPP-PXXP 960 P P P + P P P PP P P PPP P P P Sbjct: 423 PPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVP 462 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 8/47 (17%) Frame = +1 Query: 844 VPXPX-PXPPIXXPPPPXPXXNPPX-PXPXXPPPX------PPPXXP 960 VP P P P + P P P PP P P PPP PPP P Sbjct: 451 VPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 497 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 8/47 (17%) Frame = +1 Query: 844 VPXPX-PXPPIXXPPPPXPXXNPPX-PXPXXPPPX------PPPXXP 960 VP P P P + P P P PP P P PPP PPP P Sbjct: 501 VPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 547 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 8/47 (17%) Frame = +1 Query: 844 VPXPX-PXPPIXXPPPPXPXXNPPX-PXPXXPPPX------PPPXXP 960 VP P P P + P P P PP P P PPP PPP P Sbjct: 521 VPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAP 567 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 553 PRPSGLXPXXP---APXPXXPXPAXAXP--PXPKXPXPXXPPP 666 P P P P AP P P P + P P P P P PPP Sbjct: 532 PPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPP 574 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 8/47 (17%) Frame = +1 Query: 844 VPXPX-PXPPIXXPPPPXPXXNPPX-PXPXXPPPX------PPPXXP 960 VP P P P + P P P PP P P PPP PPP P Sbjct: 561 VPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAP 607 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +1 Query: 553 PRPSGLXPXXP---APXPXXPXPAXAXP--PXPKXPXPXXPPP 666 P P P P AP P P P P P P P P PPP Sbjct: 552 PPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPP 594 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +1 Query: 553 PRPSGLXPXXP---APXPXXPXPAXAXP--PXPKXPXPXXPPP 666 P P P P AP P P P P P P P P PPP Sbjct: 432 PPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 474 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +1 Query: 553 PRPSGLXPXXP---APXPXXPXPAXAXP--PXPKXPXPXXPPP 666 P P P P AP P P P P P P P P PPP Sbjct: 442 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 484 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPX-PXPXXPPPX------PPPXXP 960 P P P + P P P PP P P PPP PPP P Sbjct: 443 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 487 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +1 Query: 553 PRPSGLXPXXP---APXPXXPXPAXAXP--PXPKXPXPXXPPP 666 P P P P AP P P P P P P P P PPP Sbjct: 452 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 494 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +1 Query: 553 PRPSGLXPXXP---APXPXXPXPAXAXP--PXPKXPXPXXPPP 666 P P P P AP P P P P P P P P PPP Sbjct: 502 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 544 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +1 Query: 553 PRPSGLXPXXP---APXPXXPXPAXAXP--PXPKXPXPXXPPP 666 P P P P AP P P P P P P P P PPP Sbjct: 512 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 554 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +1 Query: 553 PRPSGLXPXXP---APXPXXPXPAXAXP--PXPKXPXPXXPPP 666 P P P P AP P P P P P P P P PPP Sbjct: 562 PPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPP 604 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXP--PXPKXPXPXXPPP 666 P P AP P P P P P P P P PPP Sbjct: 427 PHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPP 464 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 8/47 (17%) Frame = +1 Query: 844 VPXPX-PXPPIXXPPPPXPXXNPPX-PXPXXPPPX------PPPXXP 960 VP P P P P P P PP P P PPP PPP P Sbjct: 431 VPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 477 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXP--PXPKXPXPXXPPP 666 P P AP P P P P P P P P PPP Sbjct: 497 PHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 534 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +1 Query: 844 VPXPXPXPPIXXPP-PPXPXXNPP-XPXPXXPPPXPP-PXXP 960 VP P P PP P P PP P P PPP P P P Sbjct: 511 VPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 552 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +1 Query: 844 VPXPXPXPPIXXPP-PPXPXXNPP-XPXPXXPPPXPP-PXXP 960 VP P P PP P P PP P P PPP P P P Sbjct: 551 VPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVP 592 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +1 Query: 844 VPXPX-PXPPIXXPPPPXPXXNPP-XPXPXXPPPXPP-PXXP 960 VP P P + P P P PP P P PPP P P P Sbjct: 491 VPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 532 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +1 Query: 553 PRPSGLXPXXPAPX---PXXPXPAXAXP--PXPKXPXPXXPPP 666 P P P P P P P P P P P P P PPP Sbjct: 542 PPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPP 584 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXP 959 PP P P+ PPP P P PP P Sbjct: 423 PPGAPHPRVPPPGAP-HPRFPPPGAP 447 Score = 28.3 bits (60), Expect = 9.8 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 8/47 (17%) Frame = +1 Query: 844 VPXPX-PXPPIXXPPPPXPXXNPPX-PXPXXPPPX------PPPXXP 960 VP P P P + P P P PP P PPP PPP P Sbjct: 471 VPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAP 517 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXP 959 PP P P+ PPP P P PP P Sbjct: 523 PPGAPHPRVPPPGAP-HPRVPPPGAP 547 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXS 672 P P + P P P P P P A + P P PPP S Sbjct: 244 PHPPSVKPSVPIPPPTKPPPRVA----SRRPPPPLPPPDS 279 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXP---XPXXPPPXPPP 951 P PP P P P P P PPP PPP Sbjct: 244 PHPPSVKPSVPIPPPTKPPPRVASRRPPPPLPPP 277 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 885 PXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P P P P PPP PP Sbjct: 251 PSVPIPPPTKPPPRVASRRPPPPLPP 276 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P PP +PPPP PP PP Sbjct: 254 PIPPPTKPPPRVASRRPPPPLPPPDSSEAQAQQPP 288 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +1 Query: 844 VPXPXPXPP---IXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 +P P PP PPPP P + PP PP P Sbjct: 255 IPPPTKPPPRVASRRPPPPLPPPDSSEAQAQQPPLSPPVGKP 296 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 PP P P P P P PPP PP Sbjct: 681 PPLTPPPPLPTPIASSEPLPLPPPPPP 707 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXP 945 PP+ PPP P P PPP P Sbjct: 681 PPLTPPPPLPTPIASSEPLPLPPPPPP 707 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 900 PQPPPPXPPXXPXXXPPPXPP 962 P PPPP PP PP PP Sbjct: 5 PPPPPPPPPIAAEFTAPPAPP 25 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP PPPP P P PPP P P P Sbjct: 5 PPPPPPPPPIAAEFTAPPAPP-PPPNPAPDVP 35 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 871 IXXPPPPXPXXNPPXPXPXXPPPXPPP 951 + PPPP P P PPP P P Sbjct: 4 VPPPPPPPPPIAAEFTAPPAPPPPPNP 30 >SB_38491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG GGG G G G G G G G G G G Sbjct: 12 GGGGGGGGDGDGDGD-GDGDGDGDGDGDGDGDGDG 45 >SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GGG G GG GGG G GG GGG+ Sbjct: 339 GFGGGGATVASRPGGGGGYSGGGLASSGGSTLSSEGGVAGGGGS 382 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPP---XPXPXXPPPXPPPXXP 960 VP P PP PP P PP P PP PP P Sbjct: 2173 VPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGP 2214 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +1 Query: 853 PXPXPPIXXPPP-PXPXXNPPXPXPXX--PPPXPPP 951 P PP+ PP P P PP P PP PPP Sbjct: 2181 PSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPP 2216 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +3 Query: 858 PXXPXXL-SPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P L +PP P P PP P P PP PP Sbjct: 2161 PSGPSPLGAPPSVPPPMGAPPSGP-PPMGAPPSGPP 2195 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PP P P P PP PPP Sbjct: 2164 PSPLGAPPSVPPPMGAPPSGP--PPMGAPPSGPPP 2196 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP PPP P P P PP P Sbjct: 2170 PPSVPPPMGAPPSGPPPMGAPPSGP-PPMGTPPSGHP 2205 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPP-XPXPXXPPPXPPP 951 P P P P P P PP P P PP PP Sbjct: 2150 PPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPP 2185 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 +P P P + PPPP P P P P P PP Sbjct: 652 IPPPPPGGGMFPPPPPPP---PGGGVPGPPKPPPP 683 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 PP PPPP PP PP PP Sbjct: 656 PPGGGMFPPPPPPPPGGGVPGPPKPPP 682 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 PP PPPP PP PP PP Sbjct: 655 PPPGGGMFPPPPPPPPGGGVPGPPKPP 681 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PPP P P P PPP P Sbjct: 23 PQPTPPKPDTPPPGTNI-PTPPSPNTPPPVTQP 54 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 6/38 (15%) Frame = +2 Query: 866 PXSPXPPXP--PPPXT----PPXPXPXXPXXXPPPXXP 961 P P PP P PPP T PP P P PP P Sbjct: 22 PPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQP 59 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPP-PPXPXXNPPXPXPXXPPPXPP 948 P P PP+ PP P PP P P PP Sbjct: 43 PSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPP 77 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP +P P PPP T P P P PP P Sbjct: 34 PPGTNIPTPPSPNTPPPVTQP-PVTQPPVTQPPVTQP 69 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXT-PPXPXPXXPXXXPPPXXP 961 PP P PP PP T PP P P P P Sbjct: 49 PPVTQPPVTQPPVTQPPVTQPPVTQPPPPVTQSPEQEP 86 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 4/42 (9%) Frame = +1 Query: 847 PXPXPXPPIXXPP----PPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P PP P P N P P P PP P Sbjct: 23 PQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQP 64 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXGXXG 884 G GGG G GG GGGG G G Sbjct: 490 GGGGGASGGGGGGGGGGGFSGGACG 514 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXG 899 GG GGG GG GGGG G Sbjct: 487 GGFGGGGGASGGGGGGGGGGG 507 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGG 879 G GGG GG G GL GGGG Sbjct: 502 GGGGGGFSGGACGDFTSGLSPTCGGGG 528 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGG 864 G G GGG G G GG GGGG GG Sbjct: 488 GFGGGGGASGGGGGG-----GGGGGFSGG 511 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 G GGG G G GG GG G G G G G+ Sbjct: 225 GFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGGS 263 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 GG G G G GGGG G G G GGG+ Sbjct: 224 GGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGGS 263 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 960 GXXGGGXXXGXXGX---GXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GG G G G G GGGG G + GG GGG+ Sbjct: 204 GGRAGGMNSGYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGS 250 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GGG G GG GGG G G GG GG + Sbjct: 227 GGGGGGSEDNGASGGGGGYSGGGSGTHSGQAG-GGGGSYCGGSS 269 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GGG G GGG G G G G Sbjct: 224 GGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAG 258 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXGXXGGXRXXG 866 G GG G GG GGGG G G G Sbjct: 213 GYNGGPAPGAVGGFGGGGGGSEDNGASGGGG 243 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 5/41 (12%) Frame = +1 Query: 853 PXPXPPIXXPPP---PXPXXNPP-XPXPXXPPPXPP-PXXP 960 P P PI PP P P PP P P PPP P P P Sbjct: 63 PPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDP 103 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 5/41 (12%) Frame = +1 Query: 853 PXPXPPIXXPPPPXP--XXNPP--XPXPXXPPPXPP-PXXP 960 P P PI PPP NPP P P PPP P P P Sbjct: 73 PPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDP 113 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P P P P PPP Sbjct: 58 PIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPP 95 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXS-XGGXPL 690 P P P P P P P P P P PPP + G PL Sbjct: 78 PIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIQGDPL 124 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +1 Query: 853 PXPXPPIXXPPP---PXPXXNPP-XPXPXXPPPXPP 948 P P PI PP P P PP P P PPP P Sbjct: 83 PPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTP 118 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 5/41 (12%) Frame = +1 Query: 853 PXPXPPIXXPPP---PXPXXNPP-XPXPXXPPPXPP-PXXP 960 P P PI PP P P PP P P PPP P P P Sbjct: 53 PPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNP 93 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P P P P PPP Sbjct: 48 PIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPP 85 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P P P P PPP Sbjct: 68 PIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPP 105 Score = 28.7 bits (61), Expect = 7.4 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 5/39 (12%) Frame = +1 Query: 859 PXPPIXXPPP---PXPXXNPP-XPXPXXPPPXPP-PXXP 960 P PI PP P P PP P P PPP P P P Sbjct: 45 PNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDP 83 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P P PP PP P PP P PP P Sbjct: 531 PPPQPYPPTQPSYPPTPSSYPP-TQPSYPPTAP 562 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXP-PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PPI PP P NP P P PP P Sbjct: 209 PTPSSYPPIAASYPPTAPSYNPTAPSYPPTPSSYPPTQP 247 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 590 PTPXAX--TLPXQXPPXPXPXXPXRPPPXPXGAPP 688 PTP + T P PP P P PP P PP Sbjct: 518 PTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPP 552 >SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) Length = 1049 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXG 865 G G G G G GGV GGGG G D G Sbjct: 257 GDGDGDGD-GDGDGGVGGGGGGGSCNDKG 284 >SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) Length = 699 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP P PP P PPP P P Sbjct: 383 PLPTPPPMSTHPEFTSKPPPPPVASKPPPKPVP 415 >SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0) Length = 1066 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +2 Query: 851 PPXXXPXSPXP--PXPPPPXTPPXPXPXXPXXXP 946 PP P P P P P P T P P P P P Sbjct: 778 PPQAKPAEPEPLAPRPSSPQTQPAPAPPEPAAAP 811 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGG 879 G GG GG G G G G GGGG Sbjct: 436 GSFGGSSGGSFGGSGFGSKSSGGGGGG 462 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G GG GG G G G GGG Sbjct: 419 GGAFGGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGG 461 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP+ PPP PP PPP PP Sbjct: 389 PVTVPPPPLI--PPPQASIPPPTMIQTLPPPSVPP 421 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 VP P P PPP P P P PPP P Sbjct: 382 VPPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVP 420 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +1 Query: 859 PXPPIXXPPPPXP-XXNPPXPXPXXPP--PXPPPXXP 960 P P I PPP P NP P P P PPP P Sbjct: 363 PPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIP 399 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGG 681 P P G+ P P P P P P+ P P PP G Sbjct: 394 PGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMG 436 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 553 PRPSGLX-PXXPAPXPXXPXPAXAXPPXPKXPXPXXPP 663 PRP G P P P P P P P P P PP Sbjct: 406 PRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGPGMPP 443 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +2 Query: 614 PXQXPPXPX-PXXPXRPPPXPXGAPPXG 694 P PP P P P PP P G PP G Sbjct: 401 PGMGPPRPMGPPGPHGPPFGPRGPPPHG 428 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P P P PP P P P PP P Sbjct: 412 PGPHGPPFGPRGPPPHGGPPR-GPMGPGPGMPPMRP 446 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G GG GG G G G GG G Sbjct: 793 GAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSG 832 Score = 28.7 bits (61), Expect = 7.4 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = -3 Query: 960 GXXGG--GXXXGXXGXGXGGVXGGGGX---GGXGDXGXXXGGXXXGGGA 829 G GG G G G GG GG G G G G GG G G+ Sbjct: 781 GGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGS 829 Score = 28.7 bits (61), Expect = 7.4 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = -1 Query: 959 GXXGGGXGG--GXXGXGXGGLXXGXGG-GGXXXGGXGXGXG 846 G GG GG G G GG G GG G GG G G Sbjct: 781 GGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSG 821 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GG G G G G GG G G GGA Sbjct: 795 GSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGA 838 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GG G G GG G G G G G Sbjct: 806 GGSSGGASGGAGGSSGGASGGAGSSSGGASGGADG 840 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPP---XPPP 951 P PP PPP P P P PPP PPP Sbjct: 275 PPGFPPRWGPPPHMPPDYRGFPPPNFPPPDFSRPPP 310 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GGG G G G GG GGGG G G GGG+ Sbjct: 226 GGFGGGG--GVWGNGGGG-GGGGGYSGGGSGNPHYYACGGGGGS 266 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 G GGG GG GGGG G G G Sbjct: 229 GGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGG 262 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 GGG G G G GG G G G G G G+ Sbjct: 231 GGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGGS 266 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 GGG G G GG GGG G GG G+ Sbjct: 231 GGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGGSYNSGS 271 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 900 PQPPPPXPPXXPXXXPPPXPP 962 P PPPP P PPP PP Sbjct: 756 PPPPPPAVPGEGARPPPPPPP 776 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 894 PXPQPPPPXPPXXPXXXPPPXPP 962 P P PPP P PPP PP Sbjct: 755 PPPPPPPAVPGEGARPPPPPPPP 777 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 883 PPPXPXXNPPXPXPXXPPPXPPP 951 PPP P P PPP PPP Sbjct: 755 PPPPPPPAVPGEGARPPPPPPPP 777 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 30.3 bits (65), Expect = 2.4 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 881 PPXPPPPXTPPXPXP 925 PP PPPP PP P P Sbjct: 163 PPQPPPPPLPPPPPP 177 Score = 28.7 bits (61), Expect = 7.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 872 SPXPPXPPPPXTPPXP 919 SP P PPPP PP P Sbjct: 161 SPPPQPPPPPLPPPPP 176 >SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) Length = 260 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGG 905 GG GGG G GG GGGG Sbjct: 156 GGRGGGRGHGRGGGSGGGG 174 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGG 879 G GGG GGG G G GG G GGGG Sbjct: 152 GRGGGGRGGGR-GHGRGG---GSGGGG 174 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGG 889 GGG G G G GG GGGG Sbjct: 154 GGGGRGGGRGHGRGGGSGGGG 174 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = -1 Query: 959 GXXGGGXGGGXX---GXGXGGLXX-GXGGGGXXXGGXGXG 852 G GG GGG G G GG+ G GGGG G G G Sbjct: 37 GIAGGRMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRG 76 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = -1 Query: 959 GXXGGGXGGGXX---GXGXGGLXX-GXGGGGXXXGGXGXG 852 G G G GGG G G GG+ G GGGG G G G Sbjct: 57 GMAGEGMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRG 96 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVX-GGGGXGGXGDXGXXXGGXXXGGGA 829 GG G G G G GGGG G G G G GGA Sbjct: 136 GGMAGEGMGGGGMAGEGMGGGGMAGEGMGGGGIAGEGISGGA 177 Score = 28.3 bits (60), Expect = 9.8 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXG----GGGXGGXGDXGXXXGGXXXGGG 832 G G G G G GG+ G GGG G G G G GGG Sbjct: 124 GRGGMAGE-GMGRGGMAGEGMGGGGMAGEGMGGGGMAGEGMGGG 166 >SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) Length = 178 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = -1 Query: 959 GXXGGGXGGG---XXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GGG G G GG G G G G G G Sbjct: 40 GGHGGGHGGGRGRGRGHGHGGDVGGDDGDGGNCDGDGYG 78 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 883 PPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP P +PP P PP PP P Sbjct: 26 PPTDPPTDPPTDPPTDPPTDPPTDPP 51 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 883 PPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP P +PP P PP PP P Sbjct: 30 PPTDPPTDPPTDPPTDPPTDPPTDPP 55 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P + PP PPP P P PPP P Sbjct: 533 PVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPP 564 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P PPP P P PPP Sbjct: 332 PPVTEPAPPSSVVAPPPAVPTPATAPPPVVAPPP 365 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP+ P PP PP P P PPP Sbjct: 326 PSSTVTPPVTEPAPPSSVVAPPPAVP-TPATAPPP 359 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPP---XPXP-XXPPPXPPP 951 P P PP P P P P P PPP PPP Sbjct: 531 PTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPPP 565 >SB_51094| Best HMM Match : VWA (HMM E-Value=0) Length = 3544 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G GGG G G GG GG G G G Sbjct: 3197 GAGEGGGGGGESLAMTVTGLEAGGYSAGGGGGGAG 3231 >SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) Length = 370 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G G G G G G G Sbjct: 258 GDGGGGGGGGDGDGDGDGDGDGDGDGDGDGDGDGDGDG 295 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G G G G G G G Sbjct: 327 GDGGGGDGGGDDGGDGDGDGDGDGDGDGDGDRDGDGDG 364 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGG 882 GGG GGG G G GG G G G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRG 536 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXG 894 G GGG GGG G G GG G Sbjct: 515 GGGGGGGGGGGGGGGRGGRGRG 536 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 952 GGGXXXGXXGGXGGGGXGXGXXG 884 GGG G GG GGGG G G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRG 536 >SB_42044| Best HMM Match : ubiquitin (HMM E-Value=1.2e-06) Length = 1425 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 VP P P P P P P P PPP P Sbjct: 133 VPDPPPKYSTSAPVQPPPAPTPVGSTPSDPPPAP 166 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P P P PP P P P PP P Sbjct: 132 PVPDPPPKYSTSAPVQP---PPAPTPVGSTPSDPPPAP 166 >SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 894 PXPQPPPPXPPXXPXXXPPPXPP 962 P P PPPP PPP PP Sbjct: 583 PPPHPPPPAHHVNKPGVPPPPPP 605 >SB_5925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 671 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P P P P P P P P P P P Sbjct: 170 PVPRSPFPAPHSPLPVPRSPFPAPCSPLPVP 200 >SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) Length = 246 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 +P P PP+ PPPP P + P PP P Sbjct: 157 LPPPSSSPPLSSPPPPPP--STPSSSLLPPPSSSP 189 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P S P P PPPP P PP P Sbjct: 158 PPPSSSPPLSSPPPPPPSTPSSSLLPPPSSSP 189 >SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) Length = 559 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGG-XGGXGDXGXXXGGXXXGGG 832 G GG G G GG G GG GG G GG GG Sbjct: 176 GGFPGGMPGGMPGGMPGGFPGAGGMPGGFPGAGGMPGGFPGAGG 219 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPP 913 P P PP PPPP PP Sbjct: 143 PPPPPPPSPPPPCHPP 158 Score = 28.7 bits (61), Expect = 7.4 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 Query: 881 PPXPPPPXTPPXP 919 PP PPPP +PP P Sbjct: 142 PPPPPPPPSPPPP 154 Score = 28.7 bits (61), Expect = 7.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 907 PPXPXPXXPPPXPPPXXP 960 PP P P PPP PP P Sbjct: 144 PPPPPPSPPPPCHPPALP 161 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 872 SPXPPXPPPPXTPPXPXPXXP 934 +P PP PPP PP P P Sbjct: 141 NPPPPPPPPSPPPPCHPPALP 161 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 900 PQPPPPXPPXXPXXXPPPXP 959 P PPPP P P PP P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 >SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1041 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPX---PXPXXPPPXPPPXXP 960 P P PP P P PP P P P P PP P Sbjct: 413 PQQQPQQQRQSPPQPSPTGAPPQRPHPPPQQPSPRPPMGVP 453 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 SPP P P PP P P P P PP Sbjct: 423 SPPQ-PSPTGAPPQRPHPPPQQPSPRPP 449 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P +P PP P TP P P PP P Sbjct: 654 PLAPYPPKTSPKTTPKPHIPPAPSRPPPQLPP 685 >SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) Length = 287 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 912 GGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG GGGG G G GG GGG Sbjct: 259 GGFGGGGGACGCNGGGAGGGGGYSGGG 285 >SB_1944| Best HMM Match : DUF1482 (HMM E-Value=7.3) Length = 491 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP P P +PP P P P P Sbjct: 431 PRPVPDPPDGQHLSPRPVPDPPDGQHLSPRPVPDP 465 >SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPP 901 PP P P PP PPPP Sbjct: 74 PPQPTPPPPRPPTPPPP 90 >SB_23371| Best HMM Match : SRCR (HMM E-Value=0) Length = 345 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 945 GXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G GG G GD G GG GGG Sbjct: 135 GYAPGDDGDGGGDDGNGGDNNGGGDDGN--GGDNNGGG 170 >SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) Length = 524 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNP-PXPXPXXPPPXPPP 951 P P P P P P P P P P P P P P P Sbjct: 260 PEPEPEPEQEPEPEPEPEPEPEPEPEP-EPEPEPEP 294 >SB_51163| Best HMM Match : Adeno_PIX (HMM E-Value=0.96) Length = 772 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -3 Query: 951 GGGXXX--GXXGXGXGGVXGGGGXGGXGD 871 GGG G G GG+ GGGG GG G+ Sbjct: 512 GGGSHEMGGGMEEGAGGMGGGGGAGGGGE 540 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +1 Query: 853 PXPXPPIXXPPP--PXPXXNPPXPXPXXPPPXPPP 951 P P P + PP P P P P P PPP P Sbjct: 1341 PLPLPRLPLPPLRLPPPHSRLPLPPPKLPPPSRIP 1375 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/39 (35%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXP---XPXXPPPXPPP 951 +P P P+ P P P P P P PP PPP Sbjct: 1333 LPLPPSGLPLPLPRLPLPPLRLPPPHSRLPLPPPKLPPP 1371 >SB_41099| Best HMM Match : VWA (HMM E-Value=0) Length = 3373 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 894 PXPQPPPPXPPXXPXXXPPPXPP 962 P P P P PP P P P PP Sbjct: 103 PQPITPKPVPPTVPTRPPVPRPP 125 >SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 909 PPPXPPXXPXXXPPPXPP 962 PPP PP PPP PP Sbjct: 92 PPPPPPQLENDFPPPPPP 109 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 5/39 (12%) Frame = +1 Query: 847 PXPXPXP-----PIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P P P PPPP NP PPP PP Sbjct: 534 PPPVPKPQFDDTPTRAPPPPDMQTNP--DTERRPPPLPP 570 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP---XPPPXXP 960 P P PP PP P PP P P P P P P Sbjct: 152 PEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKP 192 >SB_40783| Best HMM Match : MH2 (HMM E-Value=0) Length = 494 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P+PPPP PP PP P Sbjct: 136 PRQSEYPRPPPPLPPPFRATDDPPMP 161 >SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) Length = 1042 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 868 PIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P +P P P PPP P P P Sbjct: 1000 PRHFPRAARPPDSPRDPPPITPPPPPVPWFP 1030 >SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +1 Query: 859 PXPPIXXPP-PPXPXXNPPXPX-PXXPPPXPP-PXXP 960 P PP P PP P P P PPP PP P P Sbjct: 137 PPPPAKEAPLPPPPAQQEAVPDIPTSPPPVPPLPTEP 173 >SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) Length = 198 Score = 28.7 bits (61), Expect = 7.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTP 910 PP P P PP PPP P Sbjct: 147 PPRTPPPEPTPPPTPPPLRP 166 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXP 925 P P PP P PP TPP P Sbjct: 143 PVSSPPRTPPPEPTPPPTPPPLRP 166 >SB_45113| Best HMM Match : CemA (HMM E-Value=6) Length = 363 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXG 893 G GGG G G GGGG G G Sbjct: 152 GRGGGGRRGGRGRGGGGGGGEG 173 >SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GG G + G GGGG GG G G Sbjct: 248 GGVGGGSGGIAYGSVFKPVDLGSGGGG-SWGGAGGG 282 >SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) Length = 676 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 GG GGG G G G GGGG G G G Sbjct: 556 GGGGGGDYNGGDGDDDDG-GGGGDDDDGDGDG 586 >SB_32416| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0021) Length = 358 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPP 936 PP PPPP P P P P P Sbjct: 152 PPYQVPPPPTPQPYHPHPYPSSGP 175 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 G GGG G G GG GG G G G G+ Sbjct: 355 GFGGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGGGGS 393 Score = 28.3 bits (60), Expect = 9.8 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G GG GGG GG D G GG GG Sbjct: 338 GNMNSGYNGGPSPGAVGGF--GGGGGGSEDNGASGGGGGYSGG 378 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXGXXGGXRXXG 866 G GG G GG GGGG G G G Sbjct: 343 GYNGGPSPGAVGGFGGGGGGSEDNGASGGGG 373 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 GG G G G GGGG G G GGG+ Sbjct: 354 GGFGGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGGGGS 393 >SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) Length = 483 Score = 28.7 bits (61), Expect = 7.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 872 SPXPPXPPPPXTPPXP 919 SP P PPPP PP P Sbjct: 172 SPSPTPPPPPIIPPCP 187 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P P P PPI P PP P P PPP Sbjct: 175 PTPPP-PPIIPPCPPVINLLIPTARPCMPPP 204 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = +1 Query: 853 PXPXPP-IXXPPP---PXPXXNPPXPXPXXPPPXPP 948 P P P + PPP P P PP P PPP PP Sbjct: 199 PYPGQPGMWGPPPMGGPPPMGGPPGGYP--PPPPPP 232 >SB_11987| Best HMM Match : OTU (HMM E-Value=1.1e-24) Length = 1142 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 894 PXPQPPPPXPPXXPXXXPPPXPP 962 P PQPPPP P P P PP Sbjct: 443 PVPQPPPPAADSIP-TPPQPQPP 464 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGG-GXGXGXXGG 881 G GGG G GG GGG G G G G Sbjct: 84 GDGGGGGDGGGGGDGGGDGDGDGDGDG 110 >SB_1528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2409 Score = 28.7 bits (61), Expect = 7.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 906 PPPPXPPXXPXXXPPPXPP 962 PPP PP PPP PP Sbjct: 1749 PPPSHPPPSSLGSPPPSPP 1767 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 6/42 (14%) Frame = +1 Query: 853 PXPXPPIXXPP-PPXPXX-----NPPXPXPXXPPPXPPPXXP 960 P P PP+ PP PP P PPP PPP P Sbjct: 1423 PAPPPPMAFPPMPPAPGQVITHLQHIVHHKILPPPPPPPAPP 1464 >SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2492 Score = 28.7 bits (61), Expect = 7.4 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G GG+ G G GG G G G G Sbjct: 1208 GGYGGSDGGG--DGGYGGIDSG-GDGGCDGGIDGGGDG 1242 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 875 PXPPXPPPPXTPPXPXPXXPXXXPP 949 P PP PPP PP P P P Sbjct: 1260 PLPPLPPPDAQPPSLPPQPPQPPQP 1284 >SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1321 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P ++PP PQPPP P P PP Sbjct: 882 PPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPP 916 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P ++PP PQPPP P P PP Sbjct: 930 PLPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPP 964 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P ++PP PQPPP P P PP Sbjct: 946 PPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPP 980 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P ++PP PQPPP P P PP Sbjct: 962 PPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPP 996 >SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG GG G GG GG GG G G Sbjct: 338 GGGRGGRGGRPGRGGRGGRGASGGRGRGGGRGGFG 372 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 28.3 bits (60), Expect = 9.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 7/43 (16%) Frame = +1 Query: 853 PXPXPPIXXPPP---PXPXXNPPXPXPXX----PPPXPPPXXP 960 P PP PPP P P PP P PPP P P P Sbjct: 208 PPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPP 250 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +2 Query: 851 PPXXXPXSPXPP--XPPPPXTPPXPXPXXPXXXPPP 952 PP P PP PPP PP P PPP Sbjct: 208 PPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPP 243 >SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) Length = 924 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 853 PXPXPPIXXP-PPPXPXXNPPXPXPXXPPPXPP 948 P P P P PP P PP P P P P Sbjct: 282 PSPQPTEAKPHTPPPPTSTPPTTAPRQPSPMAP 314 >SB_37033| Best HMM Match : Annexin (HMM E-Value=0) Length = 287 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXG 678 P+P G+ P P P P P P PPP S G Sbjct: 42 PQPGGMPMPMPGPYPSSGYPTSV--PGAAPPYGGPPPPVSCG 81 >SB_34601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1391 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXG 867 G G G GG G G G G GG G G Sbjct: 1132 GGNGDGDGGNGDGDGGNGDGDGDGGNGDGDG 1162 >SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P + P PP PP P P PP P Sbjct: 938 PVPVPSMYQPQPPG-IMQPPTSIPPSQPMAPPSFPP 972 >SB_31904| Best HMM Match : Extensin_2 (HMM E-Value=0.5) Length = 398 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 883 PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P + P P P PP PPP P Sbjct: 299 PINLPSASNPSPVPPPPPSVPPPSLP 324 >SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) Length = 129 Score = 28.3 bits (60), Expect = 9.8 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXG-GVXGGGG----XGGXGDXGXXXGGXXXG 838 G GGG G G G G GGGG GG G G GG G Sbjct: 79 GCEGGGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGGGCVG 124 >SB_22851| Best HMM Match : Sad1_UNC (HMM E-Value=0) Length = 1705 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTP 910 PP +P P PPPP TP Sbjct: 1645 PPSAQKRNPIPTPPPPPPTP 1664 >SB_20016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 902 Score = 28.3 bits (60), Expect = 9.8 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPX-PAXAXPPXPKXPXPXXPPPXSXGGXPL 690 P+ SG+ P P P P P P P P P GG PL Sbjct: 829 PQASGVAPPYPLYTPADAAFPPAQAPYPPPYPTPAGGYPPDQGGYPL 875 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 906 PPPPXPPXXPXXXPPPXPP 962 PP PP P PPP PP Sbjct: 198 PPSGAPPPPPIGAPPPPPP 216 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 906 PPPPXPPXXPXXXPPPXPP 962 PPPP P PPP PP Sbjct: 51 PPPPPPRFYDNDIPPPPPP 69 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/28 (42%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +3 Query: 882 PPXXPXP-QPPPPXPPXXPXXXPPPXPP 962 P P P +PPPP PPP PP Sbjct: 190 PDESPEPTRPPPPLDDLDDLPPPPPPPP 217 >SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) Length = 361 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXG 893 G GGG G G GGGG G G Sbjct: 151 GRGGGGRRGGGGCCGGGGGGGG 172 >SB_32762| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 830 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P PP P PP +PP P P P Sbjct: 298 PNTAPSPPNIAPSPPNIAPSPPNTAPSPPHSDP 330 >SB_25705| Best HMM Match : PH (HMM E-Value=2e-17) Length = 409 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 900 PQPPPPXPPXXPXXXPPPXPP 962 P PPPP P PP PP Sbjct: 306 PSPPPPGEKKAPLPTPPSTPP 326 >SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) Length = 278 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXG 893 G GGG G G GGGG G G Sbjct: 68 GRGGGGRRGGGGCCGGGGGGGG 89 >SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2149 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 883 PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P + P P P PP PPP P Sbjct: 2050 PINLPSASNPSPVPPPPPSVPPPSLP 2075 >SB_3180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P +P P P P P P P P PP Sbjct: 255 PTATQPQNPAIPQPQNPAIPQLPNPAIPQPPNPP 288 >SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) Length = 224 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXG 893 G GGG G G GGGG G G Sbjct: 151 GRGGGGRRGGGGCCGGGGGGGG 172 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,380,442 Number of Sequences: 59808 Number of extensions: 331969 Number of successful extensions: 18639 Number of sequences better than 10.0: 222 Number of HSP's better than 10.0 without gapping: 1342 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8020 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2836293838 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -