BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_B05 (962 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 54 2e-07 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 49 5e-06 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 48 7e-06 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 48 1e-05 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 46 4e-05 At2g30560.1 68415.m03722 glycine-rich protein 46 4e-05 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 44 1e-04 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 44 1e-04 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 44 1e-04 At4g01985.1 68417.m00265 expressed protein 44 2e-04 At1g75550.1 68414.m08780 glycine-rich protein 44 2e-04 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 44 2e-04 At1g29380.1 68414.m03592 hypothetical protein 44 2e-04 At5g46730.1 68418.m05757 glycine-rich protein 43 3e-04 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 43 3e-04 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 43 3e-04 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 43 3e-04 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 43 3e-04 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 43 3e-04 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 42 5e-04 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 42 8e-04 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 42 8e-04 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 42 8e-04 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 41 0.001 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 41 0.001 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 41 0.001 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 41 0.001 At5g38560.1 68418.m04662 protein kinase family protein contains ... 40 0.002 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 40 0.002 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 40 0.002 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 40 0.002 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 40 0.002 At2g05510.1 68415.m00583 glycine-rich protein 40 0.002 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 40 0.002 At1g27710.1 68414.m03387 glycine-rich protein 40 0.002 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 40 0.003 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 40 0.003 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 40 0.003 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 40 0.003 At4g18570.1 68417.m02749 proline-rich family protein common fami... 40 0.003 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 40 0.003 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 40 0.003 At2g05440.2 68415.m00575 glycine-rich protein 40 0.003 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 40 0.003 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 40 0.003 At1g26150.1 68414.m03192 protein kinase family protein similar t... 40 0.003 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 40 0.003 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 39 0.004 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 39 0.004 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 39 0.004 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 39 0.004 At1g61080.1 68414.m06877 proline-rich family protein 39 0.004 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 39 0.004 At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid t... 39 0.006 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 39 0.006 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 39 0.006 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 39 0.006 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 39 0.006 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 38 0.008 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 38 0.008 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 38 0.008 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 38 0.008 At2g05440.1 68415.m00574 glycine-rich protein 38 0.008 At4g33660.1 68417.m04781 expressed protein 38 0.010 At4g30460.1 68417.m04325 glycine-rich protein 38 0.010 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 38 0.013 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 38 0.013 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 38 0.013 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 38 0.013 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 38 0.013 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 38 0.013 At5g66400.1 68418.m08374 dehydrin (RAB18) nearly identical to SP... 37 0.017 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 37 0.017 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 37 0.017 At3g50180.1 68416.m05486 hypothetical protein 37 0.017 At1g53625.1 68414.m06096 expressed protein 37 0.017 At1g04800.1 68414.m00476 glycine-rich protein 37 0.017 At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear... 37 0.023 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 37 0.023 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 37 0.023 At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid t... 37 0.023 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 37 0.023 At1g15830.1 68414.m01900 expressed protein 37 0.023 At1g11850.2 68414.m01364 expressed protein 37 0.023 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 36 0.030 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 36 0.030 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 36 0.030 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 36 0.030 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 36 0.030 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 36 0.030 At1g10620.1 68414.m01204 protein kinase family protein contains ... 36 0.030 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 36 0.040 At5g25550.1 68418.m03040 leucine-rich repeat family protein / ex... 36 0.040 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 36 0.040 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 36 0.040 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 36 0.040 At1g62240.1 68414.m07021 expressed protein 36 0.040 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 36 0.040 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 36 0.053 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 36 0.053 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 36 0.053 At1g02710.1 68414.m00222 glycine-rich protein 36 0.053 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 35 0.070 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 35 0.070 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 35 0.070 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 35 0.070 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 35 0.070 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 35 0.070 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 35 0.070 At1g70990.1 68414.m08190 proline-rich family protein 35 0.070 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 35 0.070 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 35 0.070 At1g04660.1 68414.m00463 glycine-rich protein 35 0.070 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 35 0.093 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 35 0.093 At4g39680.1 68417.m05614 SAP domain-containing protein contains ... 35 0.093 At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1... 35 0.093 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 35 0.093 At2g11005.1 68415.m01177 glycine-rich protein 35 0.093 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 35 0.093 At3g51290.1 68416.m05614 proline-rich family protein 34 0.12 At3g24550.1 68416.m03083 protein kinase family protein contains ... 34 0.12 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 34 0.12 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 34 0.12 At2g05530.1 68415.m00585 glycine-rich protein 34 0.12 At1g48100.1 68414.m05368 glycoside hydrolase family 28 protein /... 34 0.12 At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative si... 34 0.12 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 34 0.16 At4g29240.1 68417.m04182 leucine-rich repeat family protein / ex... 34 0.16 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 34 0.16 At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical ... 34 0.16 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 34 0.16 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 33 0.21 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 33 0.21 At4g21720.1 68417.m03145 expressed protein 33 0.21 At4g08230.1 68417.m01358 glycine-rich protein 33 0.21 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 33 0.21 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 33 0.21 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 33 0.21 At1g11850.1 68414.m01363 expressed protein 33 0.21 At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; g... 33 0.28 At5g07190.1 68418.m00819 embryo-specific protein 3, putative sim... 33 0.28 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 33 0.28 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 33 0.28 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 33 0.28 At3g08640.1 68416.m01003 alphavirus core protein family contains... 33 0.28 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 33 0.28 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 33 0.28 At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi do... 33 0.28 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 33 0.28 At1g15840.1 68414.m01901 expressed protein 33 0.28 At5g61660.1 68418.m07736 glycine-rich protein 33 0.37 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 33 0.37 At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar... 33 0.37 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 33 0.37 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 33 0.37 At4g16240.1 68417.m02464 hypothetical protein 33 0.37 At3g21215.1 68416.m02681 RNA-binding protein, putative contains ... 33 0.37 At2g35920.1 68415.m04409 helicase domain-containing protein simi... 33 0.37 At2g28670.1 68415.m03485 disease resistance-responsive family pr... 33 0.37 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 33 0.37 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 33 0.37 At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family... 25 0.40 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 32 0.49 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 32 0.49 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 32 0.49 At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family prot... 32 0.49 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 32 0.49 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 32 0.49 At4g34440.1 68417.m04894 protein kinase family protein contains ... 32 0.49 At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibri... 32 0.49 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 32 0.49 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 32 0.49 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 32 0.49 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 32 0.49 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 32 0.49 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 32 0.49 At1g35617.1 68414.m04424 hypothetical protein 32 0.49 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 32 0.49 At5g67060.1 68418.m08455 basic helix-loop-helix (bHLH) family pr... 32 0.65 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 32 0.65 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 32 0.65 At5g35190.1 68418.m04170 proline-rich extensin-like family prote... 32 0.65 At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 32 0.65 At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi... 32 0.65 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 32 0.65 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 32 0.65 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 32 0.65 At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-conta... 32 0.65 At3g56990.1 68416.m06344 glycine-rich protein conserved hypothet... 32 0.65 At3g49300.1 68416.m05388 proline-rich family protein contains pr... 32 0.65 At3g43583.1 68416.m04636 hypothetical protein 32 0.65 At3g07540.1 68416.m00900 formin homology 2 domain-containing pro... 32 0.65 At2g43800.1 68415.m05445 formin homology 2 domain-containing pro... 32 0.65 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 32 0.65 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 32 0.65 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 31 0.86 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 31 0.86 At4g12490.1 68417.m01974 protease inhibitor/seed storage/lipid t... 31 0.86 At3g46240.1 68416.m05005 protein kinase-related similar to light... 31 0.86 At1g51090.1 68414.m05744 heavy-metal-associated domain-containin... 31 0.86 At1g23540.1 68414.m02960 protein kinase family protein contains ... 31 0.86 At1g18170.1 68414.m02258 immunophilin / FKBP-type peptidyl-proly... 31 0.86 At1g07135.1 68414.m00759 glycine-rich protein 31 0.86 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 31 1.1 At4g37900.1 68417.m05360 glycine-rich protein 31 1.1 At4g12500.1 68417.m01975 protease inhibitor/seed storage/lipid t... 31 1.1 At3g08630.1 68416.m01002 expressed protein 31 1.1 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 31 1.1 At2g40820.1 68415.m05038 proline-rich family protein contains pr... 31 1.1 At1g70250.1 68414.m08082 receptor serine/threonine kinase, putat... 31 1.1 At1g53620.1 68414.m06094 glycine-rich protein 31 1.1 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 28 1.5 At5g63120.2 68418.m07924 ethylene-responsive DEAD box RNA helica... 31 1.5 At5g63120.1 68418.m07925 ethylene-responsive DEAD box RNA helica... 31 1.5 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 31 1.5 At5g22560.1 68418.m02635 hypothetical protein contains Pfam prof... 31 1.5 At5g19910.1 68418.m02369 SOH1 family protein contains Pfam profi... 31 1.5 At3g55950.1 68416.m06217 protein kinase family protein contains ... 31 1.5 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 31 1.5 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 31 1.5 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 31 1.5 At1g54970.1 68414.m06278 proline-rich family protein similar to ... 31 1.5 At1g47660.1 68414.m05295 hypothetical protein 31 1.5 At1g15130.1 68414.m01807 hydroxyproline-rich glycoprotein family... 31 1.5 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 31 1.5 At3g05470.1 68416.m00599 formin homology 2 domain-containing pro... 26 1.8 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 30 2.0 At4g03120.1 68417.m00425 proline-rich family protein similar to ... 30 2.0 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 30 2.0 At3g54580.1 68416.m06039 proline-rich extensin-like family prote... 30 2.0 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 30 2.0 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 30 2.0 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 30 2.0 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 30 2.0 At3g18360.1 68416.m02335 VQ motif-containing protein contains PF... 30 2.0 At3g15400.1 68416.m01954 anther development protein, putative si... 30 2.0 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 30 2.0 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 30 2.0 At2g05540.1 68415.m00586 glycine-rich protein 30 2.0 At1g63600.1 68414.m07189 protein kinase-related low similarity t... 30 2.0 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 30 2.0 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 30 2.0 At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi do... 30 2.0 At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family p... 30 2.0 At1g17790.1 68414.m02202 DNA-binding bromodomain-containing prot... 30 2.0 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 30 2.0 At5g56140.1 68418.m07003 KH domain-containing protein 30 2.6 At4g32340.1 68417.m04603 expressed protein 30 2.6 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 30 2.6 At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar... 30 2.6 At3g46740.1 68416.m05074 chloroplast outer envelope protein, put... 30 2.6 At3g18810.1 68416.m02389 protein kinase family protein contains ... 30 2.6 At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family... 30 2.6 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 30 2.6 At2g24450.1 68415.m02922 fasciclin-like arabinogalactan family p... 30 2.6 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 30 2.6 At1g79480.1 68414.m09263 hypothetical protein low similarity to ... 30 2.6 At1g63550.1 68414.m07184 hypothetical protein low similarity to ... 30 2.6 At1g34000.2 68414.m04216 light stress-responsive one-helix prote... 30 2.6 At1g34000.1 68414.m04215 light stress-responsive one-helix prote... 30 2.6 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 30 2.6 At1g12810.1 68414.m01488 proline-rich family protein contains pr... 30 2.6 At1g11130.1 68414.m01274 leucine-rich repeat family protein / pr... 30 2.6 At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family... 30 2.6 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 29 3.0 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 29 3.5 At5g26070.1 68418.m03102 hydroxyproline-rich glycoprotein family... 29 3.5 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 29 3.5 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 29 3.5 At3g46270.1 68416.m05008 receptor protein kinase-related contain... 29 3.5 At3g26400.1 68416.m03292 eukaryotic translation initiation facto... 29 3.5 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 29 3.5 At3g07195.1 68416.m00858 proline-rich family protein 29 3.5 At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical t... 29 3.5 At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical t... 29 3.5 At2g34670.1 68415.m04259 proline-rich family protein contains pr... 29 3.5 At2g23990.2 68415.m02866 plastocyanin-like domain-containing pro... 29 3.5 At2g23990.1 68415.m02865 plastocyanin-like domain-containing pro... 29 3.5 At2g04190.1 68415.m00404 meprin and TRAF homology domain-contain... 29 3.5 At1g54060.1 68414.m06160 expressed protein similar to 6b-interac... 29 3.5 At1g36675.1 68414.m04563 glycine-rich protein 29 3.5 At1g07310.1 68414.m00778 C2 domain-containing protein contains s... 29 3.5 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 29 4.6 At5g02600.2 68418.m00195 heavy-metal-associated domain-containin... 29 4.6 At5g02600.1 68418.m00196 heavy-metal-associated domain-containin... 29 4.6 At4g19200.1 68417.m02833 proline-rich family protein contains pr... 29 4.6 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 29 4.6 At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (... 29 4.6 At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s... 29 4.6 At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) fa... 29 4.6 At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) fa... 29 4.6 At3g02540.2 68416.m00243 ubiquitin family protein contains Pfam ... 29 4.6 At3g02540.1 68416.m00242 ubiquitin family protein contains Pfam ... 29 4.6 At2g44790.1 68415.m05574 uclacyanin II strong similarity to ucla... 29 4.6 At2g36010.3 68415.m04422 E2F transcription factor-3 (E2F3) ident... 29 4.6 At2g36010.2 68415.m04421 E2F transcription factor-3 (E2F3) ident... 29 4.6 At2g36010.1 68415.m04420 E2F transcription factor-3 (E2F3) ident... 29 4.6 At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F... 29 4.6 At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F... 29 4.6 At1g45688.1 68414.m05202 expressed protein 29 4.6 At1g35880.1 68414.m04457 hypothetical protein 29 4.6 At5g65410.1 68418.m08226 zinc finger homeobox family protein / Z... 29 6.1 At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to ... 29 6.1 At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to ... 29 6.1 At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly id... 29 6.1 At5g60850.1 68418.m07633 Dof-type zinc finger domain-containing ... 29 6.1 At5g53060.1 68418.m06592 KH domain-containing protein 29 6.1 At5g49080.1 68418.m06074 proline-rich extensin-like family prote... 29 6.1 At5g48360.1 68418.m05975 formin homology 2 domain-containing pro... 29 6.1 At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein si... 29 6.1 At4g32285.1 68417.m04593 epsin N-terminal homology (ENTH) domain... 29 6.1 At4g28300.2 68417.m04053 hydroxyproline-rich glycoprotein family... 29 6.1 At4g28300.1 68417.m04052 hydroxyproline-rich glycoprotein family... 29 6.1 At4g15460.1 68417.m02363 glycine-rich protein 29 6.1 At4g08410.1 68417.m01390 proline-rich extensin-like family prote... 29 6.1 At4g03390.1 68417.m00461 leucine-rich repeat transmembrane prote... 29 6.1 At3g57670.1 68416.m06425 zinc finger (C2H2 type) protein (WIP2) ... 29 6.1 At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family... 29 6.1 At3g44950.1 68416.m04843 glycine-rich protein 29 6.1 At3g29390.1 68416.m03693 hydroxyproline-rich glycoprotein family... 29 6.1 At3g13225.1 68416.m01660 WW domain-containing protein contains P... 29 6.1 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 29 6.1 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 29 6.1 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 29 6.1 At1g76880.1 68414.m08946 trihelix DNA-binding protein, putative ... 29 6.1 At1g63570.1 68414.m07186 receptor-like protein kinase-related co... 29 6.1 At1g02460.1 68414.m00195 glycoside hydrolase family 28 protein /... 29 6.1 At5g66960.1 68418.m08442 prolyl oligopeptidase family protein si... 28 8.0 At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) ide... 28 8.0 At5g07150.1 68418.m00815 leucine-rich repeat family protein cont... 28 8.0 At5g06640.1 68418.m00750 proline-rich extensin-like family prote... 28 8.0 At4g23140.2 68417.m03338 receptor-like protein kinase 5 (RLK5) i... 28 8.0 At4g23140.1 68417.m03337 receptor-like protein kinase 5 (RLK5) i... 28 8.0 At4g08400.1 68417.m01388 proline-rich extensin-like family prote... 28 8.0 At3g62680.1 68416.m07041 proline-rich family protein contains pr... 28 8.0 At3g60270.1 68416.m06737 uclacyanin, putative similar to uclacya... 28 8.0 At3g32400.1 68416.m04142 formin homology 2 domain-containing pro... 28 8.0 At3g28790.1 68416.m03593 expressed protein 28 8.0 At2g24980.1 68415.m02987 proline-rich extensin-like family prote... 28 8.0 At2g23770.1 68415.m02839 protein kinase family protein / peptido... 28 8.0 At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family... 28 8.0 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 28 8.0 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 28 8.0 At1g31580.1 68414.m03875 expressed protein identical to ORF1 [Ar... 28 8.0 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 53.6 bits (123), Expect = 2e-07 Identities = 20/38 (52%), Positives = 21/38 (55%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP+ PPPP P PP P PPP PPP P Sbjct: 455 PPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 50.8 bits (116), Expect = 1e-06 Identities = 19/38 (50%), Positives = 20/38 (52%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP+ PPPP P PP PPP PPP P Sbjct: 440 PPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 50.8 bits (116), Expect = 1e-06 Identities = 19/38 (50%), Positives = 20/38 (52%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP+ PPPP P PP PPP PPP P Sbjct: 471 PPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 49.2 bits (112), Expect = 4e-06 Identities = 20/38 (52%), Positives = 21/38 (55%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP+ PPPP P PP P PPP PPP P Sbjct: 427 PPPSPPPPVYSPPPPPP---PPPPVYSPPPPPPPPPPP 461 Score = 45.6 bits (103), Expect = 5e-05 Identities = 37/144 (25%), Positives = 40/144 (27%), Gaps = 8/144 (5%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXX-PPPXSXGGXPLGXXXXXXXXXXXX 729 P PS P PAP P P PP P P P PPP P+ Sbjct: 403 PPPSLPSPPPPAPIFSTP-PTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPP 461 Query: 730 XXXXXXXXXXXXXXXX*XXXXXXXXXXXXXXXXXXXXXVPXPXPXPPIXXPPPPXPXXNP 909 P P P PP+ PPPP +P Sbjct: 462 PVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSP 521 Query: 910 PXPXPXXP-------PPXPPPXXP 960 P P P PP PPP P Sbjct: 522 PPPPSPAPTPVYCTRPPPPPPHSP 545 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PP PP PP P P P PPP P Sbjct: 451 PPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSP 487 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPP P +PP P P PP PPP Sbjct: 591 PPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPP 623 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPX--PPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PP PPPP PP P P PPP P Sbjct: 467 PPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPP 505 Score = 41.5 bits (93), Expect = 8e-04 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 V P P P + PPPP P + P PPP PPP Sbjct: 398 VVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPP 433 Score = 41.5 bits (93), Expect = 8e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P PP PPPP P P P PPP Sbjct: 492 PPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPP 525 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/35 (48%), Positives = 19/35 (54%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P + PPPP P +PP P P PP PPP Sbjct: 581 PPPPIYPYLSPPPPPTPVSSPP-PTPVYSPPPPPP 614 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +2 Query: 872 SPXPPXPPPPX--TPPXPXPXXPXXXPPPXXP 961 SP PP PPPP PP P P P PPP P Sbjct: 425 SPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPP 456 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P PP P PPPP PP PPP PP Sbjct: 438 PPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPP 472 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P PP P P PPPP P PPP PP Sbjct: 459 PPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 3/38 (7%) Frame = +1 Query: 847 PXPXPXP-PIXXPPPPXPXXNPPXPXP--XXPPPXPPP 951 P P P P+ PPPP P PP P P PP PPP Sbjct: 597 PVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPP 634 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P P P PPPP P P PPP PP Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPP 460 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P P PPP PP P P PPP P Sbjct: 452 PPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPP 488 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PPPP PP P P PPP P Sbjct: 438 PPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPP 474 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PPPP PP P P PPP P Sbjct: 439 PPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPP 475 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P +PP P PP P PP PPP PP Sbjct: 412 PPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPP 446 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXP--XXNPPXPXPXXPPPXPPP 951 P P PP PPPP P +PP P PP PPP Sbjct: 541 PPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPP 577 Score = 38.3 bits (85), Expect = 0.008 Identities = 41/207 (19%), Positives = 45/207 (21%), Gaps = 1/207 (0%) Frame = +2 Query: 344 PXPLASXXXPXXRRPRXXFSXHXXTXPTPPAXAXXLXGPSSAFPPXXXXXXXXXXXXXXA 523 P P P P +S P PP P PP Sbjct: 431 PPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPP 490 Query: 524 XPALXXXXXXXXXXXXXXXXXRPTPXAXTLPXQXP-PXPXPXXPXRPPPXPXGAPPXGXX 700 P + P P + P P P P P RPPP P +PP Sbjct: 491 PPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQF 550 Query: 701 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPXXXPXSPX 880 PP P Sbjct: 551 SPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPP---PTPVY 607 Query: 881 PPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P PPPP P P P PPP P Sbjct: 608 SPPPPPPCIEPPPPPPCIEYSPPPPPP 634 Score = 37.9 bits (84), Expect = 0.010 Identities = 34/138 (24%), Positives = 38/138 (27%), Gaps = 2/138 (1%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPLGXXXXXXXXXXXXX 732 P P P P+P P P P + PP P P P PP S P+ Sbjct: 475 PPPPVYSPPPPSPPPPPP-PVYSPPPPPPPPPP--PPVYSPPPPPVYSSPPPPPSPAPTP 531 Query: 733 XXXXXXXXXXXXXXX*XXXXXXXXXXXXXXXXXXXXXVPXPXPXPPIXXPPPPX-PXXN- 906 P P PP PPPP P + Sbjct: 532 VYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSP 591 Query: 907 PPXPXPXXPPPXPPPXXP 960 PP P P PP P P Sbjct: 592 PPPPTPVSSPPPTPVYSP 609 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +3 Query: 867 PXXLSPPXXPXP---QPPPPXPPXXPXXXPPPXPP 962 P SPP P P PPPP PP P PP PP Sbjct: 482 PPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 36.7 bits (81), Expect = 0.023 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +1 Query: 853 PXPXPPIXXPPPPXP--XXNPPXPXPXXPPPXPPP 951 P P PP PPPP P +PP P P PPP Sbjct: 609 PPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPP 643 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PPPP PP P PPP P Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPP 462 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P SPP P P P PP P PPP P Sbjct: 565 PPHSSPPPHSPPPPHSPPPPIYPYLSPPPPP 595 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +1 Query: 553 PRPSGLXPXXPA--PXPXXPXPAXAXPPXPKXPXPXXPPP 666 PRP + P P P P P P + PP P P PPP Sbjct: 394 PRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPP 433 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = +1 Query: 853 PXPXPPIXX--PPPPXPXXNPPXPXP-XXPPPXPPPXXP 960 P P PP+ PPPP + P P P P PPP P Sbjct: 661 PPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAP 699 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 5/38 (13%) Frame = +1 Query: 853 PXPXPPIXX---PPPPXPXXNPPXPXP--XXPPPXPPP 951 P P PP+ PPPP + P P P PP PPP Sbjct: 629 PPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPP 666 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P SPP P PPP PP PPP P Sbjct: 601 PPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPP 634 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 641 PPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPP 675 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 853 PXPXPPIXX-PPPPXPXXNPPXPXPXXPPPXPPP 951 P P P + PPPP +PP P PP P P Sbjct: 704 PPPAPVVHHSPPPPMVHHSPPPPVIHQSPPPPSP 737 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = +1 Query: 859 PXPPIXX--PPPPXPXXNPPXPXPXXPPPXPP 948 P PP+ PPPP +PP P P P PP Sbjct: 714 PPPPMVHHSPPPPVIHQSPPPPSPEYEGPLPP 745 Score = 31.9 bits (69), Expect = 0.65 Identities = 29/129 (22%), Positives = 29/129 (22%), Gaps = 5/129 (3%) Frame = +2 Query: 590 PTPXAXTLP-XQXPPXPXPXXPXRPPPXPXGAPPXGXXXXXXXXXXXXXXXXXXXXXXXX 766 P P T P PP P P P PP P PP Sbjct: 413 PAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPP 472 Query: 767 XXXXXXXXXXXXXXXXXXXXXXXXXXXXPPXXXPXSPXPPXPPP----PXTPPXPXPXXP 934 PP P P PPP P PP P P Sbjct: 473 PPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPV 532 Query: 935 XXXPPPXXP 961 PP P Sbjct: 533 YCTRPPPPP 541 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +3 Query: 858 PXXPXXLSPPXXP--XPQPPPPXPPXXPXXXPPPXP 959 P P + PP P PPP PP PPP P Sbjct: 610 PPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPP 645 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 5/38 (13%) Frame = +1 Query: 853 PXPXPPIXX--PPPPXP---XXNPPXPXPXXPPPXPPP 951 P P PP PPPP P +PP P P PPP Sbjct: 618 PPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPP 655 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P PPP P + P P PPP Sbjct: 692 PPPPPSAPCEESPPPAPVVHHSPPPPMVHHSPPPP 726 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPP--XPPXXPXXXPPPXPP 962 P L PP P P PP P P PPP PP Sbjct: 396 PPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPP 432 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P PP P + PP PP PP PP Sbjct: 611 PPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPP 645 Score = 29.9 bits (64), Expect = 2.6 Identities = 25/116 (21%), Positives = 30/116 (25%) Frame = +1 Query: 343 PXPPCXXXXPPVPXXXXXVLPAXXNRPNXPRQXXXXXXXLFRFPPXXXXXXXXXXXXXXX 522 P PP PP P P P P ++ PP Sbjct: 473 PPPPPPVYSPPPPSPPPPPPPVYSPPPPPP---PPPPPPVYSPPPPPVYSSPPPPPSPAP 529 Query: 523 XXXXXXXXXXPRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPL 690 P P P +P P P + PP P P PPP P+ Sbjct: 530 TPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPI 585 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP SP PP P + P P P PPP Sbjct: 621 PPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPP 654 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 SPP P PP PP P PP P Sbjct: 681 SPPPSPVHYSSPPPPPSAPCEESPPPAP 708 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXP 959 SPP P PP PP PPP P Sbjct: 640 SPPPPPVYYSSPPPPPVYYSSPPPPPP 666 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P PP P PPP Sbjct: 595 PTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPP 632 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPP-XPXXNPPXPXPXXPPPXPPP 951 P P P PPPP P P P P PPP Sbjct: 682 PPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPP 717 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 48.8 bits (111), Expect = 5e-06 Identities = 17/31 (54%), Positives = 19/31 (61%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP+ PPPP P +PP P P PP PPP Sbjct: 511 PPPPVYSPPPPPPVYSPPPPPPVYSPPPPPP 541 Score = 47.2 bits (107), Expect = 2e-05 Identities = 33/139 (23%), Positives = 37/139 (26%), Gaps = 3/139 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPLGXXXXXXXXXXXXX 732 P P P P P P P + PP P P PPP P+ Sbjct: 504 PSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPV 563 Query: 733 XXXXXXXXXXXXXXX*XXXXXXXXXXXXXXXXXXXXXVPXP---XPXPPIXXPPPPXPXX 903 P P P PP+ PPPP P Sbjct: 564 HSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVH 623 Query: 904 NPPXPXPXXPPPXPPPXXP 960 +PP P PPP P P Sbjct: 624 SPPPPVFSPPPPVHSPPPP 642 Score = 46.8 bits (106), Expect = 2e-05 Identities = 17/34 (50%), Positives = 19/34 (55%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP+ PPPP P +PP P PPP PP P Sbjct: 494 PPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSP 527 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/36 (52%), Positives = 20/36 (55%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 V P P PI PPPP P +PP P P PP PPP Sbjct: 498 VHSPPPPSPIHSPPPP-PVYSPPPPPPVYSPPPPPP 532 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ PPPP PP P PP PP P Sbjct: 628 PVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPP 665 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PP+ PPPP P +PP P PP PP Sbjct: 642 PVYSPPPPVYSPPPP-PVKSPPPPPVYSPPLLPP 674 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/35 (48%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPP--XPPP 951 P P PP+ PPP P +PP P PPP PPP Sbjct: 616 PPPPPPVHSPPP--PVFSPPPPVHSPPPPVYSPPP 648 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/41 (43%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP---PPXXP 960 P P PP+ PPP P +PP P PPP P PP P Sbjct: 635 PVHSPPPPVYSPPP--PVYSPPPPPVKSPPPPPVYSPPLLP 673 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPX----PPXXPXXXPPPXPP 962 P P PP P PPPP PP P PPP PP Sbjct: 494 PPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPP 532 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPP---XPXPXXPPPXPPPXXP 960 P P PP+ PPPP PP P P PP PP P Sbjct: 621 PVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSP 661 Score = 36.3 bits (80), Expect = 0.030 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = +3 Query: 879 SPPXXPXPQPPPP----XPPXXPXXXPPPXPP 962 SPP P PPPP PP P PPP PP Sbjct: 492 SPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPP 523 Score = 35.9 bits (79), Expect = 0.040 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 883 PPPXPXXNPPXPXPXXPPPXPPPXXP 960 PPP P +PP P P PP PP P Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSP 518 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P SPP PPP P P PPP PP Sbjct: 587 PPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPP 621 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +2 Query: 851 PPXXXPXSPXPPXPP---PPXTPPXPXPXXPXXXPPP 952 PP P PP PP PP PP P P PPP Sbjct: 518 PPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPP 554 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPX---PPPPXTPPXPXPXXPXXXPPPXXP 961 PP SP PP PPPP P P P PPP P Sbjct: 502 PPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPP 541 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPP---PXPP 962 P P PP P PPPP P P PP P PP Sbjct: 511 PPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPP 548 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +2 Query: 851 PPXXXPXSPXP---PXPPPPXTPPXPXPXXPXXXPPP 952 PP P P P P PPPP P P P P PPP Sbjct: 513 PPVYSPPPPPPVYSPPPPPPVYSPPPPP--PVHSPPP 547 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 6/40 (15%) Frame = +2 Query: 851 PPXXXPXSPXP----PXPPPPXTPPXPX--PXXPXXXPPP 952 PP P P P P PPP +PP P P P PPP Sbjct: 522 PPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPP 561 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXP--XPXXPXXXPPP 952 PP P P PPP +PP P P P PPP Sbjct: 554 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPP 589 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPX--PPPPXTPPXPXPXXPXXXPPPXXP 961 PP SP PP PPPP P P P PP P Sbjct: 587 PPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSP 625 Score = 32.7 bits (71), Expect = 0.37 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 5/39 (12%) Frame = +2 Query: 851 PPXXXPXSPXPP---XPPPPXTPPXP--XPXXPXXXPPP 952 PP SP PP PPP +PP P P P PPP Sbjct: 617 PPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPP 655 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 4/38 (10%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPP----XPXPXXPXXXPPP 952 PP P P PPP +PP P P P PPP Sbjct: 590 PPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPP 627 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPX--PPXXPXXXPPPXPP 962 P SPP PPPP PP P PP PP Sbjct: 641 PPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPP 674 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPX--TPPXP--XPXXPXXXPPP 952 PP P P PPPP +PP P P P PPP Sbjct: 604 PPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPP 641 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPP 953 P P PP P PP PP P PPP Sbjct: 566 PPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPP 597 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPP--XPXPXXPPPXPPPXXP 960 P PP+ PPPP P +PP P PP P P Sbjct: 654 PPPPVKSPPPP-PVYSPPLLPPKMSSPPTQTPVNSP 688 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPX---PPXXPXXXPPPXP 959 P P SP PPPP PP P PPP P Sbjct: 478 PNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPP 514 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXP--PPPXTPPXPXPXXPXXXPPPXXP 961 PP SP PP P PP P P P PP P Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPP 531 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +2 Query: 854 PXXXPXSPXPPX--PPPPXTPPXPXPXXPXXXPPPXXP 961 P SP PP PPPP P P P PP P Sbjct: 632 PPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSP 669 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P PPP PP P P PPP Sbjct: 573 PPPPVHSPPPPVYSPPP--PPVHSPPPPVHSPPP 604 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 6/39 (15%) Frame = +2 Query: 854 PXXXPXSPXPPX--PPPPX--TPPXP--XPXXPXXXPPP 952 P SP PP PPPP +PP P P P PPP Sbjct: 573 PPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPP 611 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 6/39 (15%) Frame = +2 Query: 854 PXXXPXSPXPPX--PPPPX-TPPXP---XPXXPXXXPPP 952 P SP PP PPPP +PP P P P PPP Sbjct: 625 PPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPP 663 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P PP P +PP P PPP Sbjct: 669 PPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPPP 702 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P+P P P PP P PPP Sbjct: 494 PPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPP 531 Score = 28.3 bits (60), Expect = 8.0 Identities = 30/130 (23%), Positives = 33/130 (25%), Gaps = 5/130 (3%) Frame = +1 Query: 298 PXPYSTP**XXIIXLPXPPCXXXXPPVPXXXXXVLPAXXNRPNXPRQXXXXXXXLFRFPP 477 P P +P I P PP PP P P P P + PP Sbjct: 495 PPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPP 554 Query: 478 XXXXXXXXXXXXXXXXXXXXXXXXXPRPSGLXPXXP---APXPXX--PXPAXAXPPXPKX 642 P P P P +P P P P PP P Sbjct: 555 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVY 614 Query: 643 PXPXXPPPXS 672 P PP S Sbjct: 615 SPPPPPPVHS 624 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 48.4 bits (110), Expect = 7e-06 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP PPPP P PP P P PPP PPP P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 48.4 bits (110), Expect = 7e-06 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 4/42 (9%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPP----PXPPPXXP 960 P P P PP PPPP P PP P P PP P PPP P Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 48.4 bits (110), Expect = 7e-06 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PPPP P PP P PP PPP P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 48.0 bits (109), Expect = 9e-06 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PPPP P PP P P P PPP P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 48.0 bits (109), Expect = 9e-06 Identities = 20/37 (54%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPX--PXPXXPPPXPPP 951 P P P PP PPPP P PP P P PPP PPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 46.4 bits (105), Expect = 3e-05 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 SPP P P PPPP PP P PPP PP Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/38 (50%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPP---PXPPP 951 P P P PP PPPP +PP P P PP P PPP Sbjct: 393 PPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP 430 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P P PP PPPP PP P P P PP P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYP 411 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PPPP P PP P P P PPP Sbjct: 415 PPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPP 449 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP--XPPPXXP 960 P P P PP PPPP P P P PPP PPP P Sbjct: 392 PPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXP-PPPXPXXNPPXPXPXXPPP--XPPPXXP 960 P P P PP P PPP P PP P PPP PPP P Sbjct: 400 PPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSP 440 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +2 Query: 872 SPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 SP P PPPP PP P P P PPP P Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPP----XTPPXPXPXXPXXXPPPXXP 961 PP P P PP PPPP +PP P P P PP P Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP 430 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 565 GLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 G P P P P P P PP P P P PPP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P PP P P P PPP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P PP P P PPPP P PP PP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 35.9 bits (79), Expect = 0.040 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXP-PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP P PPP PP P PPP PP P Sbjct: 407 PYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYP 445 Score = 35.1 bits (77), Expect = 0.070 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P P PP P P PPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPP---PXPP 948 P P PP PPPP P P P P P P PP Sbjct: 426 PPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPP 460 Score = 34.7 bits (76), Expect = 0.093 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPP---PXPPXXPXXXPPPXP 959 P P PP P PPP P PP P PPP P Sbjct: 413 PPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPP 449 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P P PP P P PPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +2 Query: 854 PXXXPXSPXP---PXPPPPXTPPXPXPXXPXXXPPP 952 P P SP P P PPPP P P P P PPP Sbjct: 413 PPPPPPSPPPYVYPPPPPPYVYP-PPPSPPYVYPPP 447 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 Query: 593 TPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 +P + P PP P P P PPP P PP Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P P PPP +PP P P P P Sbjct: 421 PPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYP 457 Score = 31.9 bits (69), Expect = 0.65 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 614 PXQXPPXPXPXXPXRPPPXPXGAPP 688 P PP P P P PPP P PP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P PP P P P PPP +PP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPP 414 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPP 663 P P P P P P P P P P P P PP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P + PP P P P PP Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPP 427 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P PP P P PPP P PP Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXP 673 P+P P PP P P P PPP P Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAP 685 P P P PP P P P PPP P P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYP 411 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPX--PKXPXPXXPPP 666 P P P P P P P P PP P P P PP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXP 673 P P P PP P P P PPP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P + PP P PPP P PPP P Sbjct: 418 PSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSP 451 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +1 Query: 574 PXXPAPXPXX---PXPAXAXPPXPKXPXPXXPPPXS 672 P P+P P P P PP P P PPP S Sbjct: 415 PPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPS 450 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P PP PP PP P P P P Sbjct: 426 PPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSP 459 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P+ PP P PPP Sbjct: 392 PPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPP 429 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 3/36 (8%) Frame = +2 Query: 851 PPXXXPXSPXPPX---PPPPXTPPXPXPXXPXXXPP 949 PP P P PP PPPP P P P P Sbjct: 430 PPYVYPPPPSPPYVYPPPPPSPQPYMYPSPPCNDLP 465 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 3/36 (8%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPP---PXPXGAPP 688 P P P PP P P P PP P P PP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P PP P P PP P +PP Sbjct: 389 PPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/39 (51%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXP-XXNPPXPXPXXPPPXPPPXXP 960 P P P P PPPP P PP P P PPP PPP P Sbjct: 52 PEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPP 90 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP--XPPPXXP 960 P P P PP PP P P PP P P PPP PPP P Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLP 101 Score = 47.2 bits (107), Expect = 2e-05 Identities = 21/39 (53%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXP-PIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P P PPPP P PP P P PPP PPP P Sbjct: 50 PSPEPEPEPADCPPPPPP---PPCPPPPSPPPCPPPPSP 85 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P PPPP P +PP P PP PPP P Sbjct: 69 PCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Score = 45.2 bits (102), Expect = 7e-05 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P P PP PPPP PP P P P PPP Sbjct: 58 PADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPP 91 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP P PP P PP P PP P P P Sbjct: 76 PPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPP 113 Score = 41.5 bits (93), Expect = 8e-04 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PPP P P P P PPP PP P Sbjct: 74 PSPPPCPPPPSPPPSPPPPQLP-PPPQLPPPAPPKPQP 110 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P P PP P P PPP PPP P Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPP 81 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P PP PPP P PP P P P P P Sbjct: 85 PPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P SPP P P PPP PP PP PP Sbjct: 68 PPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPP 102 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/39 (51%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPX-PPPPXTPPXPXPXXPXXXPP-PXXP 961 PP P SP PP PPPP PP P P P PP P P Sbjct: 81 PPPSPPPSPPPPQLPPPPQLPP-PAPPKPQPSPPTPDLP 118 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P PPPP P P P P P P P P Sbjct: 78 PCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 5/33 (15%) Frame = +3 Query: 879 SPPXXPXPQPPP-----PXPPXXPXXXPPPXPP 962 +PP P P+P P P PP P PPP PP Sbjct: 45 NPPPSPSPEPEPEPADCPPPPPPPPCPPPPSPP 77 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P P + PP P P PPP Sbjct: 66 PPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPP 103 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P+ P P P P P P+ P P P P PPP Sbjct: 56 PEPADCPPPPPPP-PCPPPPSPPPCPPPPSPPPSPPPP 92 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P PP P+ P P P P Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PP PP P P P P P P Sbjct: 47 PPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPP 83 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPA-XAXPPXPKXPXPXXPPP 666 P P P P+P P P P+ PP P+ P P PP Sbjct: 64 PPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPP 102 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P PP P P P PP P +PP Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPP 86 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P PP P P P P P Sbjct: 78 PCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P PS P P P P P P P P PPP P Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPP 90 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P PP P P P PP P PP Sbjct: 65 PPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPP 97 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P+P P PP P P PP P APP Sbjct: 74 PSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P + P PP P P PPP P P Sbjct: 78 PCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQP 110 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/36 (52%), Positives = 20/36 (55%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 V P P PP PPP P +PP P P PPP PPP Sbjct: 61 VDEPPPPPPTSPPPPSPPPPSPPPPSP--PPPSPPP 94 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/33 (54%), Positives = 19/33 (57%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPP 949 PP P SP PP PPPP +PP P P P PP Sbjct: 64 PPPPPPTSPPPPSPPPP-SPPPPSPPPPSPPPP 95 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/32 (50%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +1 Query: 871 IXXPPPPXPXXNPP--XPXPXXPPPXPPPXXP 960 + PPPP P PP P P PPP PPP P Sbjct: 61 VDEPPPPPPTSPPPPSPPPPSPPPPSPPPPSP 92 Score = 38.3 bits (85), Expect = 0.008 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +2 Query: 875 PXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P PP PPP +PP P P P PP P Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPPPPSPPP 94 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P P PPPP PP P PPP PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPP--PPSPPPPSPP 93 Score = 36.3 bits (80), Expect = 0.030 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 884 PXPPPPXTPPXPXPXXPXXXPPPXXP 961 P PPPP +PP P P P PP P Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPP 89 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P P PP PPP P +PP P P PPP Sbjct: 67 PPPTSPPPPSPPPPSPPPPSPPPPSP--PPP 95 Score = 35.1 bits (77), Expect = 0.070 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPP 953 P P SPP P P PP P P PPP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP-XSXGGXPLG 693 P P P P P PP P P P PPP + G P G Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPPPPAFAVGKTPEG 105 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXP 645 P P P P+P P P P PP P P Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 583 PAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P + PP P P P PPP Sbjct: 64 PPPPPPTSPPPPS-PPPPSPPPPSPPPP 90 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 46.0 bits (104), Expect = 4e-05 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GGG G G GG G GGGG GG G G Sbjct: 15 GGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGG 50 Score = 42.3 bits (95), Expect = 5e-04 Identities = 34/119 (28%), Positives = 35/119 (29%), Gaps = 3/119 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGG-GGXGGXGDXGXXXGGXXXGGGAXXXXXXXXXXXXXXX 784 G G G G G G GG GG GG GG G G GG GGG Sbjct: 3 GKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRSS 62 Query: 783 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXGGAPXGXGGGRXGXXGLG--XGGXCXG 613 G G G GGG+ G G G GG C G Sbjct: 63 YISRDNFESDPKGGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGG 121 Score = 41.5 bits (93), Expect = 8e-04 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXG-GGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG G GGG G G G GG GGG Sbjct: 80 GGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGG 123 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G G GGG G G GG G GGGG G G G Sbjct: 3 GKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGG 40 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG GG G G GG G GGG GG G G G Sbjct: 17 GGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGG 51 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GG G G GG G GGGG GG G G G Sbjct: 88 GGISGGGAGGKSGCG-GGKSGGGGGGGKNGGGCGGGGG 124 Score = 36.3 bits (80), Expect = 0.030 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G G G GG GGG GG G G GG GGG Sbjct: 102 GGGKSG--GGGGGGKNGGGCGGGGGGKGGKSGGGSGGGG 138 Score = 35.5 bits (78), Expect = 0.053 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGG--GGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GG GG G G GG G G Sbjct: 83 GGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKG 127 Score = 35.1 bits (77), Expect = 0.070 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGG---GGXXXGGXGXGXGT 843 G GGG GGG G G GG G GG GG GG G+ Sbjct: 104 GKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGGGYMVAPGS 145 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G GG G GGG G G G G Sbjct: 100 GCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGG 137 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGX----GGXGDXGXXXGGXXXGG 835 G GG G G G G GGGG GG G G GG GG Sbjct: 88 GGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGG 133 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGG 881 GG GG G G GGGG G G GG Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGG 28 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 G G G G GG GGG G G GG G G Sbjct: 92 GGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGG 125 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 G GGG GGG G G G G GGGG G T Sbjct: 113 GKNGGGCGGGGGGKG-GKSGGGSGGGGYMVAPGSNGSST 150 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -3 Query: 687 GGAPXGXGGGRXGXXGLGXGGXCXGRVXAXGVG 589 GG G GGGR G G G G C G + G G Sbjct: 15 GGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGG 47 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G GG G G G G G S G G Sbjct: 11 GGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGG 48 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/38 (47%), Positives = 20/38 (52%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ PPPP P +PP P PPP PP P Sbjct: 585 PVHSPPPPVHSPPPPAPVHSPPPPV-HSPPPPPPVYSP 621 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP+ PPP P +PP P PPP PPP Sbjct: 534 PPPPPPVHSPPP--PVHSPPPPPVYSPPPPPPP 564 Score = 42.3 bits (95), Expect = 5e-04 Identities = 18/41 (43%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP---PPXXP 960 P P PP+ PPPP P + P P PPP P PP P Sbjct: 522 PVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPP 562 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP+ PPPP P +PP P PP PP Sbjct: 601 PVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPP 635 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP--XPPPXXP 960 P P PP+ PPPP PP P PPP PPP P Sbjct: 578 PVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPP 617 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ PPPP P +PP P P P PP P Sbjct: 539 PVHSPPPPVHSPPPP-PVYSPPPPPPPVHSPPPPVFSP 575 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP--XPPP 951 V P P P PPPP P +PP P PPP PPP Sbjct: 547 VHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPP 584 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/43 (44%), Positives = 21/43 (48%), Gaps = 7/43 (16%) Frame = +1 Query: 853 PXPXPPIXXPP-----PPXPXXNPPXPXPXXPPP--XPPPXXP 960 P P PP+ PP PP P +PP P PPP PPP P Sbjct: 559 PPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAP 601 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/46 (41%), Positives = 21/46 (45%), Gaps = 8/46 (17%) Frame = +1 Query: 847 PXPXPXPPIXXPP-----PPXPXXNPPXPXPXXPPPXP---PPXXP 960 P P PP+ PP PP P +PP P P PP P PP P Sbjct: 571 PVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPP 616 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP--XPPP 951 V P P P+ PPPP PP P PPP PPP Sbjct: 593 VHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPP 630 Score = 36.7 bits (81), Expect = 0.023 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPP--XPXXNPPXPXPXXPPPXPP 948 V P P PP+ PPPP P + P PPP PP Sbjct: 609 VHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPP 645 Score = 36.3 bits (80), Expect = 0.030 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +2 Query: 851 PPXXXPXSPXPP--XPPPPXTPPXPXPXXPXXXPPP 952 PP P P PP PPPP P P P PPP Sbjct: 528 PPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPP 563 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PPP P +PP P PPP P P Sbjct: 558 PPPPPPPVHSPPP-PVFSPPPPVYSPPPPVHSPPPP 592 Score = 35.9 bits (79), Expect = 0.040 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P PP PP P +PP P P PP P Sbjct: 592 PVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPP 624 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPX-PPPPXTPPXPXPXXPXXXPPP 952 PP SP PP PPP PP P P PPP Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPP 552 Score = 35.1 bits (77), Expect = 0.070 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 883 PPPXPXXNPPXPXPXXPPPXPPPXXP 960 PPP P +PP P PPP PP P Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPPVHSP 543 Score = 34.7 bits (76), Expect = 0.093 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +2 Query: 851 PPXXXPXSPXPP--XPPPPXTPPXPXPXXPXXXPPP 952 PP SP PP PPPP P P P PPP Sbjct: 535 PPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPP 570 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P PPP PP P P PPP Sbjct: 544 PPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPP 577 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P PPPP P P P PPP Sbjct: 538 PPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPP 571 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 5/39 (12%) Frame = +2 Query: 851 PPXXXPXSPXPP---XPPPPXTPPXP--XPXXPXXXPPP 952 PP P P PP PPP +PP P P P PPP Sbjct: 553 PPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPP 591 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 5/37 (13%) Frame = +3 Query: 867 PXXLSPPXXPXP--QPPPPX---PPXXPXXXPPPXPP 962 P SPP P P PPPP PP PPP PP Sbjct: 528 PPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPP 564 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPX---PXXPXXXPPPXXP 961 P PP PPP +PP P P P PPP P Sbjct: 529 PVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPP 563 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPP---XPPXXPXXXPPP 953 P P PP P PPPP PP P PPP Sbjct: 589 PPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPP 623 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP PP P +PP P P P PP P Sbjct: 519 PPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSP 550 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP+ PPPP P + P P P PP P Sbjct: 551 PPPPVYSPPPPPPPVHSPPPPVF--SPPPPVYSP 582 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P + PP P P PPP Sbjct: 527 PPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPP 564 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P SPP P PPPP PP P PP Sbjct: 545 PPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPP 576 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPX-PPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P P PPPP P P P PP P Sbjct: 607 PPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRP 644 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPP PP P PPP P P Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPP 553 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 4/29 (13%) Frame = +3 Query: 879 SPPXXPXPQPPP----PXPPXXPXXXPPP 953 SPP P PPP P PP P PPP Sbjct: 517 SPPPAPVNSPPPPVYSPPPPPPPVHSPPP 545 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P PP P P PPP Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPP 563 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXP---KXPXPXXPPPXS 672 P P P PAP P P + PP P P P PP S Sbjct: 589 PPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPS 631 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 6/41 (14%) Frame = +1 Query: 847 PXPXPXPPIXXPP----PPXPXXNPPXPXPXXPPP--XPPP 951 P P PP+ PP PP PP P PP PPP Sbjct: 617 PVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPP 657 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P SPP P P PP P PPP P Sbjct: 629 PPSQSPPVVYSPPPRPPKINSPPVQSPPPAP 659 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP P P P P PPP P P Sbjct: 490 PVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPP 527 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P + PP P PPP Sbjct: 605 PPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPP 642 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P PP+ PPP P P PPP P Sbjct: 628 PPPSQSPPVVYSPPPRP-PKINSPPVQSPPPAP 659 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXR-PPPXPXGAPP 688 P P + P PP P P PPP P +PP Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPP 559 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P + P PP P P PP P +PP Sbjct: 551 PPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPP 583 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P + PP P P PPP Sbjct: 582 PPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPP--PPP 617 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/38 (47%), Positives = 20/38 (52%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ PPPP P +PP P P PP PP P Sbjct: 723 PVHSPPPPVQSPPPP-PVFSPPPPAPIYSPPPPPVHSP 759 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 3/34 (8%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP---XPPP 951 P PP+ PPPP P +PP P PPP PPP Sbjct: 735 PPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPP 768 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ PPPP P +PP P PPP P P Sbjct: 791 PVHSPPPPVHSPPPPSPIYSPPPPV-FSPPPKPVTPLP 827 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ PPPP P +PP P PPP P P Sbjct: 755 PVHSPPPPVHSPPPP-PVHSPPPPVHSPPPPVHSPPPP 791 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP+ PPPP P +PP P PPP P P Sbjct: 642 PPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPP 673 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ PPPP P +PP P PPP P P Sbjct: 673 PVYSPPPPVHSPPPP-PVHSPPPPVHSPPPPVHSPPPP 709 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ PPPP PP P P PPP P Sbjct: 770 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSP 807 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP-XPPPXXP 960 P P PP+ PPPP PP P PP PPP P Sbjct: 709 PVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAP 747 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP--XPPP 951 P P PP+ PPPP PP P PPP PPP Sbjct: 784 PVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPP 820 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 5/44 (11%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPX-----PXXNPPXPXPXXPPPXPPPXXP 960 V P P PP+ PPPP P +PP P PPP P P Sbjct: 644 VHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPP 687 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/46 (41%), Positives = 21/46 (45%), Gaps = 8/46 (17%) Frame = +1 Query: 847 PXPXPXPPIXXPP-----PPXPXXNPPXPXPXXPPPXP---PPXXP 960 P P PP+ PP PP P +PP P P PP P PP P Sbjct: 777 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKP 822 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/36 (50%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPP---XPPP 951 P P PI PPPP P +PP P PPP PPP Sbjct: 742 PPPPAPIYSPPPP-PVHSPPPPVHSPPPPPVHSPPP 776 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPP---XPXPXXPPPXPPPXXP 960 P P PP+ PPPP PP P P PP PP P Sbjct: 652 PVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSP 692 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP+ PPPP PP P P PPP Sbjct: 688 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 722 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP+ PPPP PP P P PPP Sbjct: 695 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 729 Score = 36.7 bits (81), Expect = 0.023 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ PPPP +PP P PPP P P Sbjct: 716 PVHSPPPPVHSPPPPVQ--SPPPPPVFSPPPPAPIYSP 751 Score = 36.3 bits (80), Expect = 0.030 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ PPPP PP P PPP P P Sbjct: 666 PMHSPPPPVYSPPPPV-HSPPPPPVHSPPPPVHSPPPP 702 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP+ PPPP PP P P PPP Sbjct: 685 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 715 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP+ PPPP PP P PP PP Sbjct: 659 PVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPP 693 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PPP P +PP P PPP P P Sbjct: 680 PVHSPPPPPVHSPPP-PVHSPPPPVHSPPPPVHSPPPP 716 Score = 35.1 bits (77), Expect = 0.070 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP+ PPPP PP P PPP P P Sbjct: 752 PPPPVHSPPPPVHSP-PPPPVHSPPPPVHSPPPP 784 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = +1 Query: 844 VPXPXPXPPIXXPP----PPXPXXNPPXPXPXXPPPXPPPXXP 960 V P P P PP PP P +PP P PPP P P Sbjct: 681 VHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 723 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXP--XPXXPXXXPPP 952 PP P P PPP +PP P P P PPP Sbjct: 701 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPP 736 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPP--PXPPXXPXXXPPPXP 959 P P PP P PPP PP P PPP P Sbjct: 720 PPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPP 755 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +3 Query: 858 PXXPXXLSPPXXPX--PQPPPPXPPXXPXXXPPPXP 959 P P PP P P PPP P P PPP P Sbjct: 735 PPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPP 770 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P SPP P PPPP P P P PP Sbjct: 729 PPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPP 760 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP SP PP PP PP P P PPP Sbjct: 751 PPPPPVHSPPPPVHSPP-PPPVHSPPPPVHSPPP 783 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = +2 Query: 851 PPXXXPXSPXP--PXPPPPXTPPXP--XPXXPXXXPPP 952 PP P P P PPP +PP P P P PPP Sbjct: 642 PPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPP 679 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P PPP P P P PPP Sbjct: 728 PPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPP 761 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 SPP P PPP P P PPP Sbjct: 641 SPPVHSPPPPPPVHSPPPPVFSPPP 665 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPP 953 P P PP P PP PP P PPP Sbjct: 663 PPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPP 694 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 V P P PI PPPP PP P PP P Sbjct: 799 VHSPPPPSPIYSPPPPV-FSPPPKPVTPLPPATSP 832 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/45 (31%), Positives = 17/45 (37%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P P P+P P P + PP P P P P + P Sbjct: 795 PPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPPATSPMANAPTP 839 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P PPP PP P P PPP Sbjct: 670 PPPPVYSPPPPVHSPPP--PPVHSPPPPVHSPPP 701 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPP-XPXPXXPXXXPPP 952 P SP PP PP P P P P PPP Sbjct: 720 PPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPP 753 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPP--XPPXXPXXXPPP 953 P P PP P PPPP PP P PP Sbjct: 795 PPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPP 828 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPP--XPPXXPXXXPPP 953 P P SPP P PPP P P PPP Sbjct: 639 PQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPP 672 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 6/39 (15%) Frame = +2 Query: 854 PXXXPXSPXPPX--PPPPX--TPPXP--XPXXPXXXPPP 952 P SP PP PPPP +PP P P P PPP Sbjct: 670 PPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPP 708 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P PAP P P PP P P PPP Sbjct: 735 PPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPP--PPP 770 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P PP+ PPP PP P P P Sbjct: 807 PIYSPPPPVFSPPPKPVTPLPPATSPMANAPTP 839 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 8/43 (18%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPP--------XPPXXPXXXPPPXPP 962 P P SP PQPP P P P PPP PP Sbjct: 610 PNDPYDASPIKKRRPQPPSPSTEETKTTSPQSPPVHSPPPPPP 652 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/47 (29%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXP--KXPXPXXPPPXSXGGXP 687 P P+ + P P P P + PP P P P PP P Sbjct: 743 PPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPP 789 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PPPP P + P P PPP PPP Sbjct: 590 PLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPP 624 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/36 (50%), Positives = 19/36 (52%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PPPP P + P P PPP PPP P Sbjct: 572 PPPPPP---PPPPLPSRSIPPPLAQPPPPRPPPPPP 604 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P PP+ P P PP P P PPP PP Sbjct: 574 PPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPP 607 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP PPPP + P P PPP PPP Sbjct: 595 PPPRPPPP---PPPPPSSRSIPSPSAPPPPPPPPP 626 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 5/37 (13%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPP-----XXPXXXPPPXPP 962 P L+ P P P PPPP PP P PPP PP Sbjct: 588 PPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPP 624 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PP PPPP P PPP P Sbjct: 589 PPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPP 625 Score = 36.3 bits (80), Expect = 0.030 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXG 678 P P P P P P P+ P P P P PPP S G Sbjct: 588 PPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFG 629 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +1 Query: 868 PIXXPPPPXPXXNPPXPXPXXPPP--XPPPXXP 960 PI PPP P PP P PPP PPP P Sbjct: 567 PINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRP 599 Score = 35.1 bits (77), Expect = 0.070 Identities = 32/139 (23%), Positives = 34/139 (24%), Gaps = 6/139 (4%) Frame = +1 Query: 553 PRPS-GLXPXXPAPXPXXPXPAXAXPPXPKX-PXPXXPPPXSXGGXPLGXXXXXXXXXXX 726 P PS + P P P P P PP + P P PPP G Sbjct: 581 PLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPP 640 Query: 727 XXXXXXXXXXXXXXXXX*XXXXXXXXXXXXXXXXXXXXXVPXPXPXPP----IXXPPPPX 894 P P P PP P PP Sbjct: 641 PPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPA 700 Query: 895 PXXNPPXPXPXXPPPXPPP 951 P PP PP PPP Sbjct: 701 PPPLPPSSTRLGAPPPPPP 719 Score = 34.7 bits (76), Expect = 0.093 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 8/43 (18%) Frame = +1 Query: 847 PXPXPXPP----IXXPPPPXPXXNPPXPXPXXPP----PXPPP 951 P P P PP + PPPP P P P PP P PPP Sbjct: 699 PAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPP 741 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Frame = +1 Query: 574 PXXPAPXPXXP----XPAXAXPPXPKXPXPXXPPPXS 672 P P P P P P A PP P+ P P PPP S Sbjct: 573 PPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSS 609 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPPP + PPP PPP P Sbjct: 613 PSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPP 648 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP+ P P PP P P P PPP Sbjct: 714 PPPPPPPPLSKTPAP-----PPPPLSKTPVPPPPP 743 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPP---XTPPXPXPXXPXXXPPPXXP 961 P P P PP PP P PP P P PPP P Sbjct: 567 PINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPP 606 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P L P PPPP PP PP PP Sbjct: 698 PPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPP 732 Score = 33.1 bits (72), Expect = 0.28 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPP----PXSXGGXPLG 693 P P P P PA PP K P P PP S G PLG Sbjct: 714 PPPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLG 757 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P P P P P P P P PPP S P Sbjct: 576 PPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIP 613 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 PP PPPP + P PPP PPP Sbjct: 482 PPPPPPPPPPLFTSTTSFSPSQPPPPPPP 510 Score = 32.3 bits (70), Expect = 0.49 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 + PP P P PPPP PP PP Sbjct: 674 VGPPSTPPPPPPPPPKANISNAPKPPAPP 702 Score = 31.9 bits (69), Expect = 0.65 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 884 PXPPPPXTPPXPXPXXPXXXPPPXXP 961 P PPPP PP P PPP P Sbjct: 639 PPPPPPPPPPTRIPAAKCAPPPPPPP 664 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P + P P PPP PP PP PP Sbjct: 684 PPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPP 718 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PPPP + P PPP PPP Sbjct: 501 PSQPPPPPPPPPLFMSTTSFSPSQPPPPPPP 531 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PPPP P PP PPP P Sbjct: 482 PPPP---PPPPPPLFTSTTSFSPSQPPPPPPPPP 512 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXP-------PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP P PPP P + PP PPP P Sbjct: 641 PPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPP 685 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 7/44 (15%) Frame = +2 Query: 851 PPXXXPXSPXPPX-------PPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PP P PP PP P PPP P Sbjct: 676 PPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPP 719 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P P P P PPP PPP Sbjct: 547 PPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPP 581 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 PP P P PP P PPP PP Sbjct: 639 PPPPPPPPPPTRIPAAKCAPPPPPPPP 665 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXPPP 953 L P P PPPP PP P PP Sbjct: 564 LHQPINKTPPPPPPPPPPLPSRSIPP 589 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 875 PXPPXPPPPXTPPXPXPXXPXXXPPP 952 P PP PPPP T P PPP Sbjct: 639 PPPPPPPPPPTRIPAAKCAPPPPPPP 664 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 6/37 (16%) Frame = +1 Query: 859 PXPPIXXPPPP------XPXXNPPXPXPXXPPPXPPP 951 P PP P PP P PP P P P PPP Sbjct: 696 PKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPP 732 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP PPP P PPP PPP Sbjct: 501 PSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPP 533 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PPPP P PP PPP P Sbjct: 658 PPPP---PPPPTSHSGSIRVGPPSTPPPPPPPPP 688 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ P P PPP PPP P Sbjct: 546 PPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPP 581 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P P + P PPP PPP P Sbjct: 546 PPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLP 583 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 PP P + P P PP PP PP Sbjct: 717 PPPPPLSKTPAPPPPPLSKTPVPPPPP 743 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 12/50 (24%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXP------------PPXPPPXXP 960 P P P PP+ PP P P P PP PPP P Sbjct: 484 PPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPP 533 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PPPP + P PPP PP Sbjct: 522 PSQPPPPPPPPPLFTSTTSFSPSQPPPPPP 551 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P+P P P+ P PP K P P PPP S P Sbjct: 696 PKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAP-PPPPLSKTPVP 739 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP PPPP P PP PPP Sbjct: 522 PSQPPP---PPPPPPLFTSTTSFSPSQPPPPPP 551 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 44.0 bits (99), Expect = 2e-04 Identities = 35/124 (28%), Positives = 37/124 (29%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGAXXXXXXXXXXXXXXXX 781 G GG G G G GG GGGG G G G GG GG + Sbjct: 359 GGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGAS-GGASGGASGGASGGVGGAGG 417 Query: 780 XXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXGGAPXGXGGGRXGXXGLGXGGXCXGRVXA 601 G GGA G GGG G G G GG G + Sbjct: 418 AGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGS 477 Query: 600 XGVG 589 G G Sbjct: 478 VGAG 481 Score = 41.5 bits (93), Expect = 8e-04 Identities = 35/124 (28%), Positives = 36/124 (29%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGAXXXXXXXXXXXXXXXX 781 G GG G G G GG+ G GG G G G GG GGGA Sbjct: 55 GGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGG-AIGGGASGGAGGGGKGRGRKGG 113 Query: 780 XXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXGGAPXGXGGGRXGXXGLGXGGXCXGRVXA 601 G GGA G G G G G GG G Sbjct: 114 GGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGA-G 172 Query: 600 XGVG 589 GVG Sbjct: 173 GGVG 176 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXG--DXGXXXGGXXXGGGA 829 GGG G G G GG GGGG G G G GG GGGA Sbjct: 198 GGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGA 240 Score = 39.9 bits (89), Expect = 0.002 Identities = 34/116 (29%), Positives = 34/116 (29%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGAXXXXXXXXXXXXXXXX 781 G GGG G G G GG GG G GG G GG GGG Sbjct: 212 GASGGGGTVGAGGRGSGGASGGVGVGGGA--GGSGGGSVGGGG--RGSGGVGASGGAGGN 267 Query: 780 XXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXGGAPXGXGGGRXGXXGLGXGGXCXG 613 G GGA G GGG G G G GG G Sbjct: 268 VGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGG 323 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G G GG GGGG G G G GG G G Sbjct: 291 GGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAG 333 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G G GG GGGG G G G G GGG Sbjct: 441 GGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGG 483 Score = 38.3 bits (85), Expect = 0.008 Identities = 33/122 (27%), Positives = 34/122 (27%), Gaps = 3/122 (2%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXG-GXXXGGGAXXXXXXXXXXXXXXXXXX 775 GGG G G G GG GG G G G G G GGG Sbjct: 305 GGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGG 364 Query: 774 XXXXXXXXXXXXXXXXXXXXXXXXXXGPXGGAPXGXGGGRXG--XXGLGXGGXCXGRVXA 601 G GGA G GG G G+G G G V A Sbjct: 365 AVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGA 424 Query: 600 XG 595 G Sbjct: 425 GG 426 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G G G GGGG GG G G G Sbjct: 464 GRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVG 501 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GG G G G GG GGGG GG G G G GGA Sbjct: 50 GAGAGGGASGGIGVGGGG-GGGGGIGGSGGVGAGGGVGGGAGGA 92 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGG----GGXGGXGDXGXXXGGXXXGGGA 829 G GGG G GGV GG GG G G G GG GGGA Sbjct: 138 GGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGA 185 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G + G GG G GG G G Sbjct: 502 GGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAG 539 Score = 37.5 bits (83), Expect = 0.013 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGG-GGXGGXGDXGXXXGGXXXGGGA 829 GGG G G G GG GG GG G G GG GGGA Sbjct: 455 GGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGA 496 Score = 37.1 bits (82), Expect = 0.017 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXG--GGA 829 G GG G G GG GGGG G G G GG G GGA Sbjct: 283 GGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGA 328 Score = 37.1 bits (82), Expect = 0.017 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXG--GGA 829 G GG G G GG GGGG G G G GG G GGA Sbjct: 351 GGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGA 396 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G G GG G GG G G G GG G G Sbjct: 462 GGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVG 501 Score = 36.7 bits (81), Expect = 0.023 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = -1 Query: 959 GXXGGGXGG--GXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GG G G G GG G GG GG G G G Sbjct: 450 GAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGG 489 Score = 36.7 bits (81), Expect = 0.023 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GGG G G G V GG G G G G GG GGGA Sbjct: 502 GGVGGGVGGGVRGAVGGAVGGGVGGAGRGS-GGASGGAGAGGGA 544 Score = 36.7 bits (81), Expect = 0.023 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GG G G GG G G GG GG G G Sbjct: 518 GAVGGGVGGA--GRGSGGASGGAGAGGGAGGGVGGG 551 Score = 36.3 bits (80), Expect = 0.030 Identities = 50/217 (23%), Positives = 52/217 (23%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGAXXXXXXXXXXXXXXXX 781 G G G G GG+ GGG GG G G GG GGG Sbjct: 43 GRGSVGVGAGAGGGASGGIGVGGGGGGGGGIG-GSGGVGAGGGVGGGAGGAIGGGASGGA 101 Query: 780 XXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXGGAPXGXGGGRXGXXGLGXGGXCXGRVXA 601 G G GGG G G GG G V Sbjct: 102 GGGGKGRGRKGGGGAGGGVGGGVGAGG---GAGGSVGAGGGIGGGAGGAIGGGASGGVGG 158 Query: 600 XGVGRXXXXXXXXXXXXXXXGXRAGXAXXXXXXXXXXGXXXGGKAEEGPXRXXALAGGVG 421 G GR G A G GG G +GG G Sbjct: 159 GGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGG 218 Query: 420 XVXXCXENXXRGRRXXGXXXXARGXG*XDYGXLLGGR 310 V G A G G G GGR Sbjct: 219 TVGAGGRGSGGASGGVGVGGGAGGSGGGSVGG--GGR 253 Score = 36.3 bits (80), Expect = 0.030 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG G G G G GG G GGG GG G G G Sbjct: 462 GGGRGSGGAGGGTGG-SVGAGGGVGVGGGGGIGGG 495 Score = 36.3 bits (80), Expect = 0.030 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GG G G+ G G GG GG G G G Sbjct: 468 GGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVG 505 Score = 36.3 bits (80), Expect = 0.030 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGG-VXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG V GG G G G G GG G G Sbjct: 485 GVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAG 528 Score = 35.9 bits (79), Expect = 0.040 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G G G G GG GG G G G Sbjct: 242 GSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVG 279 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GG G GG G GG GG G G G Sbjct: 314 GRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVG 351 Score = 35.9 bits (79), Expect = 0.040 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGG--GGXGGXGDXGXXXGGXXXGGGA 829 G GG G G G GG GG GG G G G GG GGA Sbjct: 343 GGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGA 388 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GG G GG G GG G G G G G Sbjct: 390 GGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGG 427 Score = 35.5 bits (78), Expect = 0.053 Identities = 36/136 (26%), Positives = 36/136 (26%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGTXXXXXXXXXXXXXXXXXXVXX 780 G GGG G G G G G GGG G G G V Sbjct: 118 GGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGG 177 Query: 779 *XXXXXXXXXXXXXXXXXXXXXXXXXXXXPRGXPPXEXGGGXXGXGXLGXGGXAXAGXGX 600 RG GGG G G G GG A G G Sbjct: 178 GVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGG-ASGGVGV 236 Query: 599 XGXGAGXXGXSPEGRG 552 G GAG G G G Sbjct: 237 GG-GAGGSGGGSVGGG 251 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GG G G + G G GG GG G G G Sbjct: 318 GGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVG 355 Score = 35.5 bits (78), Expect = 0.053 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 6/44 (13%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXG------XGGGGXXXGGXGXGXG 846 G GGG GGG G G GG G GGGG GG G G G Sbjct: 426 GGVGGGVGGG-VGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSG 468 Score = 35.5 bits (78), Expect = 0.053 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = -3 Query: 948 GGXXXGXXGXGXG-GVXGGGGXGGXGDXGXXXG-GXXXGGG 832 GG G G G G GV GGGG GG G G G GGG Sbjct: 471 GGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGG 511 Score = 35.5 bits (78), Expect = 0.053 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GG G G G G GG GG G G GG G GA Sbjct: 497 GGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGA 540 Score = 35.1 bits (77), Expect = 0.070 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GG G G GG G G GG GG G G Sbjct: 66 GGGGGGGIGGSGGVGAGG-GVGGGAGGAIGGGASGGAG 102 Score = 35.1 bits (77), Expect = 0.070 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G G G G G GG GG G G G Sbjct: 95 GGASGGAGGGGKGRGRKG---GGGAGGGVGGGVGAGGG 129 Score = 34.7 bits (76), Expect = 0.093 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GGV G G G G GG GGG Sbjct: 340 GGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGG 382 Score = 34.7 bits (76), Expect = 0.093 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -1 Query: 959 GXXGGGXG-GGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG G GG G G GG G G GG GG G G G Sbjct: 472 GGTGGSVGAGGGVGVGGGG-GIGGGAGGGVGGGVGGGVG 509 Score = 34.3 bits (75), Expect = 0.12 Identities = 34/124 (27%), Positives = 35/124 (28%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGAXXXXXXXXXXXXXXXX 781 G GG G G G V GGG GG G G GG GGG Sbjct: 318 GGASGGASGGASGGAGGSVGAGGGVGG-GVGGGVGGG--VGGGVGGAVGGAVGGAVGGGG 374 Query: 780 XXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXGGAPXGXGGGRXGXXGLGXGGXCXGRVXA 601 G GGA G GG +G GG G V Sbjct: 375 GGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGV-G 433 Query: 600 XGVG 589 GVG Sbjct: 434 GGVG 437 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGG--GGXXXGGXGXGXG 846 G GG GG G G G G GG GG GG G G G Sbjct: 402 GGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVG 441 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G GG GG G G G G G GGG Sbjct: 505 GGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGG 547 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G G G G G G+ G GGGG G G G G Sbjct: 45 GSVGVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAG 82 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GGG G GG G GG G GG G G Sbjct: 65 GGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASG 99 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -1 Query: 959 GXXGGGXGG--GXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GG G G G GG+ G GG G G G G Sbjct: 238 GGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGG 277 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXG-GXGDXGXXXGGXXXGGG 832 G G G G GGV GG G G G G GG GGG Sbjct: 530 GSGGASGGAGAGGGAGGGVGGGANVGVGVGAGGSTGGGAAGGGG 573 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/35 (48%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGG--GGXXXGGXGXG 852 GGG GGG G G+ G GG GG GG G G Sbjct: 541 GGGAGGGVGGGANVGVGVGAGGSTGGGAAGGGGVG 575 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -1 Query: 950 GGGXG-GGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG G GG G GG G GG GG G G G Sbjct: 312 GGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVG 347 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -1 Query: 959 GXXGGGXGG--GXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GG G G G GG G GG G G G Sbjct: 300 GAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAG 339 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GG G GG G G GG GG G G G Sbjct: 323 GASGGASGGAGGSVGAGG-GVGGGVGGGVGGGVGGGVG 359 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GG G GG G GG GG G G Sbjct: 386 GGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVG 423 Score = 32.3 bits (70), Expect = 0.49 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXG-GXXXGGGA 829 G G G G G GG GGG GG + G G G GGGA Sbjct: 525 GGAGRGSGGASGGAGAGG-GAGGGVGGGANVGVGVGAGGSTGGGA 568 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXG--XXGXGAGXXGXSPEGRG 552 GGG G G +G GG G G G +G G +GRG Sbjct: 70 GGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRG 109 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -1 Query: 959 GXXGGGXGGGXXGXG--XGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G G GG G GG G G G G Sbjct: 304 GGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVG 343 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG G G G GG G G G G GG G G Sbjct: 463 GGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAG 497 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -1 Query: 959 GXXGGGXGGGXXG-XGXGGLXXGXGGGGXXXGGXGXGXGT 843 G GG GGG G G GG G GG G G G+ Sbjct: 296 GAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGS 335 Score = 31.5 bits (68), Expect = 0.86 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGG-XGGXGDXGXXXGGXXXGGG 832 G GG G G GG G GG GG G GG GGG Sbjct: 446 GAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGG 489 Score = 31.5 bits (68), Expect = 0.86 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGX-GXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G G GG G GG GG G G GGG Sbjct: 464 GRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGG 507 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = -1 Query: 959 GXXGGGXGGGXXG-XGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G G GG G GG G G G Sbjct: 364 GAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASG 402 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 G GG G G GGGG G G G G G Sbjct: 364 GAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASG 398 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = -1 Query: 959 GXXGGGXGG--GXXGXGXGGLXXGXGGG--GXXXGGXGXG 852 G GGG GG G G G GG G GG G GG G Sbjct: 368 GAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGG 407 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = -3 Query: 960 GXXGG--GXXXGXXGXGXGGV--XGGGGXGGXGDXGXXXGGXXXGGGA 829 G GG G G G G GG GG GG G G GG GGGA Sbjct: 507 GVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGG--VGGGA 552 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G G G G G GG GG G G G GG GG A Sbjct: 530 GSGGASGGAGAG-GGAGGGVGGGANVGVGVGAGGSTGGGAA 569 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G GG G G G G G G G Sbjct: 102 GGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGG 139 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GG G G G G GG GG G G Sbjct: 326 GGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVG 363 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GG G GG G GG G G G Sbjct: 382 GRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAG 419 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GG G G GGGG G GG G G Sbjct: 472 GGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGG 506 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G G G G G G G GGG GG G G GGA Sbjct: 476 GSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGA 519 Score = 28.7 bits (61), Expect = 6.1 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGX-GGVXGG--GGXGGXGDXGXXXGGXXXGGG 832 G GG G G G GG GG G GG G G G GGG Sbjct: 454 GGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGG 499 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/38 (55%), Positives = 21/38 (55%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G GG G GGGG GG G G G Sbjct: 68 GWGGGGGGGGGGGGGGGG--GGGGGGGWGWGGGGGGGG 103 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G GG G GGGG G G G Sbjct: 75 GGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGG 112 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G G GG GGGG GG G G GG GGG Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGG 98 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -3 Query: 933 GXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G GG GGGG GG G G GG GGG Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G GG G GGGG G G G Sbjct: 73 GGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCG 110 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXG 866 GG GGG G GG GGGG G G GG G Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G GG GGGG GG G G G GGG Sbjct: 63 GSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGG 101 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GG G GG G G GGG Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGG 113 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GGGG G G G G G G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCG 110 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G GG GGGG GG G G G GGG Sbjct: 61 GSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGG 100 Score = 37.1 bits (82), Expect = 0.017 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GGG GG G GG G G Sbjct: 75 GGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKG 117 Score = 36.3 bits (80), Expect = 0.030 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG G G G G G G GGGG G G G Sbjct: 87 GGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREGRG 122 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GGGG G G G G G Sbjct: 80 GGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREGRG 122 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G GG G G G G G EGRG Sbjct: 85 GGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREGRG 122 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXG 573 GGG G G G GG G G G G G G Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWGGGGGG 101 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G GG G G G G G G G Sbjct: 73 GGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCG 110 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/37 (48%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP--XPPP 951 P P PP+ PPPP P +PP P PPP PPP Sbjct: 598 PVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPP 634 Score = 43.2 bits (97), Expect = 3e-04 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP+ PPP +PP P PPP PPP Sbjct: 555 PVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPP 589 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P P PP+ PPPP P +PP P PPP P Sbjct: 583 PPPSPPPPVHSPPPP-PVFSPPPPVFSPPPPSP 614 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/36 (47%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPP---XPPP 951 P P PP+ P PP P +PP P PPP PPP Sbjct: 534 PPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPP 569 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/40 (45%), Positives = 20/40 (50%), Gaps = 6/40 (15%) Frame = +1 Query: 859 PXPPIXXPP---PPXPXXNPPXPXPXXPPP---XPPPXXP 960 P PP+ PP PP P +PP P PPP PPP P Sbjct: 575 PPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSP 614 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/41 (43%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP---XPPPXXP 960 P P PP+ PPPP +PP P PPP PPP P Sbjct: 548 PIYSPPPPVHSPPPPV-YSSPPPPHVYSPPPPVASPPPPSP 587 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP+ PPPP PP P PPP P P Sbjct: 595 PPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPP 628 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P + PPPP PP P P P PPP Sbjct: 568 PPPHVYSPPPPVASPPPPSPPPPVHSPPPPP 598 Score = 36.7 bits (81), Expect = 0.023 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPP 951 P P P PP PP P +PP P PPP PPP Sbjct: 539 PMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPP 577 Score = 36.7 bits (81), Expect = 0.023 Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 4/38 (10%) Frame = +2 Query: 851 PPXXXPXSPXPPX---PPPPX-TPPXPXPXXPXXXPPP 952 PP SP PP PPPP +PP P P P PPP Sbjct: 559 PPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPP 596 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P+ PPPP PP P P PPP Sbjct: 609 PPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPP 641 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 4/38 (10%) Frame = +2 Query: 851 PPXXXPXSPXPP-XPPPPXTPPXP---XPXXPXXXPPP 952 PP SP PP PPP +PP P P P PPP Sbjct: 567 PPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPP 604 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P SPP PPP PP P PPP P Sbjct: 567 PPPPHVYSPPPPVASPPPPSPPP--PVHSPPPPP 598 Score = 31.9 bits (69), Expect = 0.65 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +1 Query: 871 IXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 + P PP P +PP P PPP P P Sbjct: 533 VPPPQPPMPSPSPPSPIYSPPPPVHSPPPP 562 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP SP PP PP P P P PPP Sbjct: 594 PPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPP 627 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PPP P +P P P PP P P Sbjct: 523 PPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPP 560 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPP 953 P P SPP PPPP P PPP Sbjct: 559 PPPPVYSSPPPPHVYSPPPPVASPPPPSPPPP 590 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P + P P P P A PP P P P PP Sbjct: 560 PPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPP 595 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/47 (31%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXP--XXPPPXSXGGXP 687 P P P P P P P + PP P P PPP + P Sbjct: 595 PPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPP 641 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 6/39 (15%) Frame = +2 Query: 854 PXXXPXSPXPP------XPPPPXTPPXPXPXXPXXXPPP 952 P SP PP PPP P P P P PPP Sbjct: 516 PVKNRRSPPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPP 554 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPP 949 PP P P P PPP P P PP Sbjct: 538 PPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPP 570 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +2 Query: 614 PXQXPPXPXPXXPXR-PPPXPXGAPP 688 P PP P P P PPP P +PP Sbjct: 578 PVASPPPPSPPPPVHSPPPPPVFSPP 603 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP+ PPPP +PP PP P Sbjct: 621 PSHSPPPPVYSPPPPT--FSPPPTHNTNQPPMGAP 653 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPP--PXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P P P P P +P P P P P P Sbjct: 461 PKPQPSKPEDSPKPEQPKPEESPKPEQPQIPEPTKPVSPP 500 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPP--XPXPXXPPPXPPPXXP 960 P P PP PPPP PP P P PP P Sbjct: 614 PVYSPPPPSHSPPPPVYSPPPPTFSPPPTHNTNQPPMGAP 653 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G G G GG GGG GG GD G GG GGG Sbjct: 96 GGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGG 134 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG GGG G G GG G GGGG G G G G Sbjct: 114 GGGGGGGDTGAGAGG--GGYGGGGDTGAGGGVGSG 146 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GGG G GG GGGG G G G G Sbjct: 101 GGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGG 135 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 692 PRGXPPXEXGGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 P G GGG G G G GG G G G G G G Sbjct: 94 PPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAG 140 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -2 Query: 961 GGXGGGXXXGXXGGX-GGGGXGXGXXGGXRXXGXXG 857 GG GG G GG GGGG G G G G G Sbjct: 97 GGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYG 132 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = -1 Query: 692 PRGXPPXEXGGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 P G P G G G +G GG G G G G G G + G G Sbjct: 82 PTGGYPPLYGTTPPGGGDVGGGGGGYGG-GTPGGGGGGGGDTGAGAG 127 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -3 Query: 933 GXXGXGXGGVXGGGGX-GGXGDXGXXXGGXXXGGGA 829 G G G V GGGG GG G GG G GA Sbjct: 91 GTTPPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAGA 126 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG G GG G G G GG GGG Sbjct: 196 GAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGG 238 Score = 41.5 bits (93), Expect = 8e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG GGGG GG G G GG GGG Sbjct: 191 GGEGGGAGGGGSHGGAGGYGGGGG-GGSGGGGAYGGGGAHGGG 232 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G G G G GG GG G G G Sbjct: 249 GGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGG 286 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G GG G GG GG G G GG GGG Sbjct: 150 GEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGG 192 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXG---GXGDXGXXXGGXXXGGG 832 G GGG G G G GG GGG G G G G GG GGG Sbjct: 241 GGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGG 286 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G GG G GGGG G G G G Sbjct: 237 GGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSG 274 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGG-VXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GG G G GG GGG GG G G GG GGGA Sbjct: 178 GSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGA 222 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 GGG G G G G G GG GG G G GG GGGA Sbjct: 190 GGGEGGGAGGGGSHG--GAGGYGGGGGGGSGGGGAYGGGGA 228 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GG G G GG G GG GG G G G Sbjct: 241 GGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHG 278 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 GGG GGG G GG G G GG GG G G Sbjct: 168 GGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGG 200 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG GGG G G+ G GG G G Sbjct: 210 GGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYG 252 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG GGG GG G G GG GGG Sbjct: 215 GGSGGGGAYGGGGAHGGGYGSGGGEGG-GYGGGAAGGYGGGGG 256 Score = 37.9 bits (84), Expect = 0.010 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGG--XGGXGDXGXXXGGXXXGGGA 829 G GG G G G GG GGGG GG G G GG GGGA Sbjct: 204 GGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGG--YGGGA 247 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXG--GXXXGGG 832 G GG G G G G GGGG GG G G G G GGG Sbjct: 232 GYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGG 276 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G G GG GGGG G G+ G GG GGG Sbjct: 240 GGGYGGGAAGGYGGGGGGGEGGGGSYG-GEHGGGSGGGHGGGG 281 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 GGG G G GG GG G GG G+ G GG GG Sbjct: 168 GGGHGGGGGGGSAGGAHGGSGYGG-GEGGGAGGGGSHGG 205 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GGG G GG G G GG GG G Sbjct: 169 GGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHG 204 Score = 37.5 bits (83), Expect = 0.013 Identities = 21/45 (46%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGG-GXGGXGDXGXXXGGXXXGGGA 829 G GGG G G G GG GGG G G G G GG GGG+ Sbjct: 221 GAYGGGGAHGG-GYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGS 264 Score = 37.1 bits (82), Expect = 0.017 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G GG G GGGG GG G G Sbjct: 191 GGEGGGAGGGGSHGGAGGYGGG-GGGGSGGGGAYGGGG 227 Score = 36.7 bits (81), Expect = 0.023 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = -1 Query: 959 GXXGG--GXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG G GGG G G GG G GG GG G G G Sbjct: 159 GYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAG 198 Score = 36.3 bits (80), Expect = 0.030 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -3 Query: 951 GGGXXXGXXGXGX---GGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G G GG G G GG G G GG GGG Sbjct: 82 GGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGG 124 Score = 36.3 bits (80), Expect = 0.030 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG GGG GG G GG GG Sbjct: 169 GGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGG 211 Score = 35.5 bits (78), Expect = 0.053 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GGG GG G G G GGG Sbjct: 173 GGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGG 215 Score = 35.5 bits (78), Expect = 0.053 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXG-GXXXGGG 832 G G G G G GG GGG GG G G G G GGG Sbjct: 199 GGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGG 242 Score = 35.1 bits (77), Expect = 0.070 Identities = 20/43 (46%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXG--GGGXGGXGDXGXXXGGXXXGGGA 829 GGG G G G GG G GG GG G G GG GGG+ Sbjct: 161 GGGAYGGGGGHGGGGGGGSAGGAHGGSG-YGGGEGGGAGGGGS 202 Score = 34.7 bits (76), Expect = 0.093 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G GGG G GG G GGG GG G G Sbjct: 148 GAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGG 182 Score = 34.7 bits (76), Expect = 0.093 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -1 Query: 950 GGGXGGGXXGXGX-GGLXXGXGGGGXXXGGXGXGXG 846 GGG GGG G G GG GGGG GG G G Sbjct: 190 GGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGG 225 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXG-GGGXGGXGDXGXXXGGXXXGGG 832 G GG G G GG G GGG GG G G GGG Sbjct: 66 GEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGG 109 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = -1 Query: 959 GXXGGGXGGG---XXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GGG G G GG GGG GG G G Sbjct: 55 GESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGG 93 Score = 33.5 bits (73), Expect = 0.21 Identities = 20/48 (41%), Positives = 22/48 (45%), Gaps = 4/48 (8%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGD-XGXXXG---GXXXGGGA 829 G GGG G G GG GGG GG G+ G G G GGG+ Sbjct: 38 GHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGS 85 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G G GGG G GG GGG G G G G Sbjct: 35 GGGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGG 72 Score = 33.1 bits (72), Expect = 0.28 Identities = 31/116 (26%), Positives = 31/116 (26%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGAXXXXXXXXXXXXXXXX 781 G G G G G G GGGG G G G GGGA Sbjct: 154 GAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGG 213 Query: 780 XXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXGGAPXGXGGGRXGXXGLGXGGXCXG 613 G GGA G GGG G G G GG G Sbjct: 214 GGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGG--GGGGEGGGGSYGG 267 Score = 32.7 bits (71), Expect = 0.37 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = -3 Query: 951 GGGXXXGXXGXGXG-GVXGGGGXGG--XGDXGXXXGGXXXGGGA 829 GGG G G G GGGG GG G G GG GGG+ Sbjct: 90 GGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGS 133 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 G GGG G GG GGG G GG G G Sbjct: 105 GEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGG 139 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG G GG G GGG GG G G Sbjct: 105 GEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAG 138 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GG G GG G GG G G G G Sbjct: 113 GGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAG 150 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G GG GGGG G G G G G Sbjct: 108 GGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAG 150 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G G G G GG GG GGG Sbjct: 130 GGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGG 169 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG G G G G G G GG G G G G Sbjct: 37 GGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYG 74 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G G GGG G G GG GGG Sbjct: 89 GGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGG 131 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G G G GG G G G G Sbjct: 51 GGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHG 88 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GGG G G G GG G G Sbjct: 86 GHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSG 128 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G G G G GGG GG G G GG GG Sbjct: 144 GYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGG 182 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXG-----GGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG G G G GG G GG G G Sbjct: 59 GGYGGGSGEGAGG-GYGGAEGYASGGGSGHGGGGGGAASSGGYASGAG 105 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G G GGGG G G G Sbjct: 84 GSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAG 121 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G G G G GG GGG G G G G GG Sbjct: 148 GAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGG 186 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGX-GAGXXGXSPEGRG 552 GGG G G G GG G G G G G G + G G Sbjct: 214 GGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYG 252 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -3 Query: 918 GXGGVXGGGGXGGX--GDXGXXXGGXXXGG 835 G GG GGGG GG G G GG GG Sbjct: 35 GGGGHGGGGGSGGVSSGGYGGESGGGYGGG 64 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXG---GGGXGGXGDXGXXXGGXXXGGG 832 G G G G G GG G GGG GG G GGG Sbjct: 46 GGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGG 91 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G G G G GGG G G G GGG Sbjct: 54 GGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGG 92 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G G GGG GG G G G G Sbjct: 107 GGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYG 146 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GG G G GG G G G+ G G GGGA Sbjct: 122 GGGGGSGGGGGSAYGAGGEHASGYGNGAGE-GGGAGASGYGGGA 164 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGG-LXXGXGGGGXXXGGXG 858 G GG GGG G GG G G G GG G Sbjct: 122 GGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAG 156 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G G G G G G GGGG GG G G GGA Sbjct: 150 GEGGGAGASGYGGGAYGGGGGHGGGGGGG-------SAGGA 183 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 924 GXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G GG G GG G G GG G G Sbjct: 36 GGGHGGGGGSGGVSSGGYGGESGGGYGGGSG 66 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = -1 Query: 671 EXGGGXXGX---GXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 E GGG G G G GG G G GAG S G G Sbjct: 106 EGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNG 148 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G GG G GG G G G G Sbjct: 117 GGHAGGGGGG--SGGGGGSAYGAGGEHASGYGNGAGEG 152 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G G G GG G G G GG GGG Sbjct: 138 GGEHASGYGNG-AGEGGGAGASGYGGGAYGGGGGHGGGG 175 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP+ PPPP P P P P P P PPP P Sbjct: 146 PPPPVVTPPPPTPTPEAPCP-PPPPTPYPPPPKP 178 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PPP P PP P PPP P P P Sbjct: 93 PYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTP 130 Score = 41.5 bits (93), Expect = 8e-04 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P + PPPP PP P P P P PPP Sbjct: 135 PYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPP 169 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PPP P PP P P P PPP Sbjct: 133 PTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPP 167 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PPPP PP P P PPP P P P Sbjct: 106 PPPPYVKPPPPPTVKPPPPPTPYTPPP-PTPYTP 138 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/36 (50%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPP---XPPP 951 P P P + PPPP P PP P P PPP PPP Sbjct: 113 PPPPPTVKPPPPPTP-YTPPPPTPYTPPPPTVKPPP 147 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P PPPP TP P P P PPP Sbjct: 108 PPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPP 141 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP---PPXXP 960 P P PP PPPP P PP P PPP P PP P Sbjct: 78 PPYTPKPPTVKPPPP-PYVKPPPPPTVKPPPPPYVKPPPPP 117 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP---PPXXP 960 P P PP PPP P PP P PPP P PP P Sbjct: 85 PTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPP 125 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPX-PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PPP PP P PPP P P P Sbjct: 125 PTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAP 163 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPP--XPPPXXP 960 P P P PPPP P PP PPP PPP P Sbjct: 121 PPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTP 158 Score = 36.7 bits (81), Expect = 0.023 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +3 Query: 858 PXXPXXLSPPXXPXP-QPPPPXP--PXXPXXXPPPXP 959 P P + PP P P PPPP P P P PPP P Sbjct: 113 PPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPP 149 Score = 36.7 bits (81), Expect = 0.023 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPP----PXPPP 951 P PP PPPP PP P P PP PPP Sbjct: 114 PPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPP 148 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P P PPP TP P P PPP Sbjct: 116 PPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPP 149 Score = 36.3 bits (80), Expect = 0.030 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P + PP P PPPP P P PPP P Sbjct: 63 PPTVKPPPPYIPCPPPPYTPKPPTVKPPPPP 93 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P PPPP T P P P PPP Sbjct: 100 PPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPP 133 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXP-PXXPXXXPPPXP 959 P + PP P PPPP P P P PPP P Sbjct: 140 PPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTP 171 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 5/39 (12%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPP-----PXPPXXPXXXPPPXP 959 P P + PP P +PPP P PP P PPP P Sbjct: 97 PPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTP 135 Score = 35.9 bits (79), Expect = 0.040 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P + PP P +PPPP P P P PP Sbjct: 105 PPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPP 139 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PPPP PP P P PPP Sbjct: 57 PTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPP 91 Score = 35.1 bits (77), Expect = 0.070 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P PP P P+ P P PP P PPP P Sbjct: 146 PPPPVVTPPPPTPTPEAPCPPPPPTP-YPPPPKP 178 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Frame = +1 Query: 847 PXPXPXPP-IXXPPPPXPXXNP---PXPXPXXPPPXPPPXXP 960 P P PP I PPPP P P P P PP PP P Sbjct: 64 PTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKP 105 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P PP P P P PP P P PPP P Sbjct: 149 PVVTPPPPTPTPEAPCP---PPPPTPYPPPPKP 178 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PPPP P P P PP P Sbjct: 77 PPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKP 113 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PP P P PP P PPP P P Sbjct: 45 PAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPP 85 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P+ P P P P P P P P P PPP Sbjct: 139 PPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPP 176 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXP 925 PP P +P PP PP P PP P P Sbjct: 155 PPTPTPEAPCPPPPPTPY-PPPPKP 178 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P P P PP PP P P PPP Sbjct: 38 PVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPP 70 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPP 936 P P P P PPPP P PP P P P Sbjct: 154 PPPTPTPEAPCPPPP-PTPYPPPPKPETCP 182 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P +P PP PP P P P PPP Sbjct: 74 PCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPP 107 Score = 30.7 bits (66), Expect = 1.5 Identities = 28/128 (21%), Positives = 34/128 (26%), Gaps = 2/128 (1%) Frame = +2 Query: 311 RPPNXXP*SXYPXP-LASXXXPXXRRPRXXFSXHXXTX-PTPPAXAXXLXGPSSAFPPXX 484 +PP P + P P P P ++ T P PP P+ PP Sbjct: 50 KPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPP 109 Query: 485 XXXXXXXXXXXXAXPALXXXXXXXXXXXXXXXXXRPTPXAXTLPXQXPPXPXPXXPXRPP 664 P +P P P PP P P P PP Sbjct: 110 YVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPP--PPTPTPEAPCPPP 167 Query: 665 PXPXGAPP 688 P PP Sbjct: 168 PPTPYPPP 175 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P+ P P P P PP P P PPP Sbjct: 131 PPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPP 168 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPP---PPXPPXXPXXXPPPXPP 962 P P PP P PP PP P P PP PP Sbjct: 132 PPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPP 169 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXP-PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P PPP PP P PP PP P Sbjct: 63 PPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPP 101 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPP 663 P P + P P P P P P P P P P P Sbjct: 146 PPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKPETCP 182 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PPP P P PPP P Sbjct: 91 PPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTP 127 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P+ P P P P P P PP P P P P P Sbjct: 123 PPPTPYTP--PPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCP 165 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXP 935 P PP P P PPPP P P Sbjct: 160 PEAPCPPPPPTPYPPPPKPETCP 182 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP PP P P P PPP P Sbjct: 41 PPKHPAKPPKPPTVKPPTHTPKPPTVKP---PPPYIP 74 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P + P P P P P PP P P P PPP Sbjct: 98 PPPPTVKPPPP-PYVKPPPPPTVKPPPP--PTPYTPPP 132 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P L PP P P PPP PP P PPP PP Sbjct: 1093 PPPPAALFPPLPPPPSQPPP-PPLSPPPSPPPPPP 1126 Score = 41.5 bits (93), Expect = 8e-04 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PPPP PP P P PP PPP P Sbjct: 1081 PPSPPLPPSSLPPPPPAALFPPLPPPPSQPP-PPPLSP 1117 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 858 PXXPXXLSPPXXPX-PQPPPPXPPXXPXXXPPPXP 959 P P PP P P PPPP PP P PPP P Sbjct: 1062 PPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPP 1096 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 +P P PP PP P PP P PP PPP P Sbjct: 1072 LPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQP 1110 Score = 36.3 bits (80), Expect = 0.030 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 559 PSGLXPXXPAP-XPXXPXPAXAXPPXPKXPXPXXPPP 666 PS L P PA P P P PP P P P PPP Sbjct: 1088 PSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPP 1124 Score = 35.9 bits (79), Expect = 0.040 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P PP PP P +PP P P P PP P Sbjct: 1065 PQESPPPLPPLPPSPPPPSPPLPPSSLPPPPP 1096 Score = 35.5 bits (78), Expect = 0.053 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPX----PPXXPXXXPPPXPP 962 P P SPP P PPPP PP P PP PP Sbjct: 1076 PPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPP 1114 Score = 34.7 bits (76), Expect = 0.093 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ PP P P +PP P PPP P P Sbjct: 1069 PPPLPPL--PPSPPP-PSPPLPPSSLPPPPPAALFP 1101 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P PP P P PP P P PPP Sbjct: 1094 PPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPP 1127 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXS 672 P P+ L P P P P P + PP P P P PP S Sbjct: 1094 PPPAALFPPLPPPPSQPPPPPLSPPPSP--PPPPPPPSQS 1131 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +1 Query: 853 PXPXPPIXXPPPPX-PXXNPPXPXPXXPPP 939 P P PP PPPP P PP P P PPP Sbjct: 1102 PLPPPPSQPPPPPLSP---PPSPPPPPPPP 1128 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPX--PAXAXPPXPKXPXPXXPPPXSXGGXP 687 P L P P+P P P P+ PP P P PPP S P Sbjct: 1069 PPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPP 1113 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P PPPP P P P PPP Sbjct: 1080 PPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPP 1113 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P A P PP P P PPP P PP Sbjct: 1094 PPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPP 1126 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P P P P PA PP P P PPP S P Sbjct: 1077 PSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSP 1121 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P P P PPP +PP P P PPP Sbjct: 1065 PQESPPPLPPLPPSPPPPSPPLPPSSLP--PPPP 1096 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXP 919 PP P P P P PP PP P Sbjct: 1106 PPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 553 PRPSGLXPXXP-APXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P +P P P P PP P P PPP Sbjct: 1056 PLPEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPP 1094 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 583 PAPXPXXPXPAXAXPPXPKXPXPXXPPPXS 672 P P P P + PP P P P PPP S Sbjct: 1056 PLPEDSPPLPQESPPPLP--PLPPSPPPPS 1083 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PPPP P PP P PPP PPP Sbjct: 673 PLPGGGPP---PPPPPPGGGPPPPPGGGPPPPPPP 704 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P PP PP PP P P PPP Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P P P PP PPPP P PP P PPP Sbjct: 679 PPPPPPPPGGGPPPP-PGGGPP---PPPPPP 705 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 611 LPXQXPPXPXPXXPXRPPPXPXGAPP 688 LP PP P P PPP P G PP Sbjct: 674 LPGGGPPPPPPPPGGGPPPPPGGGPP 699 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P P PPPP P P P PPP P Sbjct: 668 PSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPP 703 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P PP P P PP PP PPP P Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 PR +G P P P PP P P PPP G P Sbjct: 656 PRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPP 700 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 VP P P P PP P PPP PPP Sbjct: 651 VPRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPP 686 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPK--XPXPXXPPPXSXG 678 PS P P P P PP P P P PPP + G Sbjct: 668 PSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPPGALG 709 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P P PPPP P P PPP P Sbjct: 668 PSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPP 704 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGG 681 P P G P P P P P P P P P + GG Sbjct: 673 PLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPPGALGRGAGGG 715 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P SP PP PPPP PP P P P PPP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPP---PPP 64 Score = 41.9 bits (94), Expect = 6e-04 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +3 Query: 885 PXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P PPPP PP P PPP PP Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 41.5 bits (93), Expect = 8e-04 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 PP+ PP P PP P P PPP PPP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPP 63 Score = 41.5 bits (93), Expect = 8e-04 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 PP P PPPP PP P PPP PP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPP 61 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PP PPPP PP PPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 L P P P PPPP PP P PPP P Sbjct: 37 LFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 37.9 bits (84), Expect = 0.010 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXP 934 PP P PP PPPP PP P P P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPP 62 Score = 36.3 bits (80), Expect = 0.030 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 5/39 (12%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXP-----XPXXPPPXPP 948 P P P PP PPPP P PP PPP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P ++ P PPPP PP P PPP PP Sbjct: 75 PPPPPPVTDMIKPLSSPPPPQPP--PRSQPPPKPP 107 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP+ P PP P P PP PP Sbjct: 75 PPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPP 107 Score = 32.3 bits (70), Expect = 0.49 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 614 PXQXPPXPXPXXPXRPPPXPXGAPP 688 P PP P P P PPP P PP Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPP 63 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PP PPP P N P P PPP P Sbjct: 91 PPPPQPPPRSQPPPKPPQKNLPRRHP--PPPRSP 122 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +2 Query: 872 SPXPPXPPPPXTPP--XPXPXXPXXXPPP 952 SP PP PPP PP P P PPP Sbjct: 90 SPPPPQPPPRSQPPPKPPQKNLPRRHPPP 118 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 583 PAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P PP P P P PPP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPP 62 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 9/44 (20%) Frame = +1 Query: 847 PXPXPXPP---------IXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP I PPPP P P PPP PPP Sbjct: 57 PPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSP--PPPQPPP 98 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 568 LXPXXPAPXPXXPXPAXAXPPXPKXPXP 651 L P P P P P P PP P P P Sbjct: 37 LFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 626 PPXPXPXXPXRPPPXPXGAPP 688 PP P P P PPP P PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPP 64 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 589 PXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P PP P P P PPP Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 596 PXAXTLPXQXPPXPXPXXPXRPPPXP 673 P + P PP P P P PPP P Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 614 PXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P P P PPP P PP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPP 59 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 614 PXQXPPXPXPXXPXRPPPXPXGA 682 P PP P P P PPP P A Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPA 65 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP P PP P PP P P PPP P Sbjct: 51 PPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPP 88 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PP PPPP PP P P PPP PP Sbjct: 58 PSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P + PPP P PP P PPP PPP Sbjct: 43 PCLQNQPPPPPSPPPPSCTPSPPPPSPPP 71 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P P P PP P PP P P PP Sbjct: 50 PPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPP 84 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P + + PP P P P PPP Sbjct: 55 PPPPSCTPSPPPPSPPPPKKS-SCPPSPLPPPPPPPPP 91 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXP----XPXXPXXXPPPXXP 961 PP P P PPPP +PP P P P PPP P Sbjct: 51 PPPSPPPPSCTPSPPPP-SPPPPKKSSCPPSPLPPPPPPPP 90 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPP 950 P P S P P P PPPP PP PP Sbjct: 69 PPPPKKSSCPPSPLPPPPPPPPPNYVFTYPP 99 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P PP P P P P PPP P Sbjct: 49 PPPP---PSPPPPSCTPSPPPPSPPPPKKSSCPP 79 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 903 QPPPPXPPXXPXXXPPPXPP 962 QPPPP P P P P PP Sbjct: 48 QPPPPPSPPPPSCTPSPPPP 67 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 894 PXPQPPPPXPPXXPXXXPPPXPP 962 P P P PP P P PP PP Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPP 71 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 6/45 (13%) Frame = +1 Query: 844 VPXPXPXPPIXX-PPPPXPXXNPPXPXPXXP-----PPXPPPXXP 960 +P PP PPPP +PP P P P PP P P P Sbjct: 42 IPCLQNQPPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPP 86 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/35 (57%), Positives = 20/35 (57%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG GGG G G GG G GGGG GG G G G Sbjct: 148 GGGYGGGGGGYGGGG-GYGGGGGGYGGGGRGGGGG 181 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G GGG GG G G GG G GGGG GG G Sbjct: 149 GGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/41 (51%), Positives = 22/41 (53%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 GGG G G G GG GGGG GG G G GG GGG+ Sbjct: 148 GGGYGGGGGGYGGGGGYGGGG-GGYGGGGRGGGG---GGGS 184 Score = 35.5 bits (78), Expect = 0.053 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 5/41 (12%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXG-----GLXXGXGGGGXXXGGXGXG 852 G GGG GG G G G G G GGGG GG G G Sbjct: 84 GNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGG 124 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXG 866 GG GGG G G GGGG G G GG G Sbjct: 152 GGGGGGYGGGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 34.7 bits (76), Expect = 0.093 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGG-GGXGGXGDXGXXXGGXXXGG 835 G GGG G G G GG GG G GG G G GG GG Sbjct: 84 GNSGGGSSGGRGGFG-GGRGGGRGSGGGYGGGGGGYGGRGGGG 125 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG G G GG G GGG GG G G G Sbjct: 84 GNSGGGSSG-GRGGFGGGRGGGRGSGGGYGGGGG 116 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 933 GXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G GG GGG G G G GG GGG Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGG 180 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 952 GGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GGG G GG GGGG G GG G G Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGG 178 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXG 865 GGG G G G GG GGGG G G Sbjct: 161 GGGYGGGGGGYGGGGRGGGGGGGSCYSCG 189 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -1 Query: 662 GGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GG G G G GG +G G G G G G GRG Sbjct: 92 GGRGGFGG-GRGGGRGSGGGYGGGGGGYGGRGGGGRG 127 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEG 558 GGG G G G GG G G G G G G G Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 692 PRGXPPXEXGGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 P G P GG G G GG G G G G G G GRG Sbjct: 77 PDGAPVQGNSGGGSSGGRGGFGGGRGGGRG-SGGGYGGGGGGYGGRG 122 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXG-XGXXGGXRXXGXXG 857 G GGG G GG GGGG G G G G G Sbjct: 157 GYGGGGGYGGGGGGYGGGGRGGGGGGGSCYSCGESG 192 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 933 GXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G GGG GG G G GG GG Sbjct: 76 GPDGAPVQGNSGGGSSGGRGGFGGGRGGGRGSGG 109 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXS 567 GGG G G G G G G G G G G S Sbjct: 152 GGGGGGYGGGGGYGGGGGGYGGGGRGGGGGGGS 184 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 41.5 bits (93), Expect = 8e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG G G GG G G GG GGG Sbjct: 40 GASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGG 82 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G G G GGG GG G G G GGG Sbjct: 26 GGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGG 65 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G G GGG G G G GGG G G G G Sbjct: 19 GGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGG 56 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG G G G GG GG GG G G G Sbjct: 24 GGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGG 58 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXG 899 GG GGG G GG G GG G Sbjct: 63 GGGGGGYQGGDRGGRGSGGGG 83 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 41.5 bits (93), Expect = 8e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG G G GG G G GG GGG Sbjct: 40 GASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGG 82 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G G G GGG GG G G G GGG Sbjct: 26 GGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGG 65 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G G GGG G G G GGG G G G G Sbjct: 19 GGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGG 56 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG G G G GG GG GG G G G Sbjct: 24 GGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGG 58 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXG 899 GG GGG G GG G GG G Sbjct: 63 GGGGGGYQGGDRGGRGSGGGG 83 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 41.5 bits (93), Expect = 8e-04 Identities = 21/45 (46%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGX--GGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GGG GG G+ G GG GGG Sbjct: 35 GGAGGGEWGGAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGG 79 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GG GG G GG G GGGG GG G G G Sbjct: 35 GGAGGGEWGGAEGGGAWGGGGGGGGAWGGEGEGGG 69 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G GG GGG GG G G GG GGG Sbjct: 27 GYEGEEEWGGAGGGEWGGAEGGGAWGGGGGGGGAWGGEGEGGG 69 Score = 37.1 bits (82), Expect = 0.017 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GG G G GG G G GG GG G G G Sbjct: 44 GAEGGGAWGG--GGGGGGAWGGEGEGGGEWGGGGEGGG 79 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GG GGG G G G G GGG GG G G G Sbjct: 48 GGAWGGGGGGGGAWG-GEGEGGGEWGGGGEGGGGG 81 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXG 874 G GGG G G G GG GGGG GG G Sbjct: 53 GGGGGGGAWGGEGEG-GGEWGGGGEGGGG 80 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 GGG GG G G GG G GG G G G Sbjct: 54 GGGGGGAWGGEGEGGGEWGGGGEGGGGGRRG 84 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GGG G G GGGG GG G Sbjct: 49 GAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGGGRRG 84 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G GG GGG G G G GGG GG G Sbjct: 48 GGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGGG 81 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ PPPP P P P PPP P P P Sbjct: 75 PAPVPPVS-PPPPTPSVPSPTPPVSPPPPTPTPSVP 109 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P +P PP PPP TP P P P PPP Sbjct: 74 PPAPVPPVSPPPPTPSVPSPTPPVSPPPP 102 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP+ PPPP P + P P P PP P P Sbjct: 91 PSPTPPVS-PPPPTPTPSVPSPTPPVSPPPPTP 122 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP+ PPPP P + P P P PP P P Sbjct: 109 PSPTPPVS-PPPPTPTPSVPSPTPPVSPPPPTP 140 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P + P PP P P P P PP P P Sbjct: 154 PPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTP 188 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/35 (48%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +1 Query: 853 PXPXPPIXXPPP-PXPXX-NPPXPXPXXPPPXPPP 951 P P PP+ PPP P P +P P P P P PPP Sbjct: 145 PSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPP 179 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 VP P P P P P P +PP P P P PP P Sbjct: 162 VPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTP 200 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPX--TPPXPXPXXPXXXPPP 952 PP SP PP PPP TP P P P PPP Sbjct: 85 PPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPP 120 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P + P PP PP P P P P PP P Sbjct: 100 PPPTPTPSVPSPTPPVSPP-PPTPTPSVPSPTPPVSPP 136 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P + P PP PP P P P P PP P Sbjct: 118 PPPTPTPSVPSPTPPVSPP-PPTPTPSVPSPTPPVSPP 154 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP+ PPPP P + P P P P P P P Sbjct: 173 PMPSPPPPV-SPPPPTPTPSVPSP-PDVTPTPPTPSVP 208 Score = 37.1 bits (82), Expect = 0.017 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP-PPXXP 960 VP P PP P P P +PP P P P P PP P Sbjct: 78 VPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP 117 Score = 36.7 bits (81), Expect = 0.023 Identities = 18/36 (50%), Positives = 19/36 (52%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ PPPP P P P P PP PPP P Sbjct: 127 PSPTPPVS-PPPPTP--TPSVPSP-TPPVSPPPPTP 158 Score = 36.7 bits (81), Expect = 0.023 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP-PXXP 960 P P P P + P PP PP P P P P PP P P Sbjct: 136 PPPTPTPSVPSPTPPVSPP-PPTPTPSVPSPTPPVPTDP 173 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 V P P P + P PP PP P P P P PP P Sbjct: 81 VSPPPPTPSVPSPTPPVSPP-PPTPTPSVPSPTPPVSPP 118 Score = 35.9 bits (79), Expect = 0.040 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 4/38 (10%) Frame = +2 Query: 851 PPXXXPX--SPXPPXPPPPX--TPPXPXPXXPXXXPPP 952 PP P SP PP PPP TP P P P PPP Sbjct: 101 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPP 138 Score = 35.9 bits (79), Expect = 0.040 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 4/38 (10%) Frame = +2 Query: 851 PPXXXPX--SPXPPXPPPPX--TPPXPXPXXPXXXPPP 952 PP P SP PP PPP TP P P P PPP Sbjct: 119 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPP 156 Score = 35.5 bits (78), Expect = 0.053 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 880 PPPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP P P +PP P P P P PP P Sbjct: 74 PPAPVPPVSPPPPTPSVPSPTPPVSPP 100 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P SP PP PPP TP P P P P P Sbjct: 170 PTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTP 205 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP P P P P +PP P P P P P P Sbjct: 131 PPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVP 170 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXS 672 P P + P P P P P P PP P P P PPP S Sbjct: 147 PTPP-VSPPPPTPTPSVPSPT---PPVPTDPMPSPPPPVS 182 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P PP T P P P P PPP Sbjct: 153 PPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPP 186 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXP-PPXXP 960 P P PP P P P P +PP P P P P PP P Sbjct: 95 PPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP 135 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXP-PPXXP 960 P P PP P P P P +PP P P P P PP P Sbjct: 113 PPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP 153 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPP--PPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P PP PP P P P P P P P P Sbjct: 138 PTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSP 177 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXN-PPXPXPXXPPP-XPPPXXP 960 P P PP P P P P P P PPP PPP P Sbjct: 149 PPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTP 188 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P SP PP P P P P P P P P Sbjct: 91 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVP 127 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P SP PP P P P P P P P P Sbjct: 109 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVP 145 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P SP PP P P P P P P P P Sbjct: 127 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVP 163 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P+P P P PP P P P P P Sbjct: 153 PPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTP 190 Score = 32.3 bits (70), Expect = 0.49 Identities = 31/140 (22%), Positives = 32/140 (22%), Gaps = 4/140 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPLGXXXXXXXXXXXXX 732 P P + P P P P P P P P P P P P P Sbjct: 111 PTPP-VSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPV 169 Query: 733 XXXXXXXXXXXXXXX*XXXXXXXXXXXXXXXXXXXXXVPXP---XPXPPI-XXPPPPXPX 900 VP P P PP P PP Sbjct: 170 PTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVT 229 Query: 901 XNPPXPXPXXPPPXPPPXXP 960 PP P P PP P Sbjct: 230 PTPPTPPSVPTPSGSPPYVP 249 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P P P P P P P PPP P Sbjct: 88 PSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 122 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P + P P P P P P P P P P P P Sbjct: 93 PTPP-VSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSP 129 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P P P P P P P PPP P Sbjct: 106 PSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 140 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPX-PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP P PP P P P P PP PP Sbjct: 218 PTPSVPSPPDVTPTPPTP---PSVPTPSGSPPYVPP 250 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXP-PPXPP 962 P P SPP P PP P P P P PP PP Sbjct: 202 PPTPSVPSPPDV-TPTPPTPSVPSPPDVTPTPPTPP 236 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P P P PP P P P P P P Sbjct: 210 PPDVTPTPPTPSVPSPPDVTPTP-PTPPSVPTPSGSP 245 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P P P P P P PP P PPP P Sbjct: 74 PPAPVPPVSPPPPTPSVPSPTPPVSP---PPPTP 104 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 4/38 (10%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXP----PXXPXXXPPPXP 959 P P SP P PP P P P P PPP P Sbjct: 85 PPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 122 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAP-XPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P+P P P P P P P PPP Sbjct: 99 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPP 137 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +2 Query: 851 PPXXXPXSPXPPXP------PPPXTPPXPXPXXPXXXPPPXXP 961 P P SP PP P PP TP P P P PP P Sbjct: 175 PSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVP--SPPDVTP 215 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXP-XXPXXXPPP 952 PP SP P PP P P P P PPP Sbjct: 217 PPTPSVPSPPDVTPTPPTPPSVPTPSGSPPYVPPP 251 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 583 PAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P P P P P Sbjct: 84 PPPTPSVPSPTPPVSPPPPTPTPSVPSP 111 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P T P P P P PP P PP Sbjct: 153 PPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPP 185 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PPPP P PP P PP PP Sbjct: 267 PPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PPP P PP P PPP P P P Sbjct: 255 PLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPP 290 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP +P P PPPP P P P PPP P Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P +PP P PPP PP P PP PP Sbjct: 260 PGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPP 291 Score = 35.9 bits (79), Expect = 0.040 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P PP PP PP P P P PPP Sbjct: 259 PPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPP 291 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPP---XPXGAPPXG 694 P P A P Q PP P P PPP P APP G Sbjct: 266 PPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKG 303 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP+ PP PP P PP PPP P Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKP 285 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P P P PP P P P PPP PP Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPP 297 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPP 949 PP P P P PPPP P P P P Sbjct: 274 PPQPPPPPPPKPQPPPPPKIARPPPAPPKGAAP 306 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +1 Query: 562 SGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 +GL P P P P A P P+ P P P P Sbjct: 251 AGLPPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKP 285 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P+ P P P P P P PP PK P PP Sbjct: 267 PPPAAAPP--PQP-PPPPPPKPQPPPPPKIARPPPAPP 301 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGG 681 P AP P P P P P P PPP G Sbjct: 268 PPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKG 303 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPP 936 P P P P PPPP PP P P Sbjct: 277 PPPPPPPKPQPPPPPKIARPPPAPPKGAAP 306 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPP-XXPXXXPPPXPP 962 L P P + PP PP P PPP PP Sbjct: 253 LPPLKLPPGRSAPPPPPAAAPPPQPPPPPP 282 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 GGG GG G G GG G GGGG GG G G Sbjct: 124 GGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 37.1 bits (82), Expect = 0.017 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGG 864 G GGG G G G G GG G GGGG GG Sbjct: 126 GYSGGGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 36.7 bits (81), Expect = 0.023 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGG 850 GGG G G G GG GGG GG G G GG Sbjct: 124 GGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 952 GGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GGG G GG GGGG G G GG G G Sbjct: 123 GGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDG 154 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 933 GXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G GG GGG GG G G GG GGG Sbjct: 123 GGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 918 GXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG GGGG G G G GG GGG Sbjct: 129 GGGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 924 GXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G GGGG GG G GG GGG Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGYGGGG 152 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 938 GGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG G GG G GGGG GG G G G Sbjct: 122 GGGGGYSGGGG-GYGGGGGGYGGGGGGYGGG 151 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXG 865 G GGG G G G G GGGG GG GD G Sbjct: 126 GYSGGGGGYGGGGGGYG--GGGGGYGGGGDGG 155 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXG 893 GG GGG G GG GGGG G G Sbjct: 135 GGGGGG-YGGGGGGYGGGGDGGG 156 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGG 880 G GGG G G G GG GG G GG Sbjct: 133 GYGGGGGGYGGGGGGYGG--GGDGGGG 157 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPP-XPXPXXPPPXPPPXXP 960 +P PP PPPP P PP P P PP PPP P Sbjct: 69 LPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPP 108 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPX-PPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP PPP P PP P P PP PPP Sbjct: 82 PPPLPRLPPPLLPPPEEPPREPPPPPP--PPEEPPP 115 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P P PPP PP P P PPP Sbjct: 76 PPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPP 109 Score = 35.9 bits (79), Expect = 0.040 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P PP+ PP P PP P P PP P Sbjct: 84 PLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPP--PXTPPXPXPXXPXXXPPP 952 PP P P P PPP P P P P P PPP Sbjct: 81 PPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 35.1 bits (77), Expect = 0.070 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP-XPPPXXP 960 P P PP PPP PP P P PPP PPP P Sbjct: 64 PPEPPLPPRFELPPPL---FPPPPLPRLPPPLLPPPEEP 99 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP---PPXXP 960 P P P + PPP P +P P P PPP P PP P Sbjct: 29 PPPLVFPLLPLSPPPSPPPSPSSP-PRLPPPFPALFPPEPP 68 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 4/33 (12%) Frame = +3 Query: 876 LSPPXXPXPQP--PPPXPPXXPXXXP--PPXPP 962 LSPP P P P PP PP P P PP PP Sbjct: 39 LSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPP 71 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXPP-PXXP 961 P SP P PP P +PP P P PP P P Sbjct: 38 PLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLP 70 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 L PP P P+ PP PP P P PP Sbjct: 88 LPPPLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXX-PXPAXAXPPXPKXPXPXXPPP 666 P P+ P P P P P PP P+ P P PPP Sbjct: 58 PFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPP 96 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP PP PPP P P P P PP P Sbjct: 67 PPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREP 103 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXP---XXPPP-XPPPXXP 960 P P P P PPP P P P PPP PPP P Sbjct: 45 PPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLP 86 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P PS P P P P P PP + P P PPP Sbjct: 47 PSPSS-PPRLPPPFPALFPPEPPLPPRFELPPPLFPPP 83 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +2 Query: 851 PPXXXPXSPX-PPXPPPP---XTPPXPXPXXPXXXPPPXXP 961 PP P SP PP PPP PP P PPP P Sbjct: 41 PPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFP 81 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +3 Query: 867 PXXLSPPXXPXPQPP-PPXPPXXPXXXPPPXP 959 P L P P PP PP P P PPP P Sbjct: 29 PPPLVFPLLPLSPPPSPPPSPSSPPRLPPPFP 60 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 4/38 (10%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPP----XXPXXXPPPXP 959 P P L PP P PP PP P PPP P Sbjct: 49 PSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLP 86 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P L P P P P P P P P P PPP Sbjct: 76 PPPLFP--PPPLPRLPPPLLPPPEEPPREPPPPPPP 109 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +2 Query: 590 PTPXAXTLPXQX--PPXPXPXXPXRPPPXPXGAPP 688 P P LP PP P P PPP P PP Sbjct: 81 PPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPP 115 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 854 PXXXPXSPXP-PXPPPPXTPPXPXPXXPXXXPPP 952 P P SP P P PP PP P P PP Sbjct: 38 PLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPP 71 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPP 663 P P L P P P P P P P P P PP Sbjct: 65 PEPP-LPPRFELPPPLFPPPPLPRLPPPLLPPPEEPP 100 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P + PPPP +PP P PPP P P P Sbjct: 107 PAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPP 142 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPP 951 P P P PP P PP +PP P P P P PPP Sbjct: 135 PKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPP 173 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P I PPP P PP P PP PP P Sbjct: 88 PPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASP 123 Score = 35.1 bits (77), Expect = 0.070 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXP-XXPPPXPPPXXP 960 P P PP+ PPP +PP P PPP P P Sbjct: 70 PPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTP 106 Score = 35.1 bits (77), Expect = 0.070 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PP P PP P + P P PP PP Sbjct: 142 PGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPP 175 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPP--XPPPXXP 960 P P PP PPP +PP P PPP PPP P Sbjct: 40 PPPSPP--QSPPPVVSSSPPPPVVSSPPPSSSPPPSPP 75 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P PP P P P P PP P P Sbjct: 116 PPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPP 149 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPP P +PP P P P P P Sbjct: 123 PSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKP 158 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP SP PP P PP P P P P P Sbjct: 115 PPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSP 148 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PPPP +PP P P PP P Sbjct: 163 PTPTTTTSPPPPPATSASPPSSNPTDPSTLAPPPTP 198 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +1 Query: 859 PXPPIX-XPPPPXPXXNPPXPXPXXPPPXPP 948 P P + PPPP +PP P PP PP Sbjct: 80 PPPTVASSPPPPVVIASPPPSTPATTPPAPP 110 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/40 (35%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXP-PPXPPPXXP 960 + P P P PP P +PP P P PP P P Sbjct: 94 IASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNP 133 Score = 31.1 bits (67), Expect(2) = 0.29 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P G P P P P P P P P P PP S P Sbjct: 146 PSPPGETPSPPKPSPSTPTPTTTTSP-PPPPATSASPPSSNPTDP 189 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP---XPPP 951 P PP PPP P PP PPP PPP Sbjct: 29 PTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPP 66 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PP PPP P P PP P Sbjct: 35 PPPVTPP-PSPPQSPPPVVSSSPPPPVVSSPPPSSSP 70 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPP 951 P PP+ PPP P P PPP PPP Sbjct: 56 PPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPP 90 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P PP +PP P P P P P Sbjct: 128 PTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTP 165 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 PP P P PP P PP PPP Sbjct: 22 PPPLQTQPTTPSAPPPVTPPPSPPQSPPP 50 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P PP +P P P PPP Sbjct: 141 PPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPP 174 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 851 PPXXXPXSPXPP--XPPPPXTPPXPXPXXPXXXPP 949 PP SP PP PPP + P P P PP Sbjct: 48 PPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPP 82 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXS 672 P P G P P P P P+ + P P PP S Sbjct: 139 PSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPATS 178 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPX--PPPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP PPP P P PPP P Sbjct: 64 PPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTP 102 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 4/37 (10%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXP----XXXPPP 952 P P P PPP TPP P P PPP Sbjct: 22 PPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPP 58 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 PP P P PP P PP PP Sbjct: 23 PPLQTQPTTPSAPPPVTPPPSPPQSPP 49 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTP--PXPXPXXPXXXPPP 952 PP SP P PPP P P P PPP Sbjct: 56 PPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPP 91 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP PPP P P P PP P Sbjct: 59 PVVSSPPPSSSPPPSPPVITSPPPTVASSPPPP 91 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P +P PPP P P P PP P Sbjct: 102 PATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKP 137 Score = 20.6 bits (41), Expect(2) = 0.29 Identities = 12/45 (26%), Positives = 15/45 (33%) Frame = +1 Query: 298 PXPYSTP**XXIIXLPXPPCXXXXPPVPXXXXXVLPAXXNRPNXP 432 P S+P +I P P PP P P P+ P Sbjct: 82 PTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPP 126 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P PPP P PP P PP PPP Sbjct: 92 PLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPP 126 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +1 Query: 859 PXPPIXXPP--PPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PP PP P PP P PP PP P Sbjct: 113 PPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLP 148 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PPPP P P PPP PP Sbjct: 120 PPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPP 154 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PPP P P P P PP PP P Sbjct: 85 PPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITP 120 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PPP P P P PP PP P Sbjct: 57 PTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLP 94 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P LSPP P PP PP P PP PP Sbjct: 94 PPPLSPPQTTPPPPPAITPPPPPAITPPLSPP 125 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PP P PP P P P PP PP Sbjct: 42 PGPPPPQPDPQPPTPPTFQPAPPANDQPPPPP 73 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP PPP P P P P PP PP Sbjct: 139 PPALPPKPLPPPLSPPQTTPPPPPAITPPLSPP 171 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 6/44 (13%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPP--XPXPXXPPPXP----PPXXP 960 P P PP PPP P PP P P PP P PP P Sbjct: 100 PQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALP 143 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPP 949 PP P PP PP TPP P P PP Sbjct: 139 PPALPPKPLPPPLSPPQTTPPPPPAITPPLSPP 171 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPP--XPPPXXP 960 P P P I PP P PP P PPP PP P Sbjct: 254 PGPSPTISPPPLPPQTLKPPPPQTTPPPPPAITPPLSP 291 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PP PPP P PP P PP PP Sbjct: 262 PPPLPPQTLKPPP-PQTTPPPPPAITPPLSPP 292 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP--XPPPXXP 960 P P P PP P PP PP P PPP PP P Sbjct: 51 PQP-PTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALP 89 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P P +PP P PP PP P Sbjct: 79 PPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPP 116 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXP---XPXXPXXXPPPXXP 961 PP P PP PP TPP P P P PP P Sbjct: 85 PPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSP 124 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP P P P +PP P PP PP P Sbjct: 139 PPALPPKPLPPPLSPPQTTPPPPPAITPPLSP 170 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPP---PXTPPXPXPXXPXXXPPPXXP 961 PP +P PP P P P TPP P P PP P Sbjct: 34 PPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPP 73 Score = 32.7 bits (71), Expect = 0.37 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = +2 Query: 851 PPXXXPXSPXPP--XPPPP--XTPP--XPXPXXPXXXPPPXXP 961 P P SP PP PPPP TPP P P P PP P Sbjct: 116 PAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTP 158 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P PP P P P P PPP P P Sbjct: 42 PGPPPPQPDPQPPTP-PTFQPAPPANDQPPPPPQSTSP 78 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP PPP P P PPP PP Sbjct: 70 PPPPQSTSPPPVATTPPALPPKPLPPPLSPP 100 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P I P PP P +P P P P PP Sbjct: 31 PPPPPCICICNPGPPPPQPDPQPPTPPTFQPAPP 64 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPP--XTPPXPXPXXPXXXPPP 952 PP P P PPPP TPP P PPP Sbjct: 99 PPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPP 134 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P PP P PPP P P P PP Sbjct: 61 PAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPP 95 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP+ PP P P P P PP PP P Sbjct: 73 PQSTSPPPVATTPPALPPK--PLPPPLSPPQTTPPPPP 108 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +3 Query: 858 PXXPXXLSPPXXPX----PQPPPPXPPXXPXXXPPPXPP 962 P +SPP P P PP PP P PP PP Sbjct: 254 PGPSPTISPPPLPPQTLKPPPPQTTPPPPPAITPPLSPP 292 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P L P P P PA PP P P PPP + P Sbjct: 92 PLPPPLSPPQTTPPPP---PAITPPPPPAITPPLSPPPPAITPPP 133 Score = 29.5 bits (63), Expect = 3.5 Identities = 24/110 (21%), Positives = 27/110 (24%) Frame = +1 Query: 343 PXPPCXXXXPPVPXXXXXVLPAXXNRPNXPRQXXXXXXXLFRFPPXXXXXXXXXXXXXXX 522 P PP PP P PA ++P P Q P Sbjct: 44 PPPPQPDPQPPTPPTFQPAPPAN-DQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQT 102 Query: 523 XXXXXXXXXXPRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXS 672 P P + P P P P P P PPP S Sbjct: 103 TPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLS 152 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXPPP--PXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPP P PP P P PP PP P Sbjct: 69 PPPPPQSTSPPPVATTPPALPPKPLP--PPLSPPQTTP 104 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +2 Query: 590 PTPXAXTLPXQXP-PXPXPXXPXR--PPPXPXGAPP 688 P P A T P P P P P P + PPP P PP Sbjct: 78 PPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPP 113 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 7/44 (15%) Frame = +2 Query: 851 PPXXXPXSPX---PPXPPPPXTPPX----PXPXXPXXXPPPXXP 961 PP P P PP PP +PP P P PPP P Sbjct: 56 PPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSP 99 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXP 924 P P P P PPP P PP P Sbjct: 146 PLPPPLSPPQTTPPPPPAITPPLSPP 171 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PP+ PPP P +PP P PP PP Sbjct: 416 PSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPP 449 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/35 (51%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXP-XXPPPXPPPXXP 960 P PPI PPP P +PP P P PPP PP P Sbjct: 403 PSPPIVALPPP-PPPSPPLPPPVYSPPPSPPVFSP 436 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +1 Query: 847 PXPXPXPPIXXP---PPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP+ P PPP P P P P P PPP Sbjct: 412 PPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPP 449 Score = 37.5 bits (83), Expect = 0.013 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP+ PPP P +PP P PPP Sbjct: 427 PPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPP 459 Score = 36.3 bits (80), Expect = 0.030 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXP-XXPPPXPPPXXP 960 P PP PP P P +PP P PPP PP P Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSP 445 Score = 35.1 bits (77), Expect = 0.070 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ PPPP P P PPP P Sbjct: 436 PPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSP 471 Score = 34.7 bits (76), Expect = 0.093 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP PP P P P P PPP P Sbjct: 405 PPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPP 441 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPP-XPXPXXPXXXPPP 952 PP P P P PPP P P P P PPP Sbjct: 413 PPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPP 447 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P P P PP PP P PP PP Sbjct: 415 PPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPP 449 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +1 Query: 853 PXPXPPIXX---PPPPXPXXNPPXPXPXXPPPXPP 948 P P P I PPPP +PP P P P PP Sbjct: 445 PPPPPSIHYSSPPPPPVHHSSPPPPSPEFEGPLPP 479 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P + PP P P PP Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPP 441 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 8/42 (19%) Frame = +3 Query: 858 PXXPXXLSPPXXPX-----PQPP---PPXPPXXPXXXPPPXP 959 P P SPP P P PP PP PP PPP P Sbjct: 419 PLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPP 460 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P PP PP PP P PPP Sbjct: 427 PPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPP 460 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPP--PXPPXXPXXXPPPXP 959 P L PP P PP PP P PPP P Sbjct: 414 PPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPP 449 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +1 Query: 871 IXXPPPPXP-XXNPPXPXPXXPPP--XPPPXXP 960 + P PP PP P P PPP PPP P Sbjct: 400 VVKPSPPIVALPPPPPPSPPLPPPVYSPPPSPP 432 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/33 (57%), Positives = 19/33 (57%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 GGG GGG G G GG G GGGG GG G G Sbjct: 784 GGGCGGGHHGGGGGGCG-GCGGGGCGGGGDGGG 815 Score = 33.1 bits (72), Expect = 0.28 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 945 GXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G GG GGGG G G G GG GGG Sbjct: 779 GGHHGGGGCG-GGHHGGGGGGCGGCGGGGCGGGGDGGG 815 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGG 879 G GG GGG G G GG G GGG Sbjct: 789 GGHHGGGGGGCGGCGGGGCGGGGDGGG 815 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGR 555 GGG G G G GG G G G G G G R Sbjct: 783 GGGGCGGGHHGGGGGGCGGCGGGGCGGGGDGGGMTSR 819 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXG 893 GG GGG GG GGGG G G Sbjct: 793 GGGGGGCGGCGGGGCGGGGDGGG 815 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 G GGG G G GGGG G GG G G Sbjct: 780 GHHGGGGCGGGHHGGGGGGCGGCGGGGCGGGGDGG 814 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 924 GXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG GGGG GG G G GGG Sbjct: 775 GYHHGGHHGGGGCGGGHHGGGGGGCGGCGGG 805 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G G GG G GGGG GG G G G Sbjct: 581 GSGRGGYGGGGGGYGGGG---GYGGGGGYGGGGGYGGG 615 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGG-VXGGGGXGGXGDXGXXXGGXXXGG 835 G GG G G G GG GGGG GG G G GG GG Sbjct: 581 GSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGG 623 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 945 GXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G GG GGGG GG G G GG GGG Sbjct: 581 GSGRGGYGGGGGGYGGGGGYGGGGGYG---GGGGYGGG 615 Score = 37.1 bits (82), Expect = 0.017 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GGG G GG GGGG G GG G G Sbjct: 592 GGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYGG 626 Score = 36.3 bits (80), Expect = 0.030 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G GGG GG G G GG G GGGG GG G Sbjct: 585 GGYGGGGGGYGGGGGYGG-GGGYGGGGGYGGGYG 617 Score = 35.9 bits (79), Expect = 0.040 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G GG G G GG G G G Sbjct: 588 GGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYG 625 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G G G G GG G GGGG GG G G G Sbjct: 578 GSFGSGRGGYGGGG--GGYGGGGGYGGGGGYGGG 609 Score = 31.5 bits (68), Expect = 0.86 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXG 838 GGG G G G GG GGGG G G G G G Sbjct: 590 GGGGYGGGGGYGGGGGYGGGG-GYGGGYGGASSGGYGG 626 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GGGG G G G GG GGG Sbjct: 48 GGHGGGGHYGGGGHGHGGHNGGGGHGLDG-YGGGHGGHYGGGG 89 Score = 36.7 bits (81), Expect = 0.023 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G GG GGGG G G GG GGG Sbjct: 69 GGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGGG 108 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G G G GGGG G G G G Sbjct: 45 GGHGGHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHG 82 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXG-GVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G G G G GGG G G G GG GGG Sbjct: 64 GGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGG 107 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG G G G G G GGGG GG G G G Sbjct: 64 GGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGG 101 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXG 865 GGG G G G GG GGGG G G G Sbjct: 88 GGGHYGGGGGHGGGGHYGGGGHHGGGGHG 116 Score = 32.7 bits (71), Expect = 0.37 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -1 Query: 959 GXXGG--GXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GG G GGG G G G G GGG GG G G Sbjct: 79 GGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGGGHG 116 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 945 GXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G GG GGGG G G G G GG Sbjct: 42 GYHGGHGGHGGGGHYGGGGHGHGGHNGGGGHGLDGYGG 79 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G G G G GGG GG G G GG GGG Sbjct: 78 GGGHGGHYGGGGG--HYGGG-GGHGGGGHYGGGGHHGGG 113 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXG-GGGXXXGGXGXGXG 846 GG GG G G G G G GGG GG G G Sbjct: 78 GGGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHGG 112 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXG 899 GG GGG G G GGGG G Sbjct: 96 GGHGGGGHYGGGGHHGGGGHG 116 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PPP P PP P P P PP P Sbjct: 113 PPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAP 150 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PPP P PP P P P PP Sbjct: 120 PAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPP 154 Score = 35.1 bits (77), Expect = 0.070 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPX-SPXPPXPPPPXTPPXPXPXXPXXXP--PPXXP 961 PP P SP P PPP T P P P P P PP P Sbjct: 104 PPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAP 143 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPP--XPXPXXPPPXPPP 951 P P PP PPP P PP P P PP P P Sbjct: 134 PAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAP 170 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP--PPXXP 960 P P PP P P +PP P P PPP P PP P Sbjct: 98 PQPPQSPPASAPTVSPPPVSPP-PAPTSPPPTPASPPPAP 136 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PPP P +PP P P PPP P Sbjct: 127 PTPASPPPAPASPPPAP-ASPP-PAPVSPPPVQAP 159 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXP-PPPXPXXNPPXPXPXX-PPPXPPPXXP 960 P P P I PPP P +PP P PPP PP P Sbjct: 83 PAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAP 122 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPL 690 P P P P P PA A PP P P PPP P+ Sbjct: 122 PTSPPPTPASPPPAPASPP----PAPASPPPAPVSPPPV 156 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PP P +PP P P PPP Sbjct: 96 PPPQPP-QSPPASAPTVSPPPVSPPPAPTSPPP 127 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P PA PP + P P PP Sbjct: 136 PASPPPAPASPPPAPVSPPPVQAPSPISLPP 166 Score = 31.5 bits (68), Expect = 0.86 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 885 PXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P PQPP P P PPP P Sbjct: 93 PATPPPQPPQSPPASAPTVSPPPVSP 118 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P P P P P A PP P P PPP P Sbjct: 115 PVSPPPAPTSPPPTPASPP----PAPASPPPAPASPPP 148 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PPP P P P P P P Sbjct: 119 PPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPP 155 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +3 Query: 867 PXXLSPPXXPX-PQPPPPXPPXXPXXXPPPXPP 962 P SPP P P P P PP P PP P Sbjct: 127 PTPASPPPAPASPPPAPASPPPAPVSPPPVQAP 159 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P +P P P P PP P P P P Sbjct: 129 PASPPPAPASPPPAPASPPPAPVSPPPVQAPSP 161 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPP-PXTPPXPXPXXPXXXPPPXXP 961 PP P P PPP P +PP P PP P Sbjct: 133 PPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAP 170 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 854 PXXXPXSPXP-PXPPPPXTPPXPXPXXPXXXPPP 952 P P SP P P PPP P P P P P Sbjct: 139 PPPAPASPPPAPVSPPPVQAPSPISLPPAPAPAP 172 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P P P PPP PP P Sbjct: 70 PVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPP 105 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 593 TPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 +P A PP P P PPP P PP Sbjct: 103 SPPASAPTVSPPPVSPPPAPTSPPPTPASPPP 134 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Frame = +2 Query: 596 PXAXTLPXQXPPXPX--PXXPXRPPPXPXGAPP 688 P P PP P P P PPP P PP Sbjct: 109 PTVSPPPVSPPPAPTSPPPTPASPPPAPASPPP 141 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +2 Query: 854 PXXXPXSPXP-PXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P SP P P PPP P P P P P P Sbjct: 118 PPPAPTSPPPTPASPPP-APASPPPAPASPPPAPVSP 153 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/34 (55%), Positives = 19/34 (55%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GG GGG G G GG G GGGG GG G G G Sbjct: 105 GGYGGGGPGYGGGGYGPGGGGGGVVIGG-GFGGG 137 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/40 (50%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -1 Query: 959 GXXGGGXGGG-XXGXGXGGLXXGXG-GGGXXXGGXGXGXG 846 G GG GGG G G GG+ G G GGG GG G G G Sbjct: 147 GWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCG 186 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGG---GXGGXGDXGXXXGGXXXGGG 832 G G G G G G GG GGG G GG G G GG GGG Sbjct: 153 GGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGG 198 Score = 36.7 bits (81), Expect = 0.023 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G GG G G GG G G GG GGG Sbjct: 139 GYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGG 181 Score = 36.3 bits (80), Expect = 0.030 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG G GG G G GG GGG Sbjct: 151 GNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGG 193 Score = 36.3 bits (80), Expect = 0.030 Identities = 20/40 (50%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGG--GGXXXGGXGXGXG 846 G GGG GGG G G G + G GG GG GG G G G Sbjct: 160 GSGGGGIGGG-GGIGGGVIIGGGGGGCGGSCSGGGGGGGG 198 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G G G GG GGG GG G GG G G Sbjct: 105 GGYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSG 143 Score = 34.7 bits (76), Expect = 0.093 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGX-GXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G GGGG G G GG GGG Sbjct: 132 GGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGG 175 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G G GGG G G GG GGG G G G G Sbjct: 108 GGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGG 145 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GGG G G G G GGG Sbjct: 122 GGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGG 164 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 G GGG G G G G GG G GGG GG G G+ Sbjct: 151 GNGGGGPGYGSGGGGIGG-GGGIGGGVIIGGGGGGCGGS 188 Score = 33.1 bits (72), Expect = 0.28 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXG-GGGXGGXGDXGXXXGGXXXGGG 832 GG G G G GG G GG GG G GG GGG Sbjct: 131 GGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGG 170 Score = 32.7 bits (71), Expect = 0.37 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG G G G GG G GGGG GG G G Sbjct: 170 GGIGGGVIIGGGGGGCGGSCSGGGGGG---GGYGHG 202 Score = 32.3 bits (70), Expect = 0.49 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGG----GGXGGXGDXGXXXGGXXXGG 835 G GGG G G G GG GG GG GG G G GG Sbjct: 106 GYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGG 151 Score = 32.3 bits (70), Expect = 0.49 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 950 GGGXGGGXXGXGXGG-LXXGXGGGGXXXGGXGXG 852 GGG GG G G GG G GGG GG G G Sbjct: 122 GGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGG 155 Score = 31.5 bits (68), Expect = 0.86 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGG----GXGGXGDXGXXXGGXXXGGG 832 G GG G G G G GGG G G G G GG GGG Sbjct: 123 GGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGG 169 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 G GGG G G GGGG G GG G G Sbjct: 167 GGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYG 200 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXG---DXGXXXGGXXXGGG 832 G GG G G G G V GGG GG G G G GGG Sbjct: 111 GPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGG 156 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXGXXG 884 G GGG G G GGGG G G G Sbjct: 179 GGGGGGCGGSCSGGGGGGGGYGHGG 203 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 G GGG GG GGG G G GG G G Sbjct: 120 GPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNG 153 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 686 GXPPXEXGGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 G P GGG G G G GG G G G G G G G Sbjct: 155 GGPGYGSGGGGIGGGG-GIGGGVIIGGGGGGCGGSCSGGGGGGGG 198 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G G G G G GGG G G G GG GG Sbjct: 100 GELTAGGYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGG 137 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -3 Query: 924 GXGXGGVX-GGGGXGGXGDXGXXXGGXXXGGGA 829 G G GG GGGG G G G G GGGA Sbjct: 106 GYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGGA 138 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PP P P +PP P P P PPP Sbjct: 45 PPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPP 79 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PP P P + P P P PP PP P Sbjct: 59 PYPHPHPP---PPSPYPHPHQPPPPPHVLPPPPPTPAP 93 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = +1 Query: 844 VPXPXPXPP--IXXPPPPXPXXNPPXPXPXXPPPXPPP 951 +P P P PP I PPPP + P P PP PPP Sbjct: 20 LPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPP 57 Score = 35.9 bits (79), Expect = 0.040 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPX--PXXNPPXPXPXXPPPXPPPXXP 960 P P P P PPPP P PP P P P P PPP P Sbjct: 33 PPPPPFSPPHHPPPPHFSPPHQPP-PSPY-PHPHPPPPSP 70 Score = 35.1 bits (77), Expect = 0.070 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 PP P P P PP P P PP PP Sbjct: 55 PPPSPYPHPHPPPPSPYPHPHQPPPPP 81 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P+ P PP P P P P PP PPP Sbjct: 14 PSHQHPLPSPVPPPPSHISPPPPPFSPPHHPPP 46 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PP P P P P P P P P P Sbjct: 40 PPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQP 77 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P P P P P P PP P PPP P Sbjct: 56 PPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPP 89 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP SP PP PP PP P P PP P Sbjct: 25 PPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYP 61 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPP 953 P P P P PPPP P P PPP Sbjct: 52 PHQPPPSPYPHPHPPPPSPYPHPHQPPPP 80 Score = 32.3 bits (70), Expect = 0.49 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 583 PAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P+ PP P P PPP Sbjct: 19 PLPSPVPPPPSHISPPPPPFSPPHHPPP 46 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P P PP PPP PP P Sbjct: 9 PYYSPPSHQHPLPSPVPPPPSHISPPPPPFSPPHHP 44 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P +SPP P P PP PP P PP PP Sbjct: 25 PPPPSHISPP--PPPFSPPHHPP-PPHFSPPHQPP 56 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +2 Query: 587 RPTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 +P P P PP P P P +PPP P PP Sbjct: 54 QPPPSPYPHPHPPPPSPYP-HPHQPPPPPHVLPP 86 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PP P P P P P PPP P Sbjct: 56 PPSPYPH-PHPPPPSPYPHPHQPPPPPHVLPPPPPTP 91 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAP 685 P P + P Q PP P P P PPP P P Sbjct: 44 PPPPHFSPPHQPPPSPYPH-PHPPPPSPYPHP 74 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 583 PAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXG 678 P P P P P PP P P PP + G Sbjct: 63 PHPPPPSPYPHPHQPPPPPHVLPPPPPTPAPG 94 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GGV GGG G G GG GGG Sbjct: 362 GGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGG 404 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G G G GG GGGG G G GG GGG Sbjct: 355 GGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGG 393 Score = 35.9 bits (79), Expect = 0.040 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXG-DXGXXXGGXXXGGGA 829 G G G G G GG GGG GG G D G GG G GA Sbjct: 346 GGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGA 390 Score = 35.1 bits (77), Expect = 0.070 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G GGG G GG+ G GG G G G GG GG Sbjct: 343 GSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGG 384 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/42 (45%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = -1 Query: 959 GXXGGGXGGGXXGXG---XGGLXXGXGGGGXXXGGXGXGXGT 843 G GG GGG G G GG+ G G GG GG G G G+ Sbjct: 359 GGMGGAGGGGYRGGGGYDMGGV-GGGGAGGYGAGGGGNGGGS 399 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = -3 Query: 951 GGGXXXGXXGXG----XGGVXGGGGXGGXGDXGXXXGGXXXGG 835 GGG G G G GG GGG GG G G GG GG Sbjct: 237 GGGHGGGYGGPGGPYKSGGGYGGGRSGGYGGYGGEFGGYGGGG 279 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -3 Query: 960 GXXGGG-XXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GGG G G GG GG GG G G GG GGG+ Sbjct: 355 GGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGS 399 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -1 Query: 959 GXXGGGXGGGXXGXG--XGGLXXGXGGGGXXXGGXGXG 852 G GGG GG G G GG G GGG GG G G Sbjct: 379 GVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGGSG 416 Score = 32.7 bits (71), Expect = 0.37 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXG--GGGXXXGGXGXGXG 846 G G GGG G GG G G GGG GG G G Sbjct: 339 GGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMG 378 Score = 32.3 bits (70), Expect = 0.49 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GG GGG G G G G GGG GG G G Sbjct: 374 GYDMGGVGGGGAG-GYGAGGGGNGGGSFYGGGGGRG 408 Score = 31.9 bits (69), Expect = 0.65 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G G G GGGG GG G G G Sbjct: 358 GGGMGGAGGGGYRGGGGYDMGGVGGGG--AGGYGAGGG 393 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G G G G GG G G GG G G Sbjct: 372 GGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYG 411 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G G G GG GGG G G GG GG Sbjct: 373 GGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGG 412 Score = 31.9 bits (69), Expect = 0.65 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXG--XGGGGXXXGGXGXGXG 846 G GGG G G G G GG G GGGG G G G G Sbjct: 378 GGVGGG-GAGGYGAGGGGNGGGSFYGGGGGRGGYGGGGSG 416 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GGG G G GG G G GG G G Sbjct: 378 GGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGG 412 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G +G GG G G G G G GRG Sbjct: 371 GGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRG 408 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GG G GG G GGGG GG G G Sbjct: 255 GGYGGGRSGGY--GGYGGEFGGYGGGG-YGGGVGPYRG 289 Score = 29.9 bits (64), Expect = 2.6 Identities = 31/117 (26%), Positives = 33/117 (28%), Gaps = 6/117 (5%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGG----XGGXGDXGXXXGG--XXXGGGAXXXXXXXXXX 799 G GGG G G GG GGG G G+ G GG GGG Sbjct: 300 GGGGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGG 359 Query: 798 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXGGAPXGXGGGRXGXXGLGXG 628 G GG+ G GGGR G G G G Sbjct: 360 GMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGGSG 416 Score = 29.5 bits (63), Expect = 3.5 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 6/49 (12%) Frame = -3 Query: 960 GXXGGGXXXGXXGXG--XGGVXGGGGXGG----XGDXGXXXGGXXXGGG 832 G GGG G G G GG GGG GG G+ G GGG Sbjct: 255 GGYGGGRSGGYGGYGGEFGGYGGGGYGGGVGPYRGEPALGYSGRYGGGG 303 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXG 573 GGG G G GG G G G G G G Sbjct: 366 GGGYRGGGGYDMGGVGGGGAGGYGAGGGGNG 396 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G G GGG G G GG GG GG G G Sbjct: 230 GGYGDGYGGG-HGGGYGGPGGPYKSGGGYGGGRSGGYG 266 Score = 29.1 bits (62), Expect = 4.6 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 10/48 (20%) Frame = -1 Query: 959 GXXGGGXG--------GGXXGXGXGGLXXGXGG--GGXXXGGXGXGXG 846 G GGG G GG G G G G GG GG GG G G G Sbjct: 238 GGHGGGYGGPGGPYKSGGGYGGGRSGGYGGYGGEFGGYGGGGYGGGVG 285 Score = 28.7 bits (61), Expect = 6.1 Identities = 33/129 (25%), Positives = 33/129 (25%), Gaps = 4/129 (3%) Frame = -3 Query: 960 GXXGG-GXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGAXXXXXXXXXXXXXXX 784 G GG G G G G GGGG G GG GGG Sbjct: 279 GYGGGVGPYRGEPALGYSGRYGGGGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGY 338 Query: 783 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXGGA---PXGXGGGRXGXXGLGXGGXCXG 613 G GG G GGG G G G GG G Sbjct: 339 GGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGG 398 Query: 612 RVXAXGVGR 586 G GR Sbjct: 399 SFYGGGGGR 407 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 GGG GGG G GG G G G G G+ Sbjct: 316 GGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGS 351 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 662 GGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GG G G G GG G G G GAG G G G Sbjct: 362 GGAGGGGYRGGGGYDMGGVG--GGGAGGYGAGGGGNG 396 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXR 875 G GGG G G GGG G G G R Sbjct: 389 GAGGGGNGGGSFYGGGGGRGGYGGGGSGR 417 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G GGGG GG G G G Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGG 850 G GGG G G GGGG GG G G GG Sbjct: 103 GKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +1 Query: 859 PXPPIXX-PPPPXPXXNPPXPXPXXPPPXPPP 951 P P + PP P P P P P PP PP Sbjct: 413 PPPAVNYMPPQPQPHQQHPYPYPYPYPPQYPP 444 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = -3 Query: 912 GGVXGGGGXGG--XGDXGXXXGGXXXGGG 832 GG GGGG GG + G GG GGG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGG 130 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G GGGG GG G G G Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GG G GG+ G G GG G G G Sbjct: 356 GKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGG 393 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGG 850 G GGG G G GGGG GG G G GG Sbjct: 103 GKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG G G GG G GGGG G G G Sbjct: 325 GPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGG 362 Score = 32.7 bits (71), Expect = 0.37 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXG---XGGGGXXXGG 864 GGG GGG G GGL G GGGG GG Sbjct: 387 GGGGGGGGGGPMSGGLPPGFRPMGGGGGGGGG 418 Score = 31.9 bits (69), Expect = 0.65 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = -3 Query: 960 GXXGGGXXX---GXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG GGGG GG G G GGG Sbjct: 367 GNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGG 412 Score = 31.5 bits (68), Expect = 0.86 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = -3 Query: 960 GXXGGGXXX-GXXGXGXGGVXGGGGXGGX----GDXGXXXGGXXXGGG 832 G GGG G G G GG G G GG G G GG GGG Sbjct: 346 GKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGG 393 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXG---XXGGXRXXGXXG 857 G GGG G GG GGGG G GG + G G Sbjct: 313 GGGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGG 349 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G GGG GG G G G GGG Sbjct: 320 GGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGG 362 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G G G GG GGG G G G GGG Sbjct: 378 GGPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGG 416 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G GG GGG G G G GGG Sbjct: 314 GGGGGPGGKKGGPGG--GGGNMGNQNQGGGGKNGGKGGGG 351 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G GGG G GGV GG G G G GG GG Sbjct: 356 GKMGGGGGGPNGNKGGGGVQMNGGPNG-GKKGGGGGGGGGGG 396 Score = 29.1 bits (62), Expect = 4.6 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 6/47 (12%) Frame = -3 Query: 960 GXXGGGXXXGXXGXG---XGGVXG---GGGXGGXGDXGXXXGGXXXG 838 G GGG G G GG G GGG GG G G GG G Sbjct: 359 GGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPG 405 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +1 Query: 859 PXPPIXX-PPPPXPXXNPPXPXPXXPPPXPPP 951 P P + PP P P P P P PP PP Sbjct: 535 PPPAVNYMPPQPQPHQQHPYPYPYPYPPQYPP 566 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = -3 Query: 912 GGVXGGGGXGG--XGDXGXXXGGXXXGGG 832 GG GGGG GG + G GG GGG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGG 130 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGX---GGLXXGX-GGGGXXXGGXGXGXG 846 G GGG G G G GG G GGGG GG G G Sbjct: 359 GGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPMSG 400 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXX---PPPXPPPXXP 960 P P P PPPP P P P P PPP PPP P Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP PPPP P P PPP P Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPP 339 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 4/32 (12%) Frame = +1 Query: 583 PAPXPXXPXPAXAXPPXP----KXPXPXXPPP 666 P P P P P PP P K P P PPP Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPP 341 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 VP P P I +PP PPP PPP Sbjct: 282 VPKPPPKRSISLGDSTENRADPPPQKSIPPPPPPPP 317 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP--XPPPXXP 960 P P PP+ PPP P P P PPP PPP P Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATP 105 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPP--PXPXXNPPXPXPXXPPPXPPP 951 P P PP PPP P P +PP P PP PPP Sbjct: 71 PPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Frame = +1 Query: 847 PXPXPXPPIXXPPPP----XPXXNPPXPXPXXPPPXPPPXXP 960 P PP+ PPP P NPP P PP PPP P Sbjct: 46 PPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATP 87 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ PPPP P P P PP P P Sbjct: 82 PPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASP 119 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPP---PXPXXNPPXPXPXXPPPXPPP 951 P P PP PPP P P P P PPP PP Sbjct: 34 PTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPP 71 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PPPP P P P PPP P P Sbjct: 59 PPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPP 96 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P P PPP TPP P PP Sbjct: 26 PPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPP 59 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P +P P P P + PP P P PPP Sbjct: 70 PPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPP--PXPXXNPPXPXPXXPPPXPPP 951 P P PP+ PPP P P PP P P PP P Sbjct: 89 PVASPPPPVASPPPATPPPVATPP-PAPLASPPAQVP 124 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 6/44 (13%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPP---XPXPXXPPP---XPPPXXP 960 P P PP PPP PP P P PPP PPP P Sbjct: 39 PPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASP 82 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PP PP P +PP P PP PP P Sbjct: 77 PPPASPPPATPPPVASPPPPVASPPPATP--PPVATPPPAP 115 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPL 690 P AP P P P + PP P P P PPP + P+ Sbjct: 60 PVTTAPPPANPPPPVSSPP-PASPPPATPPPVASPPPPV 97 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P +P P PPPP + P P P PP P Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASP 93 Score = 32.3 bits (70), Expect = 0.49 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 6/44 (13%) Frame = +1 Query: 847 PXPXPXPPIXXPPPP---XPXXNPPXPXPXXPPP---XPPPXXP 960 P P PP PPP P + P P PPP PPP P Sbjct: 27 PTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANP 70 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ PPP P +PP P P P P P Sbjct: 100 PPPATPPPVATPPPA-PLASPPAQVPA-PAPTTKPDSP 135 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXP-KXPXPXXPPP 666 P S P +P P P A PP P P P PPP Sbjct: 46 PPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPP 84 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPP-PXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP P P P + P P P PP P P Sbjct: 113 PAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPLPSSDAP 151 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P+ P P P P P A PP P PPP P Sbjct: 77 PPPASPPPATPPPVASPPPPV-ASPPPATPPPVATPPPAPLASPP 120 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPP--XPXPXXPXXXPPPXXP 961 PP P P P PPP TPP P P PP P Sbjct: 88 PPVASP--PPPVASPPPATPPPVATPPPAPLASPPAQVP 124 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXT-PPXPXPXXPXXXPPP 952 P SP P PPP T PP P P P P Sbjct: 93 PPPPVASPPPATPPPVATPPPAPLASPPAQVPAP 126 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P+ P AP P P PP P P PPP Sbjct: 39 PPPAATPPPVSAPPPVTTSP----PPVTTAPPPANPPP 72 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P P P P P A PP P P P PP P Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPP-PATPPPVASPPPPVASPP 101 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP--XPPPXXP 960 P P PP+ PPP P P P PPP PPP P Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATP 105 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPP--PXPXXNPPXPXPXXPPPXPPP 951 P P PP PPP P P +PP P PP PPP Sbjct: 71 PPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Frame = +1 Query: 847 PXPXPXPPIXXPPPP----XPXXNPPXPXPXXPPPXPPPXXP 960 P PP+ PPP P NPP P PP PPP P Sbjct: 46 PPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATP 87 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ PPPP P P P PP P P Sbjct: 82 PPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASP 119 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPP---PXPXXNPPXPXPXXPPPXPPP 951 P P PP PPP P P P P PPP PP Sbjct: 34 PTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPP 71 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PPPP P P P PPP P P Sbjct: 59 PPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPP 96 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P P PPP TPP P PP Sbjct: 26 PPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPP 59 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P +P P P P + PP P P PPP Sbjct: 70 PPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPP--PXPXXNPPXPXPXXPPPXPPP 951 P P PP+ PPP P P PP P P PP P Sbjct: 89 PVASPPPPVASPPPATPPPVATPP-PAPLASPPAQVP 124 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 6/44 (13%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPP---XPXPXXPPP---XPPPXXP 960 P P PP PPP PP P P PPP PPP P Sbjct: 39 PPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASP 82 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PP PP P +PP P PP PP P Sbjct: 77 PPPASPPPATPPPVASPPPPVASPPPATP--PPVATPPPAP 115 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPL 690 P AP P P P + PP P P P PPP + P+ Sbjct: 60 PVTTAPPPANPPPPVSSPP-PASPPPATPPPVASPPPPV 97 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P +P P PPPP + P P P PP P Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASP 93 Score = 32.3 bits (70), Expect = 0.49 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 6/44 (13%) Frame = +1 Query: 847 PXPXPXPPIXXPPPP---XPXXNPPXPXPXXPPP---XPPPXXP 960 P P PP PPP P + P P PPP PPP P Sbjct: 27 PTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANP 70 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ PPP P +PP P P P P P Sbjct: 100 PPPATPPPVATPPPA-PLASPPAQVPA-PAPTTKPDSP 135 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXP-KXPXPXXPPP 666 P S P +P P P A PP P P P PPP Sbjct: 46 PPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPP 84 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPP-PXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP P P P + P P P PP P P Sbjct: 113 PAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPLPSSDAP 151 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P+ P P P P P A PP P PPP P Sbjct: 77 PPPASPPPATPPPVASPPPPV-ASPPPATPPPVATPPPAPLASPP 120 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPP--XPXPXXPXXXPPPXXP 961 PP P P P PPP TPP P P PP P Sbjct: 88 PPVASP--PPPVASPPPATPPPVATPPPAPLASPPAQVP 124 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXT-PPXPXPXXPXXXPPP 952 P SP P PPP T PP P P P P Sbjct: 93 PPPPVASPPPATPPPVATPPPAPLASPPAQVPAP 126 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P+ P AP P P PP P P PPP Sbjct: 39 PPPAATPPPVSAPPPVTTSP----PPVTTAPPPANPPP 72 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P P P P P A PP P P P PP P Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPP-PATPPPVASPPPPVASPP 101 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G GG GGGG GG G G GG GGG Sbjct: 98 GGGGHYGGGGGHYGG--GGGGHGGGGHYGGGGGGYGGGGG 135 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GG G GG G GGGG GG G G Sbjct: 108 GHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 Score = 37.5 bits (83), Expect = 0.013 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G GGGG G G G GG GGG Sbjct: 87 GHYGGGG--GHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGG 127 Score = 37.5 bits (83), Expect = 0.013 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -3 Query: 951 GGGXXXGXXGX--GXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G G GG GGGG G G G GG GGG Sbjct: 99 GGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGG 140 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G G GG G GGGG GG G G Sbjct: 104 GGGGGHYGGGGGGHGGGG-HYGGGGGGYGGGGGHHGGG 140 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G GG G GGG GG G G G Sbjct: 83 GGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGG 120 Score = 36.7 bits (81), Expect = 0.023 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G GG G GGGG GG G G Sbjct: 90 GGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGG 127 Score = 35.9 bits (79), Expect = 0.040 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G G G GGGG G G GG GGG Sbjct: 57 GGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGG 99 Score = 35.9 bits (79), Expect = 0.040 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXG 838 G GG G G G GG GGGG GG G G GG G Sbjct: 104 GGGGGHYGGGGGGHGGGGHYGGGG-GGYGGGGGHHGGGGHG 143 Score = 35.5 bits (78), Expect = 0.053 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G G GG GGGG G G G GG GGG Sbjct: 46 GHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG--GGHYGGGG 86 Score = 35.1 bits (77), Expect = 0.070 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG G G GG G GG GGG Sbjct: 51 GGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGG 93 Score = 35.1 bits (77), Expect = 0.070 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G G G GGGG G G GG GGG Sbjct: 71 GLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGG 113 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G G GGGG G G GG GGG Sbjct: 67 GGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGG 106 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G GGGG G G GG GGG Sbjct: 80 GHYGGGG--GHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGG 120 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -3 Query: 951 GGGXXXGXXGX--GXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G G GG GGGG G G GG GGG Sbjct: 85 GGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGG 126 Score = 33.5 bits (73), Expect = 0.21 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 6/48 (12%) Frame = -3 Query: 960 GXXGGGXXXGXXGX---GXGGVXGGGG---XGGXGDXGXXXGGXXXGG 835 G GGG G G G GG GGGG GG G G GG GG Sbjct: 74 GYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGG 121 Score = 32.3 bits (70), Expect = 0.49 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGV-XGGGG--XGGXGDXGXXXGGXXXGGG 832 G GG G G G GG GGGG GG G GG GGG Sbjct: 62 GGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGG 107 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = -1 Query: 950 GGGXGG--GXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG GG G G G G GGGG G G G G Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGG 80 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G GG G G G G G G G Sbjct: 106 GGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 4/39 (10%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPP 951 P P PP PPPP +PP P P PPP PPP Sbjct: 529 PPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPP 567 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPP 949 P P SP PP PPPP P P P PP Sbjct: 528 PPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPP 559 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PPPP P PP PPP P P P Sbjct: 528 PPPPPLSPPPPSPP--PPYIYSSPPPPSPSPPPP 559 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 8/41 (19%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXN--------PPXPXPXXPPPXPPP 951 P P PP P PP P PP P PPP PPP Sbjct: 502 PPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPP 542 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P P PP+ PPP P PP PPP Sbjct: 678 PPPVYYPPVTQSPPPSPVYYPPVTQSPPPPP 708 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 6/41 (14%) Frame = +1 Query: 847 PXPXPXPPIX-XPPPPXPXXNP-----PXPXPXXPPPXPPP 951 P P P P PPPP +P P P P PPP PP Sbjct: 501 PPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPP 541 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXP----XPXXPXXXPPP 952 P P PP PPP +PP P P P PPP Sbjct: 522 PSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPP 558 Score = 33.1 bits (72), Expect = 0.28 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 9/47 (19%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXP------XXNPPXPXPXXPPP---XPPPXXP 960 P P PP+ PPP P +PP P P PP PPP P Sbjct: 692 PSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSP 738 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXX-PPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ PPPP P PP PP P P Sbjct: 721 PSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHP 759 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +1 Query: 853 PXPXPP----IXXPPPPXPXXNPPXPXPXXPPP 939 P P PP + PPPP P PP PPP Sbjct: 619 PPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPP 651 Score = 31.5 bits (68), Expect = 0.86 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 13/50 (26%) Frame = +2 Query: 851 PPXXXPXSPXPP-----------XPPPPXTPPXPXPXXP--XXXPPPXXP 961 PP P SP PP PPPP +PP P P P PPP P Sbjct: 506 PPEYEP-SPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSP 554 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP P PP P PP PPP Sbjct: 511 PSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPP 543 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PPPP +PP P PP P P Sbjct: 549 PPPPSPSPPPPYIYSSPP-PVVNCPPTTQSPPPP 581 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXP-----PPXPPPXXP 960 P P + PPP P +PP P P P PP P P P Sbjct: 516 PSSEMSPSVRAYPPPPPL-SPPPPSPPPPYIYSSPPPPSPSPP 557 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P P PP+ PPP P P PPP Sbjct: 635 PPPVYYPPVTASPPPPPVYYTPVIQSPPPPP 665 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 7/35 (20%) Frame = +3 Query: 879 SPPXXPXP-----QPPPPXPPXX--PXXXPPPXPP 962 SPP P P Q PPP PP P PP PP Sbjct: 617 SPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPP 651 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P+ PPP P P PPP PP P Sbjct: 649 PPPVYYTPVIQSPPPPPVYYSPVTQS--PPPPPPVYYP 684 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP P PP P P P PPP Sbjct: 486 PPPPSSKMSPSVKAYPPPPPPPEYEPSPPPP 516 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 844 VPXPXPXPPIXXPP-PPXPXXNPPXPXPXXPPPXPPP 951 V P P PP+ PP P P P P PPP Sbjct: 629 VQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPP 665 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +1 Query: 847 PXPXPX---PPIXXPPPPXPXXNPPXPXPXXPPP 939 P P P P I PPPP +P P PPP Sbjct: 647 PPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPP 680 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +2 Query: 872 SPXPPXPP--PPXTPPXPXPXXPXXXPPPXXP 961 SP PP P PP T P P P PP P Sbjct: 732 SPPPPSPVYYPPVTQSPPPPSTPVEYHPPASP 763 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTP-PXPXPXXPXXXPPP 952 PP P PPPP TP P P PPP Sbjct: 735 PPSPVYYPPVTQSPPPPSTPVEYHPPASPNQSPPP 769 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P + P P PPPP PP PP P Sbjct: 522 PSVRAYPPPPPLSPPPPSPPPPYIYSSPPPP 552 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 PP PPP P P P P PP Sbjct: 572 PPTTQSPPPPKYEQTPSPREYYPSPSPP 599 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/47 (31%), Positives = 15/47 (31%), Gaps = 2/47 (4%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXP--KXPXPXXPPPXSXGGXP 687 P P P P P A PP P P P PPP P Sbjct: 504 PPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPP 550 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P P P PP PP P N P PPP Sbjct: 552 PSPSPPPPYIYSSPP-PVVNCPPTTQSPPPP 581 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P PPPP PP PP PP Sbjct: 610 PTYYATQSPPPPPPPTYYAVQSPPPPP 636 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P P+ PPP P P P PPP P Sbjct: 663 PPPVYYSPVTQSPPPPPPVYYP-PVTQSPPPSP 694 Score = 28.3 bits (60), Expect = 8.0 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 13/51 (25%) Frame = +1 Query: 847 PXPXPX---PPIXXPPPPXPXX------NPPXPXPXXPPP----XPPPXXP 960 P P P P PPPP P +PP P P PP PPP P Sbjct: 704 PPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTP 754 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P P P+ PP P +PP P PPP Sbjct: 749 PPPSTPVEYHPPASPNQSPP-PEYQSPPP 776 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P PPPP PP P PPP PPP Sbjct: 384 PPPPPPPSAAAPPPPP----PPKKGPAAPPPPPPP 414 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 5/40 (12%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQ-----PPPPXPPXXPXXXPPPXPP 962 P P +PP P P+ PPPP PP PPP PP Sbjct: 387 PPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 37.1 bits (82), Expect = 0.017 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQ----PPPPXPPXXPXXXPPPXPP 962 P SPP P P PPPP P P PPP PP Sbjct: 376 PGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPP 414 Score = 35.5 bits (78), Expect = 0.053 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPX-PAXAXPPXPKXPXPXXPPPXSXGGXP 687 P PS P P P P P PP K P PPP S G P Sbjct: 388 PPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPP 433 Score = 35.1 bits (77), Expect = 0.070 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PPPP PP P P P PPP P Sbjct: 376 PGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPP 413 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +3 Query: 879 SPPXXPXPQ---PPPPXPPXXPXXXPPPXPP 962 +PP P P PPP PP PPP PP Sbjct: 371 APPAPPGPANQTSPPPPPPPSAAAPPPPPPP 401 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGG 681 P P G P P P A PP P P PPP G Sbjct: 373 PAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPG 415 Score = 31.5 bits (68), Expect = 0.86 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 8/42 (19%) Frame = +1 Query: 847 PXPXPXP---PIXXPPPPXPXXN-----PPXPXPXXPPPXPP 948 P P P P P PPPP P PP P PP PP Sbjct: 395 PPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPP 436 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPP---PXPPPXXP 960 P P P PPP P + P P PP P PP P Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPP 412 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXPP--PPXTPPXPXPXXPXXXP-PPXXP 961 PP P +P PP PP PP P P P PP P Sbjct: 400 PPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNP 439 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/47 (31%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPX--PKXPXPXXPPPXSXGGXP 687 P P+ P P P P PP P P P PP G P Sbjct: 376 PGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPP 422 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +2 Query: 881 PPXPPPPX--TPPXPXPXXPXXXPPPXXP 961 PP PP P T P P P PPP P Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPP 400 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +2 Query: 851 PPXXXPXSPXP-PXPPPPXTPPXPXPXXPXXXPPP 952 PP P SP P P PPPP P P P PPP Sbjct: 86 PPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPP 120 Score = 37.1 bits (82), Expect = 0.017 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPP---XPPPXXP 960 P PP PPPP P PP P PP PPP P Sbjct: 91 PVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPP 129 Score = 36.7 bits (81), Expect = 0.023 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP---PPXXP 960 P P P P PPP P +PP P PPP P PP P Sbjct: 98 PSPPPPLPTEAPPPANPVSSPP-PESSPPPPPPTEAPPTTP 137 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PPPP + P P P P PP P Sbjct: 137 PITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVP 174 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P PPP P P P PPP P P Sbjct: 73 PEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPP 110 Score = 35.5 bits (78), Expect = 0.053 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 5/41 (12%) Frame = +1 Query: 853 PXPXPPIXXPPP-----PXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PP P P NPP P P PP P P P Sbjct: 124 PPPPPPTEAPPTTPITSPSPPTNPPPP-PESPPSLPAPDPP 163 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP PP P PP P PPP P P P Sbjct: 72 PPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPP 103 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 5/37 (13%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPX-----PXPXXPPPXPPPXXP 960 PP PPPP P PP P P PP PP P Sbjct: 119 PPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPP 155 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +2 Query: 851 PPXXXPXSPXPP--XPPPPXTPP-XPXPXXPXXXPPP 952 PP SP PP PPPP +PP P P P PP Sbjct: 133 PPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPP 169 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPPP P P PP PP P Sbjct: 114 PVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPP 151 Score = 32.3 bits (70), Expect = 0.49 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 10/48 (20%) Frame = +1 Query: 847 PXPXPXPP---IXXPPP------PXPXXNPPXPXP-XXPPPXPPPXXP 960 P P P PP + PPP P P +PP P P PPP P P Sbjct: 71 PPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSP 118 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPP--PXPP 962 P SP P PPP PP P PP P PP Sbjct: 133 PPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPP 169 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXP-PPXXP 961 PP SP P PPP P P P P PP P Sbjct: 110 PPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNP 147 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P+ PP P +PP P P PP P P Sbjct: 109 PPPANPVSSPP---PESSPPPPPPTEAPPTTPITSP 141 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +2 Query: 851 PPXXXPXSPXPPXP----PPPXTPPXPXPXXPXXXPPPXXP 961 P P P PP P PPP T P P P PPP P Sbjct: 67 PLSSPPPEPSPPSPSLTGPPPTTIPVSPP--PEPSPPPPLP 105 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P PP PP T P P P PPP Sbjct: 118 PPPESSPPPPPPTEAPP-TTPITSPSPPTNPPPP 150 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P+ PPP +PP P PPP P P Sbjct: 62 PPPETPLSSPPPEP---SPPSPSLTGPPPTTIPVSP 94 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 596 PXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P T+P PP P P PPP P APP Sbjct: 85 PPPTTIPVSPPPEPSP-----PPPLPTEAPP 110 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +1 Query: 865 PPIXXP--PPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP P PPP P PP P PP P P Sbjct: 86 PPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPP 119 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P P P P P P P P P PP S P Sbjct: 86 PPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPP 128 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P PP P P P PP P P PP Sbjct: 141 PSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPP 175 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPP--PXPPP 951 P P P PP P P P P PP PPP Sbjct: 232 PPPGSKRPTPSPPSPSDSKRPVHPSPPSPPEETLPPP 268 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P P P P NP P PP PP Sbjct: 147 PPPPPESP-PSLPAPDPPSNPLPPPKLVPPSHSPP 180 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPP 949 P P P P PPP PP P PP Sbjct: 155 PSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPP 187 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP PPP P +P PP PP Sbjct: 255 PSP-PSPPEETLPPPKPSPDPLPSNSSSPPTLLPP 288 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +2 Query: 851 PPXXXPXSPX-PPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PP P P P P P P PP P Sbjct: 143 PPTNPPPPPESPPSLPAPDPPSNPLP-PPKLVPPSHSP 179 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTP-PXPXPXXPXXXPPPXXP 961 PP P P P PP P P P P PP P Sbjct: 147 PPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLP 184 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +1 Query: 853 PXPXPPIXXPPPP---XPXXNPPXPXPXXPPPXPPP 951 P P PP PPP P +PP P P PP Sbjct: 158 PAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPP 193 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +2 Query: 851 PPXXXPXSPXPP-XPPPPXTPPXPXPXXPXXXPPP 952 PP P SP PP PPPP PP P PPP Sbjct: 61 PPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPP 95 Score = 39.1 bits (87), Expect = 0.004 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 872 SPXPPXPPPPXTPPXPXPXXPXXXPPP 952 +P PP PPPP PP P P PPP Sbjct: 58 NPPPPSPPPPSPPPPACPPPPALPPPP 84 Score = 35.1 bits (77), Expect = 0.070 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P P PP PPP P P PPP P Sbjct: 65 PPPSPPPPACPPPPALPPPPPKKVSSYCPPPPP 97 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +2 Query: 872 SPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 SP PPP +PP P P P PPP P Sbjct: 52 SPSCIQNPPPPSPPPPSPPPPACPPPPALP 81 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 871 IXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 I PPPP P P P PPP PP P Sbjct: 56 IQNPPPPSPPPPSPPPPACPPPPALPPPPP 85 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = +1 Query: 847 PXPXPXPPIXXPP--PPXPXXNPPXPXPXXP--PPXPP 948 P P P PP PP PP P PP P PP PP Sbjct: 60 PPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPP 97 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P + P P P PP P PP P P PP Sbjct: 53 PSCIQNPPPPSPPPPSPPPPACPPPPALPPPP 84 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P PP PP P P PP P PPP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPP 85 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXP 945 PP PPPP P P P PPP P Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPP 85 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPP--PPXPPXXPXXXPPPXPP 962 P P SPP P PP PP PP PP PP Sbjct: 61 PPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPP 97 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P SP P PP P PP P PP P Sbjct: 48 PIKCSPSCIQNPPPPSPPPPSPPPPACPPPP 78 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P PA PP K PPP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPP 96 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 614 PXQXPPXPXPXXPXRPPPXPXGAPP 688 P PP P P P PPP PP Sbjct: 60 PPPSPPPPSPPPPACPPPPALPPPP 84 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 VP P P P P P +PP P P PPP PP Sbjct: 706 VPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPP 740 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP PP P + P P P PPP PP Sbjct: 708 PPPPPAPPA--PPTPIVHTSSPPPPPPPPPPPAPP 740 Score = 36.3 bits (80), Expect = 0.030 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 9/47 (19%) Frame = +1 Query: 847 PXPXPXPP-----IXXPPPPXPXXNPPXPXP----XXPPPXPPPXXP 960 P P P PP + PPP P P P P PPP PPP P Sbjct: 690 PPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPP 736 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P PPPP P P P PPP P Sbjct: 696 PPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPP 732 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P + P P PPPP PPP PP Sbjct: 761 PRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPPP 795 Score = 31.5 bits (68), Expect = 0.86 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 885 PXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P PPPP PPP PP Sbjct: 687 PRPPPPPPPPPMQHSTVTKVPPPPPP 712 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PPPP P PP P P P Sbjct: 687 PRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTP 720 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPP-PXPPPXXP 960 P P PP P PP P N PP P PP P Sbjct: 728 PPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLP 764 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP S PP P P PP P PPP Sbjct: 760 PPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPP 793 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP +P P PPPP P P P P P Sbjct: 779 PPLGQTRAPSAPPPPPPKLGTKLSPSGPNVPPTPALP 815 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 5/39 (12%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXP-----XPXXPPPXPP 948 P P P PP P PP P P PPP PP Sbjct: 757 PPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPPP 795 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXG 678 P PAP + PP P P P P P S G Sbjct: 712 PAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNG 746 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXP 945 PP PP P + P P PPP P Sbjct: 754 PPAPPAPPRLPTHSASPPPPTAPPPPP 780 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PPI PPPP P PP P PP PPP Sbjct: 68 PPPPIYSPPPP-PIYPPPIYSPPPPPIYPPP 97 Score = 36.7 bits (81), Expect = 0.023 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PPI PPPP P PP P P PPP Sbjct: 77 PPPIYPPPIYSPPPP-PIYPPPIYSPPPTPISPPP 110 Score = 36.3 bits (80), Expect = 0.030 Identities = 19/42 (45%), Positives = 21/42 (50%), Gaps = 4/42 (9%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPP----PXPPPXXP 960 P P P+ PPPP P +PP P P PP P PPP P Sbjct: 56 PPPVYSRPVAFPPPP-PIYSPPPP-PIYPPPIYSPPPPPIYP 95 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPP---PXPPPXXP 960 P P P+ PPPP P + P P PP P PPP P Sbjct: 43 PPPPYRSPVTIPPPP-PVYSRPVAFPPPPPIYSPPPPPIYP 82 Score = 34.7 bits (76), Expect = 0.093 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPP--XPXXNPPXPXPXXPPP--XPPP 951 V P P P PPPP P P P P PPP PPP Sbjct: 64 VAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPP 103 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PPP +PP P P PP P Sbjct: 69 PPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTP 105 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 5/39 (12%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPP---PPXPP--XXPXXXPPPXP 959 P P SPP P PP PP PP P PPP P Sbjct: 67 PPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTP 105 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +1 Query: 583 PAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P P P P + PP P P P PP + P Sbjct: 75 PPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPP 109 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 4/38 (10%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQP----PPPXPPXXPXXXPPPXP 959 P P SP P P P P PP P PPP P Sbjct: 42 PPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPP 79 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G G GGG G G GG G G GG G G G G Sbjct: 130 GGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGG 167 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G G GG GG G GG G G G Sbjct: 107 GGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYG 144 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G GGG G GG G GGG GG G G Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGG 120 Score = 35.1 bits (77), Expect = 0.070 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -1 Query: 959 GXXGGGXGGGXXG--XGXGGLXXGXGGGGXXXGGXG 858 G GGG GG G G GG G GGGG GG G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGG 123 Score = 35.1 bits (77), Expect = 0.070 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG GG GG G GG GGG Sbjct: 95 GGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGG 137 Score = 34.7 bits (76), Expect = 0.093 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G GG GGG G GG G GGG GG G Sbjct: 91 GGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 33.9 bits (74), Expect = 0.16 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGG-----XGDXGXXXGGXXXGGG 832 G GGG G G GG GG G GG G G GG GGG Sbjct: 119 GGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGG 166 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVX----GGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G G GG G G GG G G GG GGG Sbjct: 107 GGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGG 153 Score = 33.1 bits (72), Expect = 0.28 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = -1 Query: 959 GXXGGGXGGGXXGXG---XGGLXXGXGGGGXXXGGXGXG 852 G GGG G G G G GG GGGG GG G G Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 31.9 bits (69), Expect = 0.65 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGG---GXGGXGDXGXXXGGXXXGGG 832 GGG G G G G GGG GG G G G GGG Sbjct: 105 GGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGG 147 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G G G G GG GGG G G G G GG Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G GGG G G G GG G GG GG G Sbjct: 135 GGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 168 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GGG GG G GG GGG Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGG------GGYSGGGG 122 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GGG G GGG G GG G G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGG 122 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXG-GXGDXGXXXGGXXXGG 835 G GG G G GGGG G G G G GG GG Sbjct: 115 GGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGG 157 Score = 28.7 bits (61), Expect = 6.1 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGX-GGXGDXGXXXGGXXXGGG 832 G G G G G G GG GGG G GD G GG GGG Sbjct: 130 GGYGSGGGGGGRGYGGGGRREGGGYGG--GDGGSYGGG---GGG 168 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 G G G G G GG +G G G G G S G G Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGG 123 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP+ PPP P PP P PPP PP P Sbjct: 69 PPPPLDSSPPPPPDLTPPPSSP--PPPDAPPPIP 100 Score = 38.3 bits (85), Expect = 0.008 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P + PPPP +PP P PPP PP Sbjct: 61 PPPTVSSPPPPPLDSSPPPPPDLTPPPSSPP 91 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P SPP P PPP PP P PPP P Sbjct: 69 PPPPLDSSPPPPPDLTPPPSSPP--PPDAPPPIP 100 Score = 35.1 bits (77), Expect = 0.070 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P PP PPP +PP P PPP P Sbjct: 98 PIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPP 130 Score = 34.7 bits (76), Expect = 0.093 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP---XPPPXXP 960 P PP PPP P + P P P PP PPP P Sbjct: 56 PAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAP 96 Score = 34.7 bits (76), Expect = 0.093 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPP 953 P P L+PP P PPP PP P PPP Sbjct: 77 PPPPPDLTPP--PSSPPPPDAPPPIPIVFPPP 106 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPP--XPXPXXPPPXP 945 V P P P PPPP PP P P PPP P Sbjct: 65 VSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIP 100 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +1 Query: 853 PXPXPPIXXPP--PPXPXXNPPXPXPXXPPPXPPP 951 P P P + PP PP P PP P PP PP Sbjct: 77 PPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPP 111 Score = 32.7 bits (71), Expect = 0.37 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P + PPPP + P P P PPP Sbjct: 119 PPPEVFEPPPPPADEDESPPAPPPPEQLPPP 149 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPP----XPPPXXP 960 PP PPP PP P PPP PPP P Sbjct: 55 PPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSP 90 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPP---XPXPXXPPPXPPP 951 P P PP PPP PP P P P PPP Sbjct: 37 PPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPP 72 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = +2 Query: 851 PPXXXPXSPXP----PXPPPPXTPPXPXPXXPXXXPP 949 PP P P P PPP TPP P P PP Sbjct: 62 PPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPP 98 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 9/44 (20%) Frame = +1 Query: 847 PXPXPXPPIXXPPP-----PXPXXNPPXPXPXXPPP----XPPP 951 P P PP PPP P P +PP PPP PPP Sbjct: 85 PPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPP 128 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +1 Query: 847 PXPXPXPP---IXXPPPPXPXXNPPXPXPXXP-PPXPPP 951 P P PP PPPP PP P PP PPP Sbjct: 104 PPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPP 142 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P+ P P P P PP P P PPP Sbjct: 61 PPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPP 98 Score = 29.5 bits (63), Expect = 3.5 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 5/50 (10%) Frame = +1 Query: 553 PRPSGLXPXXP---APXPXXPXPAXAXPPXP-KXPXP-XXPPPXSXGGXP 687 P P P P P P P P A PP P P P PPP S P Sbjct: 70 PPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPP 119 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPX-PXXNPPXPXPXXPPPXPPPXXP 960 P P PP PPP P P P P P P P Sbjct: 138 PAPPPPEQLPPPASSPQGGPKKPKKHHPGPATSPPAP 174 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P PPP P P PPP Sbjct: 47 PPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPP 80 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P PPP + P P P PPP Sbjct: 48 PPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPP 81 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P L P P P P+ PP P P PP Sbjct: 68 PPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPP 105 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 5/36 (13%) Frame = +1 Query: 859 PXPPIXXPPPP--XPXXNPPXPXP-XXPPP--XPPP 951 P PP PPP P + P P P PPP PPP Sbjct: 77 PPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPP 112 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 7/46 (15%) Frame = +1 Query: 844 VPXPXPXPP-----IXXPPPPXPXXNPP--XPXPXXPPPXPPPXXP 960 +P P P PP I PPPP P PP P PP PPP P Sbjct: 437 LPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPPLPP 482 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPP---IXXPPPPXPXXNPPXPXPXXPPP----XPPPXXP 960 P P P PP + PPPP P P P PPP PPP P Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPP 567 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +1 Query: 847 PXPXPXPP--IXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP PPPP P PP PPP PPP Sbjct: 536 PPPPPPPPGTAAAPPPPPP---PPGTQAAPPPPPPPP 569 Score = 36.3 bits (80), Expect = 0.030 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P PPP P PP PPP PPP Sbjct: 511 PPPPPLPTTIAAPPPPP---PPPRAAVAPPPPPPP 542 Score = 35.9 bits (79), Expect = 0.040 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 9/47 (19%) Frame = +1 Query: 847 PXPXPXPPIXX-----PPPPXPXXNPPXPXPXXPPP----XPPPXXP 960 P P P PP+ PPPP P P P PPP PPP P Sbjct: 508 PPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPP 554 Score = 35.5 bits (78), Expect = 0.053 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 6/41 (14%) Frame = +1 Query: 847 PXPXPXPPIXXP------PPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP P PPP P P PPP PPP Sbjct: 475 PPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPP 515 Score = 35.5 bits (78), Expect = 0.053 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P PP PPPP PP PPP PP Sbjct: 537 PPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPP 568 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P P PPPP P PPP PP Sbjct: 494 PPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPP 528 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P +S P P P PPPP PPP PP Sbjct: 445 PIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPP 479 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 5/32 (15%) Frame = +3 Query: 882 PPXXPXPQ-----PPPPXPPXXPXXXPPPXPP 962 PP P P PPPP PP PPP PP Sbjct: 511 PPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPP 542 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP PP PPPP PP P PPP Sbjct: 444 PPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPP 477 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 894 PXPQPPPPXPPXXPXXXPPPXPP 962 P P PPPP P PPP PP Sbjct: 508 PPPPPPPPLPTTIAAPPPPPPPP 530 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXP----XXPPPXPPP 951 +P PP PPP PP P P PPP PPP Sbjct: 516 LPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPP 555 Score = 32.7 bits (71), Expect = 0.37 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 868 PIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P+ PPP P + P PPP PPP Sbjct: 436 PLPSPPPTPPIADIAISMPPPPPPPPPP 463 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +1 Query: 865 PPIXXPPPPXPXXNP-PXPXPXXPPPXPPPXXP 960 PP PPPP P P P PPP PP P Sbjct: 454 PPPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMP 486 Score = 32.7 bits (71), Expect = 0.37 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 13/48 (27%) Frame = +1 Query: 847 PXPXPXPP----IXXPPPPXPXXN-----PPXPX----PXXPPPXPPP 951 P P P PP PPPP P N PP P PPP PPP Sbjct: 549 PPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPP 596 Score = 32.7 bits (71), Expect = 0.37 Identities = 20/49 (40%), Positives = 21/49 (42%), Gaps = 14/49 (28%) Frame = +1 Query: 847 PXPXPXPPIXX---PPPPXPXXN-----PPXPXPXXP------PPXPPP 951 P P P PP+ PPP P N PP P P P PP PPP Sbjct: 562 PPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPP 610 Score = 32.3 bits (70), Expect = 0.49 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 6/39 (15%) Frame = +1 Query: 853 PXPXPPIXXP-----PPPXPXXNPPXPXPXX-PPPXPPP 951 P P PP P PPP P PP P PPP PPP Sbjct: 493 PPPTPPAFKPLKGSAPPPPPP--PPLPTTIAAPPPPPPP 529 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP P PP P P PPP PP P Sbjct: 436 PLPSPP---PTPPIADIAISMPPPPPPPPPPPAVMP 468 Score = 31.9 bits (69), Expect = 0.65 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 8/46 (17%) Frame = +1 Query: 847 PXPXPXPPIXXP----PPPXPXXNPPXPXPXX----PPPXPPPXXP 960 P P P PP P PP P PP P PPP PP P Sbjct: 457 PPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKP 502 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P PPP TPP P PPP P Sbjct: 478 PPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPP 514 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P PPPP P P PPP Sbjct: 497 PPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPP 530 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P PPPP P PPP PP Sbjct: 538 PPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP PP P P P P P P Sbjct: 542 PPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPP 578 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P S P P PPPP P PPP PP Sbjct: 578 PPMPMGNSGSGGPPP-PPPPMPLANGATPPPPPPP 611 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 12/49 (24%) Frame = +2 Query: 851 PPXXXPX---SPXPPXPP---------PPXTPPXPXPXXPXXXPPPXXP 961 PP P +P PP PP PP PP P P PPP P Sbjct: 481 PPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPP 529 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPPXG 694 P P T+ PP P P PPP P PP G Sbjct: 513 PPPLPTTIAAPPPPPPPPRAAVAPPPPP---PPPG 544 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P A A PP P P PP Sbjct: 526 PPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPP 563 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXG---APP 688 P P A P PP P PPP P G APP Sbjct: 528 PPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPP 563 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P PP PPPP P PPP P Sbjct: 417 PPPPPPPPPPLSFIKTASLPLPSPPPTPP 445 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXP---XXPPP 666 P P L AP P P P A P P P P PPP Sbjct: 511 PPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPP 551 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +3 Query: 882 PPXXPXPQ--PPPPXPPXXPXXXPPPXP 959 PP P Q PPPP PP P P P Sbjct: 552 PPPPPGTQAAPPPPPPPPMQNRAPSPPP 579 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P L+ P P PPPP PPP PP Sbjct: 593 PPPPMPLANGATPPP-PPPPMAMANGAAGPPPPPP 626 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP + P P PP TPP PPP P Sbjct: 425 PPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPP 461 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPP---IXXPPPPXPXXNPPXPXP----XXPPPXPPPXXP 960 P P P PP I P P P P PPP PPP P Sbjct: 419 PPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPP 463 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXP--PPXPPP 951 P PP PPP PP P P P PPP Sbjct: 543 PGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPP 579 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P PP PPPP PP PP P Sbjct: 550 PPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMP 581 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PP PPPP +PP P PP PP Sbjct: 457 PPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPP 488 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +1 Query: 853 PXPXPPIXX-PPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P + PPPP +PP P PP PPP P Sbjct: 494 PPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPP 530 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +1 Query: 859 PXPPIXX--PPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PPPP +PP P P PPP P P Sbjct: 504 PPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPP 539 Score = 36.3 bits (80), Expect = 0.030 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPP--PXPPPXXP 960 P PP PPPP P +PP P P PPP P Sbjct: 522 PPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSP 557 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +1 Query: 847 PXPXPXPPIXX--PPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP PPPP +PP P P PPP Sbjct: 462 PSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPP 498 Score = 35.9 bits (79), Expect = 0.040 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 4/42 (9%) Frame = +1 Query: 847 PXPXPXPPIXX-PPPPXPXXNPPXPXPXXPPPXP---PPXXP 960 P P PP+ PPPP P PP P PPP P PP P Sbjct: 615 PSPLYYPPVTPSPPPPSPVYYPPV-TPSPPPPSPVYYPPVTP 655 Score = 35.1 bits (77), Expect = 0.070 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP PP P +PP P P PP P Sbjct: 513 PPPPYVYSSPPPPPPSPPPPCPESSPPPP 541 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +1 Query: 847 PXPXPXPPIXX-PPPPXPXXNPPXPXPXXPPPXP 945 P P PP+ PPPP P PP P PPP P Sbjct: 630 PSPVYYPPVTPSPPPPSPVYYPPV-TPSPPPPSP 662 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPP 953 P P S P P P PPPP P P PPP Sbjct: 513 PPPPYVYSSPPPPPPSPPPPCPESSP---PPP 541 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP---PPXXP 960 P P PP+ PPP P P PPP P PP P Sbjct: 585 PSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTP 625 Score = 32.7 bits (71), Expect = 0.37 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +1 Query: 847 PXPXPXPPIXX-PPPPXPXXNPPXPXPXXPPPXP---PPXXP 960 P P P + PPPP P PP P PPP P PP P Sbjct: 600 PSPVYYPQVTPSPPPPSPLYYPPVT-PSPPPPSPVYYPPVTP 640 Score = 31.9 bits (69), Expect = 0.65 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 10/48 (20%) Frame = +1 Query: 847 PXPXPXPPIXX-PPPPXP------XXNPPXPXPXXPPP---XPPPXXP 960 P P PP+ PPPP P +PP P P PP PPP P Sbjct: 555 PSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSP 602 Score = 31.9 bits (69), Expect = 0.65 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 10/48 (20%) Frame = +1 Query: 847 PXPXPXPPIXX-PPPPXPXX------NPPXPXPXXPP---PXPPPXXP 960 P P PP+ PPPP P +PP P P P P PPP P Sbjct: 570 PSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSP 617 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXP-PPXPPPXXP 960 P P P P+ PP P PP P P P PPP P Sbjct: 625 PSPPPPSPVYY-PPVTPSPPPPSPVYYPPVTPSPPPPSP 662 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +3 Query: 867 PXXLSPPXXPX--PQPPPPXPPXXPXXXPPPXPP 962 P SP P P PPPP P P P P PP Sbjct: 627 PPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPP 660 Score = 31.5 bits (68), Expect = 0.86 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 13/51 (25%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXP-------------XPXXPPPXPPPXXP 960 P P P PPPP +PP P P PPP PPP P Sbjct: 484 PPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCP 534 Score = 31.5 bits (68), Expect = 0.86 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 10/48 (20%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXP-------XXNPPXPXPXXPPP---XPPPXXP 960 P P P PP PP P +PP P P PP PPP P Sbjct: 525 PPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSP 572 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +3 Query: 867 PXXLSPPXXPX--PQPPPPXPPXXPXXXPPPXPP 962 P SP P P PPPP P P P P PP Sbjct: 597 PPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPP 630 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P PP P PPPP P PP P Sbjct: 522 PPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPP 555 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P P PPPP P P PPP Sbjct: 458 PPPPPSPSPPPPYVYSSPPPPYVYSSPPP 486 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXP-PXXPXXXPPPXPP 962 +SP P PPPP P P P P PP Sbjct: 449 MSPSVRAYPPPPPPSPSPPPPYVYSSPPPP 478 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P P P+P P P P P P P PP + P Sbjct: 615 PSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPP 659 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 851 PPXXXPXSPXP-PXPPPPXTPPXPXPXXPXXXPPP 952 PP SP PPPP P P P PPP Sbjct: 443 PPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPP 477 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P S P P PP PP P PPP P Sbjct: 504 PPPPYVYSSPPPPYVYSSPPPPPPSP---PPPCP 534 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXP 673 P P + P PP P P P PP P Sbjct: 514 PPPYVYSSPPPPPPSPPPPCPESSPPPP 541 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXP 934 PP SP PP P PP P P P Sbjct: 514 PPPYVYSSPPPPPPSPPPPCPESSPPPP 541 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +3 Query: 867 PXXLSPPXXPX--PQPPPPXPPXXPXXXPPPXPP 962 P SP P P PPPP P P P PP Sbjct: 642 PPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPP 675 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/28 (42%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 880 PPPPXPXXNPP-XPXPXXPPPXPPPXXP 960 PPPP +P P PPP P P P Sbjct: 442 PPPPYSKMSPSVRAYPPPPPPSPSPPPP 469 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 6/40 (15%) Frame = +2 Query: 851 PPXXXPXSPXPPX----PPPPXT--PPXPXPXXPXXXPPP 952 PP SP PP PPPP P P P PPP Sbjct: 458 PPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPP 497 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPP---XPPPXXP 960 P P P+ PP +PP P P PP PPP P Sbjct: 552 PPPPSPVYYPPVTQ---SPPPPSPVYYPPVTNSPPPPSP 587 >At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 161 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +1 Query: 847 PXPXPXP-PIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P P P P+ PPPP P P P P PP P Sbjct: 38 PVPSPKPKPVQCPPPPRPSVPSPNPRPVTPPRTP 71 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P P P PP P P P P P P P Sbjct: 32 PSPKPKPVPSPKPKPVQCPPPPRPSVPSPNPRPVTP 67 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP--PPXXP 960 P P P P P P PP P P P P PP P Sbjct: 32 PSPKPKPVPSPKPKPVQCPPPPRPSVPSPNPRPVTPPRTP 71 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 587 RPTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAP 685 +P P P Q PP P P P P P P P Sbjct: 37 KPVPSPKPKPVQCPPPPRPSVP-SPNPRPVTPP 68 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +1 Query: 847 PXPXPX---PPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP PPPP P +PP P P PPP Sbjct: 56 PPPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPP 93 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 +P P P PPPP P +PP P PPP P Sbjct: 43 LPSPVYSSPADLPPPPTPVYSPP-PADLPPPPTP 75 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P+ + PA P P P + P P P PPP Sbjct: 56 PPPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPP 93 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 851 PPXXXPXSPXP-PXPPPPXTPPXPXPXXPXXXPPP 952 PP P P P PP PP P P PPP Sbjct: 65 PPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPP 99 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P PP PP PP P P PPP Sbjct: 55 PPPPTPVYSPPPADLPP--PPTPYYSPPADLPPP 86 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 7/38 (18%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPP---PXPPXX----PXXXPPPXP 959 P L PP P PPP P PP P PPP P Sbjct: 51 PADLPPPPTPVYSPPPADLPPPPTPYYSPPADLPPPTP 88 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 583 PAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P PA PP P P P PP Sbjct: 71 PPPTPYYSPPADLPPPTPIYPPPVAFPP 98 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPP 951 P PP+ PPPP +PP P PPP PPP Sbjct: 45 PPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPP 79 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPP 951 P PP+ PPPP +PP P PPP PPP Sbjct: 77 PPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPP 111 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPP 951 P PP+ PPPP +PP P PPP PPP Sbjct: 61 PPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPP 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPP 951 P PP+ PPPP +PP P PPP PPP Sbjct: 93 PPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP 127 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPP 951 P PP+ PPPP +PP P PPP PPP Sbjct: 109 PPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP 143 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPP 951 P PP+ PPPP +PP P PPP PPP Sbjct: 125 PPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP 159 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPP 951 P PP+ PPPP +PP P PPP PPP Sbjct: 141 PPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP 175 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPP 951 P PP+ PPPP +PP P PPP PPP Sbjct: 157 PPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPP 191 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP-----XPPP 951 P PP+ PPPP +PP P PPP PPP Sbjct: 173 PPPPVKSPPPPYLYSSPPPPVKSPPPPVYIYASPPP 208 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PP P +PP P PP P P Sbjct: 48 PVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPP 85 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PP P +PP P PP P P Sbjct: 64 PVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPP 101 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PP P +PP P PP P P Sbjct: 80 PVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPP 117 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PP P +PP P PP P P Sbjct: 96 PVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPP 133 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PP P +PP P PP P P Sbjct: 112 PVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPP 149 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PP P +PP P PP P P Sbjct: 128 PVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPP 165 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PP P +PP P PP P P Sbjct: 144 PVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPP 181 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PP P +PP P PP P P Sbjct: 160 PVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPPVKSPP 197 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PP P +PP P PP P P Sbjct: 36 PPPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPP 69 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PP PP P +PP P P PP Sbjct: 176 PVKSPPPPYLYSSPPPPVKSPPPPVYIYASPPPP 209 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PPPP PP PPP P P Sbjct: 36 PPPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPP 71 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP SP PP PP P P PPP Sbjct: 37 PPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPP 70 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P L PP P PP P PP PPP PP Sbjct: 154 PESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXP----PPXPPP 951 P P PP PPP +PP P P P PP PPP Sbjct: 147 PPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 35.5 bits (78), Expect = 0.053 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP P +PP P P P PP P Sbjct: 148 PPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPP 184 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P PP PP P +P P P P P PP Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPPP 175 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 553 PRPSGLXPXX-PAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P P PP P P PPP Sbjct: 147 PPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 875 PXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P PP PPP + P P P P P P Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPP 174 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 Query: 593 TPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 +P +LP P P P P PPP PP Sbjct: 151 SPPPESLPPPSPESPSPPSPEPPPPSSLEPPP 182 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P PP P P P P P P PPP P Sbjct: 32 PSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACP 69 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXP-XXPPPXPPPXXP 960 P P P P PPP PP P P PPP P P P Sbjct: 52 PSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPP 90 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 3/38 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPP-PPXPXXNP-PXPXP-XXPPPXPPP 951 P P P PP PP PP P P P P P PPP P P Sbjct: 58 PQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKP 95 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNP-PXPXPXXPP-PXPPPXXP 960 P P P PP P P P P P P P PP P P P P Sbjct: 75 PQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPP 114 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP-PPXXP 960 P P P P PP P P P P P P P P PP P Sbjct: 79 PAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGP 117 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXX-NPPXPXPXXPPPXPPPXXP 960 P P P PP P P P PP P P PP PP P Sbjct: 83 PEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKP 121 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNP-PXPXPXXPPPXP 945 P P P PP PP P P P P P P PP P Sbjct: 107 PTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKP 140 Score = 37.1 bits (82), Expect = 0.017 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +1 Query: 847 PXPXPXP-PIXXPPPPXPXXNPPXPXPXX-PPPXPPP 951 P P P P P+ P PP P P P P PPP P P Sbjct: 87 PAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAP 123 Score = 36.7 bits (81), Expect = 0.023 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXP-XXPPPXPPPXXP 960 P P P PP P P P PP P P PPP PP P Sbjct: 36 PKPQPKPPPAPSPSPCPSP-PPKPQPKPVPPPACPPTPP 73 Score = 36.7 bits (81), Expect = 0.023 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPP-PXPPPXXP 960 P P P P PP P P PP P PP P P P P Sbjct: 44 PAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPP 82 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P P P P +PP P P P PP P Sbjct: 81 PPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPP 118 Score = 36.3 bits (80), Expect = 0.030 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P+P + P P P P P A PP PK P P P P Sbjct: 58 PQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPP 102 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P PP P P PP P P P P P Sbjct: 93 PKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTP 127 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXN-PPXPXPXXPPPXPPP 951 P P P PP P P P PP P P P PPP Sbjct: 48 PSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPP 83 Score = 35.5 bits (78), Expect = 0.053 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXP-PIXXPPPPXPXXNPPXPXPXX-PPPXPPPXXP 960 P P P P P+ P P PP P P PPP P P P Sbjct: 4 PTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPP 43 Score = 35.1 bits (77), Expect = 0.070 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPP-PXPPPXXP 960 P P P PP P P P +P P P PP P P P P Sbjct: 28 PSPCPSPPPKPQPKPPPAPSPS-PCPSPPPKPQPKPVPP 65 Score = 35.1 bits (77), Expect = 0.070 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P PP P PQ P P PP P PPP P Sbjct: 64 PPPACPPTPPKPQ-PKPAPPPEPKPAPPPAP 93 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP SP P PP P P P P P P P Sbjct: 42 PPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKP 75 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPP P PP P P PPP Sbjct: 22 PVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPP 56 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXP 959 SPP P P+PPP P P PPP P Sbjct: 33 SPPPKPQPKPPPA-PSPSPCPSPPPKP 58 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPP--PPXPXXNPPXP-XPXXPPPXPPP 951 P P P P PP PP P P P P P P PPP Sbjct: 54 PPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPP 91 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 844 VPXPXPX-PPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 VP P P PP P P P PP P P P P P P Sbjct: 96 VPCPSPPKPPAPTPKPVPPHGPPPKPAP-APTPAPSP 131 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P PS P P P P P A PP P P P PP Sbjct: 46 PSPSPCPSPPPKPQPK-PVPPPACPPTPPKPQPKPAPP 82 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 V P P PP P P +PP PPP P P Sbjct: 13 VAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSP 48 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNP---PXPXPXXPPPXPPPXXP 960 P P P PPP P P P P P PP PP P Sbjct: 69 PPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTP 109 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P P PP P P P P P P P Sbjct: 91 PAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAP 125 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXP-PXPPPPXTP-PXPXPXXPXXXPPPXXP 961 P P +P P P P PP P P P P P PP P Sbjct: 85 PKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAP 123 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P P P P P P P P PP P Sbjct: 50 PCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKP 87 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P SP P P+P P PP P P P PP Sbjct: 22 PVAPPGPSPCPSPPPKPQ-PKPPPAPSPSPCPSPP 55 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P + P P+ P P P P P P PP S P Sbjct: 8 PSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCP 52 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PP P P P P PP P Sbjct: 69 PPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPP 105 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P S P P P P PP P PPP P Sbjct: 16 PGPSSKPVAPPGPSPCPSPPPKPQPKPPPAP 46 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +3 Query: 879 SPPXXPXPQP---PPPXPPXXPXXXPPPXP 959 SPP P P P PP PP P P P P Sbjct: 100 SPPKPPAPTPKPVPPHGPPPKPAPAPTPAP 129 Score = 30.3 bits (65), Expect = 2.0 Identities = 26/115 (22%), Positives = 31/115 (26%) Frame = +2 Query: 344 PXPLASXXXPXXRRPRXXFSXHXXTXPTPPAXAXXLXGPSSAFPPXXXXXXXXXXXXXXA 523 P P P +P+ + P+PP P A PP Sbjct: 26 PGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEP 85 Query: 524 XPALXXXXXXXXXXXXXXXXXRPTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 PA PTP P PP P P P P P +PP Sbjct: 86 KPA-PPPAPKPVPCPSPPKPPAPTPKPVP-PHGPPPKPAPAPTPAPSPKPAPSPP 138 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP PP P P P P P P Sbjct: 55 PPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPP 91 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 574 PXXPAPXP-XXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P P P P P A PP PK P P PP P Sbjct: 72 PPKPQPKPAPPPEPKPAPPPAPK-PVPCPSPPKPPAPTP 109 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P+P P P P P P PK P P P G P Sbjct: 75 PQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPP 119 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +2 Query: 590 PTPXAXTLPXQXP-PXPXPXXPXRPPPXPXGAPPXG 694 P P P P P P P P P P P PP G Sbjct: 81 PPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHG 116 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/46 (28%), Positives = 16/46 (34%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPL 690 P + P P+P P P PP P P PP P+ Sbjct: 18 PSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPV 63 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXP-XXPPPXPPPXXP 960 P P P P PP P P P P P P P P Sbjct: 102 PKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPP 138 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXX-PXPAXAXPPXPKXPXP 651 P P + P P P P P PA + P P P P Sbjct: 107 PTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKP 140 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P P P PP P P P P P P Sbjct: 102 PKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAP 135 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTP-PXPXPXXPXXXPPPXXP 961 PP P P PPP P P P P P P P P Sbjct: 104 PPAPTPKPVPPHGPPPKPAPAPTPAP-SPKPAPSPPKP 140 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXX-PXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P P P P P P P+ P PK P P PP + P Sbjct: 28 PSPCPSPPPKPQPKPPPAPSPSPCPSPPPK-PQPKPVPPPACPPTP 72 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G G G GG GG G G G Sbjct: 124 GFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAG 161 Score = 37.1 bits (82), Expect = 0.017 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 GGG G G G GG G GG GG G G GGGA Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGA--GGYGGSGGYGGGA 160 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G GGG G G GG G GG GG G GG GG Sbjct: 129 GYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGG 170 Score = 35.5 bits (78), Expect = 0.053 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G GGG GG G G GG GG Sbjct: 124 GFGGGGYGGGGGGYGGSGGYGGGA-GGYGGSGGYGGGAGGYGG 165 Score = 35.1 bits (77), Expect = 0.070 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGG-XGGXGDXGXXXGGXXXGGGA 829 G GG G G G GG G GG GG G G GG G A Sbjct: 132 GGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAA 176 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GGG G GG GG G G GG G G Sbjct: 123 GGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYG 157 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 GG G G G G GGG G G+ G GG GG Sbjct: 141 GGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGG 178 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 G GGG GG G G G GG GG G G G+ Sbjct: 165 GNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGGYGS 203 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 662 GGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXS 567 GG G G G GG G G G GAG G S Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGS 153 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEG 558 GGG G G G G G G G GAG G + G Sbjct: 134 GGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGG 169 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GG G G GG GG G GG G GG G G+ Sbjct: 161 GGYGGNSGGGYGGNAAGG-YGGSGAGGYGGDATGHGGAGGGYGS 203 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G GG G G GG G GG G G G GG G Sbjct: 142 GYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSG 183 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GG G G GG G G GG G G Sbjct: 169 GGYGGNAAGGYGGSGAGGYGGDATGHGGAGGGYGSSGG 206 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXG 866 GG G G G G GG G G G GG G Sbjct: 180 GGSGAGGYGGDATGHGGAGGGYGSSGGFGSSG 211 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GGG G GG GG G G G G G GA Sbjct: 141 GGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGA 184 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -1 Query: 959 GXXGGGXGG--GXXGXGXGGLXXGXGGGGXXXGGXG 858 G GGG GG G G G GG G G GG GG G Sbjct: 154 GGYGGGAGGYGGNSGGGYGGNAAG-GYGGSGAGGYG 188 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = -3 Query: 951 GGGXXXGXXGXGXGG-VXGG-GGXGGXGDXGXXXGGXXXGGG 832 G G G G G GG GG GG G G G G GGG Sbjct: 159 GAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGG 200 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 G GG GG G G GG G GG G G G G G+ Sbjct: 173 GNAAGGYGGSGAG-GYGGDATGHGGAGGGYGSSG-GFGS 209 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG G G G GG G GG G G G G Sbjct: 148 GGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAG 185 Score = 29.1 bits (62), Expect = 4.6 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXG-XXXGGXXXG-GGA 829 G GGG G G GG GG GG G G GG G GGA Sbjct: 154 GGYGGG--AGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGA 197 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAX-AGXGXXGXGAGXXGXSPEGRG 552 GGG G G GG A G G GAG G G G Sbjct: 157 GGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHG 195 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G GG GG G G GG GG Sbjct: 164 GGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGGYGSSGG 206 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G GG GGG GG G G GG Sbjct: 148 GGYGGSGGYGGGAGGYGG-NSGGGYGGNAAGGYGGSGAGGYGG 189 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP P PP P +P P P P P P P P Sbjct: 162 PLPPPPPPYPSPLPPPPSPSPT-PGPDSPLPSPGPDSP 198 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP P P P P P P P P P P P Sbjct: 245 PLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPP 282 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP+ PPPP P PP P P P P P P Sbjct: 161 PPLPPPPPPYPSPLPPPPSP-SPTPGPDSPLP 191 Score = 35.9 bits (79), Expect = 0.040 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 +P P P P+ P PP P P P P PPP Sbjct: 218 LPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPP 253 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P SP P PPP P P P P P P P Sbjct: 238 PTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSP 273 Score = 35.1 bits (77), Expect = 0.070 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 6/44 (13%) Frame = +1 Query: 847 PXPXPXP-PIXXPPPPXPXXNP----PXPXPXXPPPXP-PPXXP 960 P P P P P+ PP P P P P P P P P P PP P Sbjct: 165 PPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSP 208 Score = 35.1 bits (77), Expect = 0.070 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P SP P PPP P P P P P P P Sbjct: 191 PSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSP 226 Score = 35.1 bits (77), Expect = 0.070 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP P P P P P P P P P P Sbjct: 198 PLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGP 232 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP-PPXXP 960 P P P P P P P + P P P P P P PP P Sbjct: 217 PLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSP 255 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = +1 Query: 847 PXPXPXPPIXXPPP----PXPXXNPPXPXP-XXPPPXPPP 951 P P P PP P P P P P P P PPP P P Sbjct: 171 PSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSP 210 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXP-XPXXPPPXPPPXXP 960 P P P PP P P P P P P P P P P P Sbjct: 226 PLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSP 264 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 872 SPXPPXPPPPXTPPXPXPXXPXXXPPP 952 S PP PPPP P P P P P P Sbjct: 158 SSDPPLPPPPPPYPSPLPPPPSPSPTP 184 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXP-PIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P P P P P + P P P PP P P Sbjct: 251 PPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPPLPSP 286 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXP----PIXXPPP---PXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P P+ PPP P P + P P P P P P P Sbjct: 189 PLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPP 233 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXP-PIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P P P P P + P P P PP P P Sbjct: 204 PPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGP 242 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPK-XPXPXXPPPXSXGGXPL 690 P P P P P P P+ PP P P P P P PL Sbjct: 228 PLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPL 274 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXP-PXPKXPXPXXPPPXSXGGXP 687 P PS L P P+P P P P P P P P P PP S P Sbjct: 169 PYPSPLPPP-PSPSPT-PGPDSPLPSPGPDSPLPLPGPPPSPSPTP 212 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +1 Query: 553 PRPS-GLXPXXPAPXPXXPXPAXAXPPXPK-XPXPXXPPPXSXGGXPL 690 P P+ G P+P P P P PP P P P P P PL Sbjct: 180 PSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPL 227 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P+ P P P P P P P P P Sbjct: 210 PTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLP 247 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXPPIXXP-PPPXPXXNPPXPXPXXPPPXPPP 951 P P P P P P P P P P P P P P P Sbjct: 253 PSPSPTPGPDSPLPSPGPDSPLPSPGPDPPLPSPGP 288 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +2 Query: 851 PPXXXPXSPXP-PXPPPPXTPPXPXPXXPXXXPPP 952 PP P P P P PPPP P P P P P Sbjct: 161 PPLPPPPPPYPSPLPPPPS--PSPTPGPDSPLPSP 193 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/46 (32%), Positives = 17/46 (36%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPL 690 P PS P P+P P P + P P P PP G L Sbjct: 245 PLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPPLPSPGPHL 290 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +3 Query: 879 SPPXXPXPQPPPPXP-PXXPXXXPPPXP 959 S P P P PP P P P P P P P Sbjct: 159 SDPPLPPPPPPYPSPLPPPPSPSPTPGP 186 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 38.3 bits (85), Expect = 0.008 Identities = 32/138 (23%), Positives = 33/138 (23%), Gaps = 4/138 (2%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPLGXXXXXXXXXXXXXXX 738 P P P P P P P P P P PP S P Sbjct: 100 PHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPP 159 Query: 739 XXXXXXXXXXXXX*XXXXXXXXXXXXXXXXXXXXXVPXPXPXPPIXXPPPPXPXX-NPPX 915 V P P PP+ PP P P PP Sbjct: 160 PTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPT 219 Query: 916 PXPXX---PPPXPPPXXP 960 P P P P PP P Sbjct: 220 PTPPVVTPPTPTPPVVTP 237 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = +1 Query: 844 VPXPXPXPPIXXPP-PPXPXXNPPXP-XPXXPPPXPPPXXP 960 + P P PP+ PP P P PP P P PP P P P Sbjct: 205 ITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTP 245 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PP P PP P P P PP P Sbjct: 146 PPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTP 182 Score = 35.5 bits (78), Expect = 0.053 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P +P PP PPP TP P P P P Sbjct: 120 PTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKP 153 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXX-NPPXPXPXXPPPXPPP 951 + P P PP+ PP P P PP P P P P P Sbjct: 215 ITPPTPTPPVVTPPTPTPPVVTPPTPTPPTPIPETCP 251 Score = 34.7 bits (76), Expect = 0.093 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPP-PXPPP 951 P P PP P P P PP P P P P P P Sbjct: 81 PHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKP 114 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXX--PPPXPPPXXP 960 P P PP PP P P PP P P P P PP P Sbjct: 43 PVKPPKPPAVKPPKP-PAVKPPTPKPPTVKPHPKPPTVKP 81 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNP-PXPXPXX-PPP-XPPPXXP 960 P P PP PP P P P P P P PP PPP P Sbjct: 90 PHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTP 128 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNP-PXPXPXXPPPXPPPXXP 960 V P P PP P P P P P P P P PP P Sbjct: 60 VKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKP 99 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXP--PPPXPXXNPPXPXPXXPP-PXPPPXXP 960 P P P P P PP P PP P PP P PP P Sbjct: 32 PSPAPHKPPKHPVKPPKPPAVKPPKPPAVKPPTPKPPTVKP 72 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPP-XTPPXPXPXXPXXXPPPXXP 961 PP P PP P PP TPP P P P PP P Sbjct: 187 PPTPTPPVVTPPTPTPPVITPPTPTP--PVITPPTPTP 222 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP-PPXXP 960 P P PP P P P P P PP P PP P Sbjct: 72 PHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKP 108 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPP-XTPPXPXPXXPXXXPPPXXP 961 PP P PP P PP TPP P P P PP P Sbjct: 177 PPTPTPPVITPPTPTPPVVTPPTPTP--PVITPPTPTP 212 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPP-XTPPXPXPXXPXXXPPPXXP 961 PP P PP P PP TPP P P P PP P Sbjct: 197 PPTPTPPVITPPTPTPPVITPPTPTP--PVVTPPTPTP 232 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP PP PP P P PPP P Sbjct: 104 PPTKPHPHPKPPIVKPPTKPP-PSTPKPPTKPPPSTP 139 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 866 PXSPXPPXPPPPXT-PPXPXPXXPXXXPPP 952 P P P P PP T PP P P PPP Sbjct: 131 PTKPPPSTPKPPTTKPPPSTPKPPHHKPPP 160 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP PP P P P P P P P P Sbjct: 55 PKPPAVKPPTPKPPTVKPHPKPPTVKPHPKP 85 Score = 32.3 bits (70), Expect = 0.49 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSP--XPPXPPPP-XTPPXPXPXXPXXXPPPXXP 961 PP P P PP P PP TPP P P P PP P Sbjct: 165 PPTPTPTPPVVTPPTPTPPVITPPTPTP--PVVTPPTPTP 202 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P P PPP TP P P PP P Sbjct: 153 PPHHKP--PPTPCPPPTPTPTPPVVTPPTPTPPVITP 187 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSP---XPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PP P PP P P P P P P P Sbjct: 49 PPAVKPPKPPAVKPPTPKPPTVKPHPKP--PTVKPHPKPP 86 Score = 30.7 bits (66), Expect = 1.5 Identities = 27/125 (21%), Positives = 32/125 (25%) Frame = +2 Query: 311 RPPNXXP*SXYPXPLASXXXPXXRRPRXXFSXHXXTXPTPPAXAXXLXGPSSAFPPXXXX 490 +PP P S P P + P +P P P + P + PP Sbjct: 129 KPPTKPPPST-PKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITP 187 Query: 491 XXXXXXXXXXAXPALXXXXXXXXXXXXXXXXXRPTPXAXTLPXQXPPXPXPXXPXRPPPX 670 P PTP T P PP P P P P Sbjct: 188 PTPTPPVVTPPTPT-PPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTPI 246 Query: 671 PXGAP 685 P P Sbjct: 247 PETCP 251 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPP---XPXPXXPXXXPPPXXP 961 P P +P PP P P TPP P P P PP P Sbjct: 154 PHHKPPPTPCPP-PTPTPTPPVVTPPTPTPPVITPPTPTP 192 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP P PP P PP P P Sbjct: 65 PKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHP 102 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = +1 Query: 553 PRPSGLXPXXPAPX---PXXPXPAXAXPPXPKXPXPXXPPP 666 P P + P P P P P P PP P P P P Sbjct: 200 PTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTP 240 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPX--PXPXXPPPXPPPXXP 960 P PP PP P PP P P P P P P Sbjct: 58 PAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPP 95 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXP-XXPPPXPPP 951 P P P P P PP P PP P P PPP P P Sbjct: 50 PAPSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSP 85 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/39 (46%), Positives = 20/39 (51%), Gaps = 4/39 (10%) Frame = +1 Query: 844 VPXPXPXP-PIXXPPPPXPXX---NPPXPXPXXPPPXPP 948 +P P P P P PPPP +PP P P PPP PP Sbjct: 78 LPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPPP 116 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PPPP P PP P PPP Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPP 93 Score = 35.9 bits (79), Expect = 0.040 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +1 Query: 853 PXPXPPIXXPPP---PXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PPP P P PP P P PPP P Sbjct: 70 PPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRP 108 Score = 35.5 bits (78), Expect = 0.053 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P +P PP PP PP P P PPP Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPP 94 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 885 PXXPXPQPPPPXPPXXPXXXPPPXP 959 P P PQ PPP PP P PPP P Sbjct: 61 PLPPPPQTPPPPPP--PQSLPPPSP 83 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 5/51 (9%) Frame = +1 Query: 553 PRPSGLXPXXPAPXP-XXPXPA----XAXPPXPKXPXPXXPPPXSXGGXPL 690 P P L P P+P P P P P P P P PPP PL Sbjct: 73 PPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPPPLHFSSPL 123 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P L P P PPPP P P P P P Sbjct: 54 PEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEP 87 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 2/40 (5%) Frame = +1 Query: 553 PRPSGLXPXXPAPX--PXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P P P P PP P PPP Sbjct: 54 PEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPP 93 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNP-PXPXPXXPPPXP 945 +P P P PPPP P P P P PP P Sbjct: 60 LPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPP 94 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 SP P P+ P PP P PPP PP Sbjct: 49 SPAPSPEPEDYLPLPP--PPQTPPPPPP 74 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P P PP PP P P PP Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPP 92 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G G G GGGG G G G GG GGG Sbjct: 71 GLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGGHHGGG 113 Score = 35.9 bits (79), Expect = 0.040 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G G G GGGG G G GG GGG Sbjct: 57 GGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGG 99 Score = 35.9 bits (79), Expect = 0.040 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGG--XGGXGDXGXXXGGXXXGGG 832 GGG G G G GGGG GG G G GG GGG Sbjct: 67 GGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGG 108 Score = 35.5 bits (78), Expect = 0.053 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G G GG GGGG G G G GG GGG Sbjct: 46 GHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGG--GGHYGGGG 86 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 G GGG G G GGGG G G GG G G Sbjct: 83 GGGGGHYGGGGGHYGGGGGGYGGGGGHHGGGGHG 116 Score = 35.1 bits (77), Expect = 0.070 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG G G GG G GG GGG Sbjct: 51 GGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGG 93 Score = 35.1 bits (77), Expect = 0.070 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G G GG GGG G G G GG G G Sbjct: 62 GGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYG 104 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG GGG GG G GG GGG Sbjct: 74 GYGGGGGHYGGGGGHYGG--GGGHYGGGGGGYGGGGGHHGGGG 114 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = -1 Query: 950 GGGXGG--GXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG GG G G G G GGGG G G G G Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGG 80 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = -1 Query: 959 GXXGGGX---GGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G GG G GGGG GG G G Sbjct: 74 GYGGGGGHYGGGGGHYGGGGG-HYGGGGGGYGGGGGHHGGG 113 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G GG G G G G G G G G Sbjct: 67 GGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYG 104 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP P PP P PPP PPP P Sbjct: 9 PYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPPP 44 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPX--PXXNPPXPXPXXPPPXPP 948 P P P PPPP P P P P PPP PP Sbjct: 9 PYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPPP 44 Score = 33.1 bits (72), Expect = 0.28 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXP 919 PP P PP PPPP PP P Sbjct: 22 PPVGVPPQYYPPPPPPPPPPPPP 44 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 GGG GGG G G G G G GG GG G G Sbjct: 128 GGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G GGG G G GG G GGGG G G G G Sbjct: 118 GSGGGGGHGGGGGGG--GGRGGGGGSGNGEGYGEG 150 Score = 37.1 bits (82), Expect = 0.017 Identities = 21/43 (48%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXG---GXGDXGXXXGGXXXGGG 832 GGG G G G GG GGGG G G G+ G GG GGG Sbjct: 120 GGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGG--YGGG 160 Score = 35.9 bits (79), Expect = 0.040 Identities = 20/42 (47%), Positives = 21/42 (50%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G GGG G G G GG GGGG G G+ G GG GG Sbjct: 118 GSGGGGGHGG--GGGGGGGRGGGGGSGNGE-GYGEGGGYGGG 156 Score = 34.7 bits (76), Expect = 0.093 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G G G G G G G GG GG G G GG GGG+ Sbjct: 100 GSHAGSGSGGRSGSGRG--RGSGGGGGHGGGGGGGGGRGGGGGS 141 Score = 34.7 bits (76), Expect = 0.093 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXG-GXXXGGG 832 G G G G G G G GGGG G G G G G GGG Sbjct: 109 GRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGG 152 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G G G G G G G G GGG GG G G G Sbjct: 109 GRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEG 146 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG G G G G GG G G G G G G G Sbjct: 120 GGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYG 154 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G G G G G GGGG GG G G G Sbjct: 100 GSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGG 134 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G GG G G G G G GG GGG Sbjct: 92 GSEAGSYAGSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGG 134 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G G GGG GG G G GG G G Sbjct: 106 GSGGRSGS-GRGRGSGGGGGHGGGGGGGGGRGGGGGSGNG 144 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 G GGG G GG GG G G G G G G Sbjct: 124 GHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYG 158 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG G G G G GG G G G G Sbjct: 86 GGGGDAGSEAGSYAGSHAGSGSGGRSGSGRGRGSG 120 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGG 880 G GGG G G GG GGG GG Sbjct: 134 GRGGGGGSGNGEGYGEGGGYGGGYGGG 160 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PPP PP P P PP PP P Sbjct: 365 PVPPPRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P SPP P PPPP PP P P P Sbjct: 365 PVPPPRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = +2 Query: 872 SPXPPX---PPPPXTPPXPXPXXPXXXPPP 952 SP PP PPP TPP P P P PPP Sbjct: 364 SPVPPPRRSPPPLQTPPPPPPPPPLAPPPP 393 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAP 685 P P P Q PP P P P PPP P P Sbjct: 367 PPPRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 Score = 31.9 bits (69), Expect = 0.65 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 583 PAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P PP P P P PPP Sbjct: 365 PVPPPRRSPPPLQTPPPPPPPPPLAPPP 392 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +1 Query: 847 PXPXPX---PPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P PP+ PPPP P PP P PP P Sbjct: 365 PVPPPRRSPPPLQTPPPPPP---PPPLAPPPPPQKRP 398 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +3 Query: 879 SPPXXPXPQPPP---PXPPXXPXXXPPPXPP 962 SP P PPP P PP P PP PP Sbjct: 364 SPVPPPRRSPPPLQTPPPPPPPPPLAPPPPP 394 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXP 946 PP P PPPP PP P P P Sbjct: 367 PPPRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP----PPXXP 960 P P P + PPPP +PP P PPP P PP P Sbjct: 34 PEPAPLVDLSPPPPPVNISSPPPPVNLSPPPPPVNLSPPPPP 75 Score = 37.5 bits (83), Expect = 0.013 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P P + PPPP +PP P PPP P Sbjct: 143 PPPPPVLLSPPPPPVLFSPPPPTVTRPPPPP 173 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P + PPPP +PP P PP PP Sbjct: 89 PPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPP 120 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P + PPPP +PP P PP PP Sbjct: 116 PPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPP 147 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P + PPPP +PP P PP PP Sbjct: 125 PPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPP 156 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP+ PPP P P P P P PPP Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 84 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP+ PPP P P P P P PPP Sbjct: 63 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 93 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP+ PPP P P P P P PPP Sbjct: 72 PPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 102 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP+ PPP P P P P P PPP Sbjct: 81 PPPPVNLSPPPPPVLLSPPPPPVNLSPPPPP 111 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP+ PPP P P P P P PPP Sbjct: 90 PPPPVLLSPPPPPVNLSPPPPPVNLSPPPPP 120 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP+ PPP P P P P P PPP Sbjct: 99 PPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 129 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP+ PPP P P P P P PPP Sbjct: 108 PPPPVNLSPPPPPVLLSPPPPPVLLSPPPPP 138 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP+ PPP P P P P P PPP Sbjct: 117 PPPPVLLSPPPPPVLLSPPPPPVNLSPPPPP 147 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP+ PPP P P P P P PPP Sbjct: 126 PPPPVLLSPPPPPVNLSPPPPPVLLSPPPPP 156 Score = 35.1 bits (77), Expect = 0.070 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P PPPP +PP P PP PP Sbjct: 62 PPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 93 Score = 35.1 bits (77), Expect = 0.070 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P PPPP +PP P PP PP Sbjct: 71 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 102 Score = 35.1 bits (77), Expect = 0.070 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P PPPP +PP P PP PP Sbjct: 80 PPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPP 111 Score = 35.1 bits (77), Expect = 0.070 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P PPPP +PP P PP PP Sbjct: 98 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 129 Score = 35.1 bits (77), Expect = 0.070 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P PPPP +PP P PP PP Sbjct: 107 PPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPP 138 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P + PPPP PP P PP P P Sbjct: 152 PPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRP 184 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP----PPXXP 960 P P I PPPP PP P PPP P PP P Sbjct: 45 PPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 84 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = +3 Query: 858 PXXPXXLSPPXXPXP-QPPPPX----PPXXPXXXPPPXPP 962 P P LSPP P PPPP PP P PP PP Sbjct: 90 PPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 129 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P PP+ PPP P P P P P PP Sbjct: 135 PPPPVNLSPPPPPVLLSPPPPPVLFSPPPP 164 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPPP +PP P PP P P Sbjct: 134 PPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRP 169 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +2 Query: 851 PPXXXPXSPXPPX----PPPPXTPPXPXPXXPXXXPPPXXP 961 PP SP PP PPPP P P PPP P Sbjct: 144 PPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRP 184 Score = 29.1 bits (62), Expect = 4.6 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 11/47 (23%) Frame = +1 Query: 844 VPXPXPXPPIXX-PPPPXPXX-----NPPXPXPXX-----PPPXPPP 951 V P P P I PPPP P P P P PPP PPP Sbjct: 166 VTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPPP 212 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 37.5 bits (83), Expect = 0.013 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 14/53 (26%) Frame = +1 Query: 844 VPXPXPXPPI------XXPPPPXPXXN---PPXPXP-----XXPPPXPPPXXP 960 VP P P PP+ PPPP P PP P P PPP PPP P Sbjct: 13 VPLPPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLP 65 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Frame = +1 Query: 853 PXPXPPIXX----PPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP+ PPPP P P P PPP P P Sbjct: 31 PPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRP 67 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P P PP+ P P PP P P PP Sbjct: 44 PPPPPPLMRRRAPPPPPPPPLPRPCSRPP 72 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 6/39 (15%) Frame = +2 Query: 851 PPXXXPXSPXPPXPP------PPXTPPXPXPXXPXXXPP 949 PP +P PP PP PP PP P P P PP Sbjct: 35 PPLMRRRAPPPPPPPLMRRRAPPPPPPPPLP-RPCSRPP 72 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G GGG G G GG G G GG G G G G Sbjct: 69 GSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGG 103 Score = 34.7 bits (76), Expect = 0.093 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G GG GGG GG GD G GG GGG Sbjct: 69 GSGGGGGGRGYGGGGRREGGGYGG-GDGGSYGGG---GGG 104 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G GGG G G G GG G GG GG G Sbjct: 71 GGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 104 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXG 866 GG GGG G G GGG G G G G Sbjct: 71 GGGGGGRGYGGGGRREGGGYGGGDGGSYGGGG 102 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G GGG G G GG G GGGG GG G G Sbjct: 88 GSGGGGGHRGGGGGGYRSG-GGGGYSGGGGSYGGG 121 Score = 36.7 bits (81), Expect = 0.023 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXG 866 GG GGG G GG GGG G GG R G Sbjct: 97 GGGGGGYRSGGGGGYSGGGGSYGGGGGRREGG 128 Score = 36.3 bits (80), Expect = 0.030 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G GG GGGG G G GG GGG Sbjct: 93 GGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGG 135 Score = 35.9 bits (79), Expect = 0.040 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GGG GG G G G GGG Sbjct: 88 GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGG 130 Score = 35.5 bits (78), Expect = 0.053 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GGG GG G GG GGG Sbjct: 94 GHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGG 136 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GG G G GG GG Sbjct: 130 GYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGG 172 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG GG G G G GGG GG G G G Sbjct: 128 GGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGG 162 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G GGG G GG GGGG GG G G Sbjct: 120 GGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGG 157 Score = 31.9 bits (69), Expect = 0.65 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = -3 Query: 960 GXXGGGXXXGXXGX---GXGGVXGGGGX--GGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GGGG G G GG GGG Sbjct: 110 GYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGG 157 Score = 31.9 bits (69), Expect = 0.65 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGG----GGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GG GG G GG GGG Sbjct: 116 GSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGG 162 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 GGG GG G GG G GGG GG G Sbjct: 144 GGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 174 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = -3 Query: 951 GGGXXXGXXG----XGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G G GG GGG G G G GG G G Sbjct: 128 GGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSG 171 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 GGG GG G GG GGGG G G G Sbjct: 114 GGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 146 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 GGG GG G GG GGGG GG G Sbjct: 108 GGGYSGGGGSYGGGG-GRREGGGGYSGGGGG 137 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GG GGG GG G GGG GG G G Sbjct: 115 GGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYG 149 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGG-GXXXGGXGXGXG 846 G G GGG G G G GGG G GG G G G Sbjct: 137 GYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 175 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -3 Query: 951 GGGXXX-GXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G GG GG G G G GG GGG Sbjct: 135 GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 175 Score = 28.3 bits (60), Expect = 8.0 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 6/44 (13%) Frame = -1 Query: 959 GXXGGGXG----GGXXGXGXGGLXXGXGG--GGXXXGGXGXGXG 846 G GGG G GG G GG G GG GG G G G G Sbjct: 130 GYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 173 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXPP-PPXTPPXPXPXXPXXXPPPXXP 961 PP +P PP P PP PP P P PPP P Sbjct: 14 PPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPP 51 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP+ PP PP P P PPP PPP Sbjct: 7 PYPPLPQPPSQNSLA-PPPPPPSLPPPVPPP 36 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P + P PP P + P P PPP PPP Sbjct: 23 PPPPPSLPPPVPPPPPSHQPYSYP--PPPPPPP 53 Score = 35.9 bits (79), Expect = 0.040 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 10/43 (23%) Frame = +1 Query: 853 PXPXPPIXX---PPPPXPXXNPPXPXPXX-------PPPXPPP 951 P P PP PPPP P PP P P PPP PPP Sbjct: 10 PLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPP 52 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 7/33 (21%) Frame = +3 Query: 882 PPXXPXPQPP-------PPXPPXXPXXXPPPXP 959 PP P PQPP PP PP P PPP P Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPP 38 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXS 672 P P P P PP P P P PPP S Sbjct: 7 PYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPS 39 Score = 31.9 bits (69), Expect = 0.65 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPP-------PXPPPXXP 960 P P P PPP P PP P P PP P PPP P Sbjct: 10 PLPQPPSQNSLAPPPPPPSLPP-PVPPPPPSHQPYSYPPPPPPPP 53 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPP 953 P P PP PPPP P P PPP Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPP 37 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXP----XXXPPPXXP 961 PP P S PP PPPP P P PPP P Sbjct: 37 PPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPPPPP 77 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 900 PQPPPPXPPXXPXXXPPPXPP 962 P PP P PP PPP PP Sbjct: 7 PYPPLPQPPSQNSLAPPPPPP 27 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 881 PPXPPPPXTPPXPXPXXPXXXPP 949 PP PPPP PP P P P Sbjct: 72 PPPPPPPSAPPPLVPDPPRHQGP 94 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 883 PPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP P PP PPP PP P Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPP 31 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPP--IXXPPPPXPXXNPPXPXPXXPPP-XPPPXXP 960 P P P PP P P N P PPP PPP P Sbjct: 46 PPPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPPSAPPPLVP 86 Score = 28.3 bits (60), Expect(2) = 0.85 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAP 685 P P +LP PP P P PP P P Sbjct: 22 PPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPP 53 Score = 21.8 bits (44), Expect(2) = 0.85 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 659 PPPXPXGAPP 688 PPP P APP Sbjct: 73 PPPPPPSAPP 82 >At5g66400.1 68418.m08374 dehydrin (RAB18) nearly identical to SP|P30185 Dehydrin Rab18 {Arabidopsis thaliana} Length = 186 Score = 37.1 bits (82), Expect = 0.017 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -1 Query: 959 GXXGGGXGG---GXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 G G G GG G G G GG G GG G GG G G GT Sbjct: 34 GGYGTGGGGGATGGQGYGTGGQGYGSGGQGYGTGGQGYGTGT 75 Score = 32.3 bits (70), Expect = 0.49 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 6/50 (12%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXG------GXXXGGGA 829 G GGG G G G GG G G G G G G G GGGA Sbjct: 37 GTGGGGGATGGQGYGTGGQGYGSGGQGYGTGGQGYGTGTGTEGFGTGGGA 86 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 918 GXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG GGG G G G GG G G Sbjct: 32 GGGGYGTGGGGGATGGQGYGTGGQGYGSG 60 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 37.1 bits (82), Expect = 0.017 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +1 Query: 844 VPXPXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXPPP 951 +P P P P P PPP P PP P PPP P P Sbjct: 157 LPPPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPPSP 194 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +2 Query: 596 PXAXTLPXQXPPXPXPXXPXRPPPXPXGAP 685 P + ++P PP P P PPP P P Sbjct: 166 PFSPSIPPPSPPYFPPEPPSIPPPPPPSPP 195 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 37.1 bits (82), Expect = 0.017 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = -1 Query: 959 GXXGGGXGGGXXG--XGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GG G G GG G GGGG GG G G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G GGG G GG G GGG GG G G Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGG 120 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G GG GGG G G G G GGG Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGG 881 GG GGG G GG GGG G GG Sbjct: 95 GGSGGGYRSGGGGGYSGGGGGGYSGGG 121 Score = 31.9 bits (69), Expect = 0.65 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G GGG G G G GGG GG G G GG GG Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGG--GGYSGGGGGGG 125 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GGG G GGG G GG G G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGG 122 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 G G G G G GG +G G G G G S G G Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGG 123 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G G + G G G G G G G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +1 Query: 844 VPXPXPXPP-IXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 +P P P PP + P PP P P PPP PP P Sbjct: 7 IPPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPPPRLGP 46 Score = 34.3 bits (75), Expect = 0.12 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXP 947 +PP P P PPPP PP P P Sbjct: 24 APPPQPPPPPPPPPPPPPPRLGP 46 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P PP PPPP PP P PP Sbjct: 27 PQPPPPPPPPPPPPPPRLGPRLRLRLLPP 55 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P P P PP PPPP P P PPP Sbjct: 27 PQPPPPPP-PPPPPPPPRLGPRLRLRLLPPP 56 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 PP P P PPPP P P PP Sbjct: 29 PPPPPPPPPPPPPPRLGPRLRLRLLPP 55 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXP 673 P P L Q P P P P PPP P Sbjct: 12 PLPPRLELRRQRAPPPQPPPPPPPPPPP 39 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 GGG GGG G GG G GGGG GG G G Sbjct: 59 GGGDGGGDGGGDGGG--GGCGGGGGCGGGGGGG 89 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXG 899 GG GGG G GG GGGG G Sbjct: 68 GGDGGGGGCGGGGGCGGGGGG 88 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 952 GGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GGG G GG GGGG G G GG G G Sbjct: 59 GGGDGGGDGGGDGGGG-GCGGGGGCGGGGGGG 89 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 912 GGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG GGG GG G G GG GGG Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGG 85 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 924 GXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G GG GGG GG G G G GGG Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGGGGG 89 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 687 GGAPXGXGGGRXGXXGLGXGGXCXG 613 GG G GGG G G G GG C G Sbjct: 60 GGDGGGDGGGDGGGGGCGGGGGCGG 84 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXG 883 G GGG G G GG GGGG G Sbjct: 64 GGDGGGDGGGGGCGGGGGCGGGGGGG 89 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 37.1 bits (82), Expect = 0.017 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDX-GXXXGGXXXGGGA 829 GGG G G G GG GG GG G G GG GGGA Sbjct: 58 GGGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGA 99 Score = 35.5 bits (78), Expect = 0.053 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G G GGG G GG G GGG GG G G G Sbjct: 64 GGGGFGAGGGWIGGSVGGFGGGI-GGGFGGGGFGGGAG 100 Score = 34.7 bits (76), Expect = 0.093 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGG 881 GG GGG G GG GGG G G GG Sbjct: 80 GGFGGGIGGGFGGGGFGGGAGKGVDGG 106 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGG-GXXXGGXGXGXG 846 G GG G G G GG G GGG G GG G G G Sbjct: 60 GGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGG 98 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/36 (50%), Positives = 19/36 (52%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GG GG G G GG+ G GGGG GG G G Sbjct: 69 GAGGGWIGGSVGGFG-GGIGGGFGGGG-FGGGAGKG 102 Score = 31.5 bits (68), Expect = 0.86 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -1 Query: 959 GXXGGGXG--GGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GG G GG G G GG G G G GG G G Sbjct: 73 GWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKG 110 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G G GV GG G G G GG GGG Sbjct: 161 GGVGKGFDGGAGKGVDGGAIGGIGGGAGKEIGGGIGGGG 199 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG G GG G G G GG G G G Sbjct: 54 GDLGGGGGISGGGGFGAGGGWIGGSVGGFGGGIG 87 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G GG+ GGG GG G G G G G Sbjct: 71 GGGWIGGSVGGFGGGI--GGGFGGGGFGGGAGKGVDGGFG 108 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG GG G GG G G G Sbjct: 89 GFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDGGAGKG 126 Score = 29.9 bits (64), Expect = 2.6 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXG-XXXGGXXXG--GGA 829 G GGG G G GV GG G G G G GG G GGA Sbjct: 93 GGFGGGAGKGVDGGFGKGVDGGAGKGVDGGAGKGFDGGVGKGVDGGA 139 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G G G GG G G GG Sbjct: 88 GGFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDGGAGKGFDGG 130 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXG-GGGXGGXGDXGXXXGGXXXG 838 G GGG G G V G GGG GG G GG G Sbjct: 61 GISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKG 102 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -1 Query: 944 GXGGGXXGXGXGGLXXGXGGG--GXXXGGXGXGXG 846 G GGG G G G G GG G GG G G G Sbjct: 57 GGGGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFG 91 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 GG G G GG GGG GG G G GGA Sbjct: 76 GGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGA 115 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGG--XGGXGDXGXXXGGXXXGGG 832 G GGG G GG GGG G G G GG GGG Sbjct: 54 GDLGGGGGIS----GGGGFGAGGGWIGGSVGGFGGGIGGGFGGGG 94 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = -2 Query: 961 GGXGGGXXXGXXGG-XGG--GGXGXGXXGGXRXXGXXG 857 GG GG G GG GG GG G G GG G G Sbjct: 60 GGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGG 97 >At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear antigen EBNA-1 (GI:3342234) {Cercopithecine herpesvirus 15} Length = 118 Score = 36.7 bits (81), Expect = 0.023 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 GGG G G G V GG G GG G G GG GG A Sbjct: 5 GGGSGSSGSGSG-GSVSGGSGSGGSGSGGSGSGGSGSGGRA 44 Score = 35.5 bits (78), Expect = 0.053 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G G GG G G GG G GGG G G G G Sbjct: 34 GSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRGIG 71 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = -1 Query: 959 GXXGGGXGG-GXXGXGXGGLXXGXGGGGXXXG-GXGXGXG 846 G G G GG G G G GG G G GG G G G G G Sbjct: 24 GSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDG 63 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GG G G G G GG G GG G G G G G+ Sbjct: 12 GSGSGGSVSGGSGSGGSG-SGGSGSGGSGSGGRANGRGNGGRGS 54 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG G G G G G G GG G G G G Sbjct: 32 GSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRG 69 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -1 Query: 662 GGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GG G G GG G G G G+G G G G Sbjct: 5 GGGSGSSGSGSGGSVSGGSGSGGSGSGGSGSGGSGSG 41 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G G GGG G GD G GG G G Sbjct: 37 GSGSGGRANGRGNGGRGSGRGGGRGDGRGD-GRGIGGGGRGRG 78 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G G G G G G G G GGG Sbjct: 17 GSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGG 59 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -3 Query: 684 GAPXGXGGGRXGXXGLGXGGXCXGRVXAXGVGR 586 G G G GR G+G GG GR+ A +GR Sbjct: 55 GRGGGRGDGRGDGRGIGGGGRGRGRIPAAFMGR 87 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G G G GG G G G G GG GG G G Sbjct: 9 GSSGSGSGGSVSGGSGSG---GSGSGGSGSGGSGSG 41 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXA----GXGXXGXGAGXXGXSPEGRG 552 G G G G G GG G G G G+G G +GRG Sbjct: 24 GSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRG 65 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G G G G GG G G GGG Sbjct: 32 GSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRGIGGGG 74 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 36.7 bits (81), Expect = 0.023 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PP PP P PP P PP PP P Sbjct: 110 PTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSP 150 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 V P PPI PP P PP P P PP P Sbjct: 88 VKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPPTYKP 126 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P SPP P PP P P PP PP Sbjct: 142 PTTPPVQSPPVQPPTYKPPTSPVKPPTTTPPVKPP 176 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP+ PP P PP P PP PP P Sbjct: 141 PPTTPPVQSPPVQPPTYKPPTS-PVKPPTTTPPVKP 175 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PP P NPP P PP PP P Sbjct: 171 PPVKPPTTTPPVQPPTYNPPTT-PVKPPTAPPVKPP 205 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/39 (33%), Positives = 15/39 (38%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 +P PP+ PP P PP P P PP P Sbjct: 83 IPVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQP 121 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 844 VPXPXPXPPIXXPP--PPXPXXNPPXPXPXXPPPXPP 948 V P PP+ P PP PP P PP PP Sbjct: 173 VKPPTTTPPVQPPTYNPPTTPVKPPTAPPVKPPTPPP 209 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXPP---PPXTPPXPXPXXPXXXPPPXXP 961 PP P + P PP PP TP P P P PP P Sbjct: 171 PPVKPPTTTPPVQPPTYNPPTTPVKP-PTAPPVKPPTPPP 209 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXP-XPXXPXXXPPP 952 PP P P P PP TPP P P PP Sbjct: 76 PPVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPP 110 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P P QPP PP P P PP Sbjct: 138 PVKPPTTPPVQSPPVQPPTYKPPTSPVKPPTTTPP 172 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PP P PP P PP P P Sbjct: 160 PTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTPVKPP 197 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 V P PP+ PP P PP P P PP P Sbjct: 164 VKPPTTTPPVK-PPTTTPPVQPPTYNPPTTPVKPPTAPP 201 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP P P P PP PP P Sbjct: 122 PTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKP 159 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP P PP P P PP P Sbjct: 134 PTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPPTTTP 171 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP P P P P P PP PP P Sbjct: 127 PTPTVKPPTTSPVKP-PTTPPVQSPPVQPPTYKPPTSP 163 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P PP P P P P PP PP Sbjct: 151 PVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPP 185 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 596 PXAXTLPXQXPPXPXPXXPXRPPPXPXGAPP 688 P T P Q P P P +PP P PP Sbjct: 175 PPTTTPPVQPPTYNPPTTPVKPPTAPPVKPP 205 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 36.7 bits (81), Expect = 0.023 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 5/39 (12%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPP-----PXPPPXXP 960 P PP PPPP P P P PP P PPP P Sbjct: 22 PLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPP 60 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +1 Query: 847 PXPXPXPPI----XXPPPPXPXXNPPXPXPXXPPP 939 P P P PP+ PPPP P P P PPP Sbjct: 26 PPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPP 60 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = +3 Query: 876 LSPPXX---PXPQPPPPXPPXXPXXXPPPXPP 962 +SPP P P PPPP PP P P PP Sbjct: 13 VSPPMRGRVPLPPPPPPPPPPMRRRAPLPPPP 44 Score = 32.7 bits (71), Expect = 0.37 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 894 PXPQPPPPXPPXXPXXXPPPXPP 962 P P PPPP P PPP PP Sbjct: 24 PPPPPPPPPPMRRRAPLPPPPPP 46 Score = 32.3 bits (70), Expect = 0.49 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 871 IXXPPPPXPXXNPPXPXPXXPPPXPPP 951 + PPPP P P PPP PPP Sbjct: 21 VPLPPPPPPPPPPMRRRAPLPPPPPPP 47 Score = 31.9 bits (69), Expect = 0.65 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 884 PXPPPPXTPPXPXPXXPXXXPPPXXP 961 P PPPP PP P PPP P Sbjct: 22 PLPPPPPPPPPPMRRRAPLPPPPPPP 47 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P P PPPP PP PP PP Sbjct: 25 PPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPP 59 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 8/45 (17%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXT--PPXPXPXXPXXX------PPPXXP 961 PP +P PP PPPP P P P P PPP P Sbjct: 31 PPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPP 75 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 5/39 (12%) Frame = +1 Query: 847 PXPXPXPP-----IXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P PP PPPP P P PPP PP Sbjct: 39 PLPPPPPPPMRRRAPLPPPPPPAMR-RRVLPRPPPPPPP 76 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 7/36 (19%) Frame = +3 Query: 876 LSPPXXPXPQP-------PPPXPPXXPXXXPPPXPP 962 L PP P P P PPP PP P P PP Sbjct: 23 LPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPP 58 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P P PPPP P P P PP Sbjct: 39 PLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPP 73 >At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein identical to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 168 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P P P P +P P P P P P P P Sbjct: 38 PVPSPKPKPVPSPKPKPVPSPSVPSPSVPSPNPRPVTP 75 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 36.7 bits (81), Expect = 0.023 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 6/44 (13%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPPXPXPXXPPPXP---PPXXP 960 P P PPI PP PP P +PP P PP P PP P Sbjct: 159 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKP 202 Score = 36.7 bits (81), Expect = 0.023 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 6/44 (13%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPPXPXPXXPPPXP---PPXXP 960 P P PPI PP PP P +PP P PP P PP P Sbjct: 311 PTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKP 354 Score = 36.7 bits (81), Expect = 0.023 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 6/44 (13%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPPXPXPXXPPPXP---PPXXP 960 P P PPI PP PP P +PP P PP P PP P Sbjct: 395 PTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKP 438 Score = 36.3 bits (80), Expect = 0.030 Identities = 20/44 (45%), Positives = 21/44 (47%), Gaps = 6/44 (13%) Frame = +1 Query: 847 PXPXPXPPIXXPP--PPXPXXNPP-XPXPXXPPPXP---PPXXP 960 P P PPI PP PP P +PP P P PP P PP P Sbjct: 412 PTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKP 455 Score = 36.3 bits (80), Expect = 0.030 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 6/44 (13%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPPXPXPXXPPPXP---PPXXP 960 P P PP+ PP PP P +PP P PP P PP P Sbjct: 445 PTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQP 488 Score = 36.3 bits (80), Expect = 0.030 Identities = 20/44 (45%), Positives = 21/44 (47%), Gaps = 6/44 (13%) Frame = +1 Query: 847 PXPXPXPPIXXPP--PPXPXXNPPX-PXPXXPPPXP---PPXXP 960 P P PPI PP PP P +PP P P PP P PP P Sbjct: 462 PTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKP 505 Score = 36.3 bits (80), Expect = 0.030 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 6/44 (13%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPPXPXPXXPPPXP---PPXXP 960 P P PP+ PP PP P +PP P PP P PP P Sbjct: 495 PTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKP 538 Score = 36.3 bits (80), Expect = 0.030 Identities = 20/44 (45%), Positives = 21/44 (47%), Gaps = 6/44 (13%) Frame = +1 Query: 847 PXPXPXPPIXXPP--PPXPXXNPPX-PXPXXPPPXP---PPXXP 960 P P PPI PP PP P +PP P P PP P PP P Sbjct: 512 PTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 555 Score = 35.5 bits (78), Expect = 0.053 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPP-XPXPXXPPPXP---PPXXP 960 P P PPI PP PP P +PP P P PP P PP P Sbjct: 192 PTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKP 236 Score = 35.5 bits (78), Expect = 0.053 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPP-XPXPXXPPPXP---PPXXP 960 P P PPI PP PP P +PP P P PP P PP P Sbjct: 209 PTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKP 253 Score = 35.5 bits (78), Expect = 0.053 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPP-XPXPXXPPPXP---PPXXP 960 P P PPI PP PP P +PP P P PP P PP P Sbjct: 243 PTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKP 287 Score = 35.5 bits (78), Expect = 0.053 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPP-XPXPXXPPPXP---PPXXP 960 P P PPI PP PP P +PP P P PP P PP P Sbjct: 528 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKP 572 Score = 35.5 bits (78), Expect = 0.053 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPP-XPXPXXPPPXP---PPXXP 960 P P PPI PP PP P +PP P P PP P PP P Sbjct: 545 PTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 589 Score = 35.5 bits (78), Expect = 0.053 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPP-XPXPXXPPPXP---PPXXP 960 P P PPI PP PP P +PP P P PP P PP P Sbjct: 562 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 606 Score = 35.5 bits (78), Expect = 0.053 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPP-XPXPXXPPPXP---PPXXP 960 P P PPI PP PP P +PP P P PP P PP P Sbjct: 579 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 623 Score = 35.5 bits (78), Expect = 0.053 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPP-XPXPXXPPPXP---PPXXP 960 P P PPI PP PP P +PP P P PP P PP P Sbjct: 596 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 640 Score = 35.5 bits (78), Expect = 0.053 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPP-XPXPXXPPPXP---PPXXP 960 P P PPI PP PP P +PP P P PP P PP P Sbjct: 613 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 657 Score = 35.5 bits (78), Expect = 0.053 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPP-XPXPXXPPPXP---PPXXP 960 P P PPI PP PP P +PP P P PP P PP P Sbjct: 630 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKP 674 Score = 35.1 bits (77), Expect = 0.070 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPP-XPXPXXPPPXP---PPXXP 960 P P PP+ PP PP P +PP P P PP P PP P Sbjct: 142 PTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 186 Score = 35.1 bits (77), Expect = 0.070 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPP-XPXPXXPPPXP---PPXXP 960 P P PP+ PP PP P +PP P P PP P PP P Sbjct: 226 PTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKP 270 Score = 35.1 bits (77), Expect = 0.070 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPP-XPXPXXPPPXP---PPXXP 960 P P PP+ PP PP P +PP P P PP P PP P Sbjct: 294 PTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKP 338 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPX--PPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P +P PP PPP PP P P PP P Sbjct: 322 PPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKP 360 Score = 35.1 bits (77), Expect = 0.070 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPP-XPXPXXPPPXP---PPXXP 960 P P PP+ PP PP P +PP P P PP P PP P Sbjct: 344 PTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKP 388 Score = 35.1 bits (77), Expect = 0.070 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPP-XPXPXXPPPXP---PPXXP 960 P P PP+ PP PP P +PP P P PP P PP P Sbjct: 361 PTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKP 405 Score = 35.1 bits (77), Expect = 0.070 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPP-XPXPXXPPPXP---PPXXP 960 P P PP+ PP PP P +PP P P PP P PP P Sbjct: 428 PTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKP 472 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPX--PPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P +P PP PPP PP P P PP P Sbjct: 456 PPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKP 494 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPX--PPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P +P PP PPP PP P P PP P Sbjct: 506 PPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKP 544 Score = 34.7 bits (76), Expect = 0.093 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPPX-PXPXXPPPXP---PPXXP 960 P P PP+ PP PP P +PP P P PP P PP P Sbjct: 664 PTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKP 708 Score = 34.7 bits (76), Expect = 0.093 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPPX-PXPXXPPPXP---PPXXP 960 P P PP+ PP PP P +PP P P PP P PP P Sbjct: 681 PTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKP 725 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPPX-PXPXXPPPXPPPXXP 960 P P PP+ PP PP P +PP P P PP P P Sbjct: 698 PTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSP 739 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPP-XPXPXXPPPXPPPXXP 960 P P PP+ PP PP P +PP P P PP P P Sbjct: 260 PTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPP 301 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPP-XPXPXXPPPXPPPXXP 960 P P PP+ PP PP P +PP P P PP P P Sbjct: 378 PTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPP 419 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPX--PPXPPPPX-TPPXPXPXXPXXXPPPXXP 961 PP P +P PP PPP TPP P P PP P Sbjct: 254 PPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKP 293 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 SPP P P PP P P PPP P Sbjct: 316 SPPIKPPPVQKPPTPTYSPPIKPPPVKP 343 Score = 33.1 bits (72), Expect = 0.28 Identities = 40/211 (18%), Positives = 48/211 (22%), Gaps = 5/211 (2%) Frame = +2 Query: 344 PXPLASXXXPXXRRPRXXFSXHXXTXPT--PPAXAXXLXGPSSAFPPXXXXXXXXXXXXX 517 P P+ P P H PT PP + P+ + P Sbjct: 438 PPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTP 497 Query: 518 XAXPALXXXXXXXXXXXXXXXXXRPTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAPPXGX 697 P + +P P P PP P P PP P +PP Sbjct: 498 TYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPP--PVHKPPTPTYSPPIKP 555 Query: 698 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPXXXPXSP 877 PP P +P Sbjct: 556 PPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 615 Query: 878 X--PPXPPPPX-TPPXPXPXXPXXXPPPXXP 961 PP PPP PP P P PP P Sbjct: 616 TYSPPIKPPPVHKPPTPTYSPPIKPPPVHKP 646 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPP-PPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PI PP P P PP P PP PPP P Sbjct: 440 PVHKPPTPIYSPPVKPPPVHKPPTPT-YSPPIKPPPVKP 477 Score = 32.7 bits (71), Expect = 0.37 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 847 PXPXPXPPIXXPPP-PXPXXNPPXPX---PXXPPPXPPPXXP 960 P P PP PP P P PP P P PPP P P Sbjct: 69 PPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTP 110 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 SPP P P PP P P PPP P Sbjct: 500 SPPVKPPPIQKPPTPTYSPPIKPPPVKP 527 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPP 953 P SPP P P PP P P PPP Sbjct: 75 PPTYSPPIYPPPIQKPPTPTYSPPIYPPP 103 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 844 VPXPXPXPPIXXPP-PPXPXXNPPXPXPXXPPPXPPP 951 +P P PI PP P P PP P PP PPP Sbjct: 422 LPPVKPPTPIYSPPVKPPPVHKPPTPI-YSPPVKPPP 457 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +1 Query: 859 PXPPIXXPP-PPXPXXNPP-XPXPXXPPPXPPPXXP 960 P PPI PP P P PP P PPP P P Sbjct: 58 PPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTP 93 Score = 31.5 bits (68), Expect = 0.86 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 847 PXPXPXPPIXXPP-PPXPXXNPPXP---XPXXPPPXPPPXXP 960 P P PI PP P P PP P P PPP P P Sbjct: 187 PVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTP 228 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPP-PPXPXXNPPXPXPXXPPPXPPP 951 P P PI PP P P PP P PP PPP Sbjct: 204 PVHKPPTPIYSPPIKPPPVHKPPTPT-YSPPVKPPP 238 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPP-PPXPXXNPPXPXPXXPPPXPPP 951 P P PI PP P P PP P PP PPP Sbjct: 238 PVHKPPTPIYSPPIKPPPVHKPPTPI-YSPPVKPPP 272 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPP-PPXPXXNPPXPXPXXPPPXPPP 951 P P PI PP P P PP P PP PPP Sbjct: 255 PVHKPPTPIYSPPVKPPPVQTPPTPI-YSPPVKPPP 289 Score = 31.5 bits (68), Expect = 0.86 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 10/45 (22%) Frame = +1 Query: 847 PXPXPXPPIXXPP--PPXPXXNPPX--------PXPXXPPPXPPP 951 P P PPI PP PP P +PP P P PP PP Sbjct: 328 PTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPP 372 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPP-PPXPXXNPPXPXPXXPPPXPPP 951 P P PI PP P P PP P PP PPP Sbjct: 339 PPVKPPTPIYSPPVKPPPVHKPPTPI-YSPPVKPPP 373 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPP-PPXPXXNPPXPXPXXPPPXPPP 951 P P PI PP P P PP P PP PPP Sbjct: 356 PVHKPPTPIYSPPVKPPPVHKPPTPI-YSPPVKPPP 390 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +3 Query: 858 PXXPXXLSPPXX---PXPQPPPPXPPXXPXXXPPPXPP 962 P P + PP P QPPP P P PP PP Sbjct: 469 PIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPP 506 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PPI PP PP P +PP PPP P P Sbjct: 91 PTPTYSPPIYPPPIQKPPTPTYSPP----IYPPPIQKPPTP 127 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PPI PP PP P +PP PPP P P Sbjct: 108 PTPTYSPPIYPPPIQKPPTPTYSPP----IYPPPIQKPPTP 144 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPP-PPXPXXNPPXPXPXXPPPXPPP 951 P P PI PP P P PP P PP PPP Sbjct: 373 PVHKPPTPIYSPPVKPPPIQKPPTPT-YSPPIKPPP 407 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPX--PPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P +P PP PP PP P P PP P Sbjct: 406 PPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKP 444 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXP---XPXXPPPXPPPXXP 960 P P P P P P PP P P PPP P P Sbjct: 474 PVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTP 514 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 SPP P P PP P P PPP Sbjct: 483 SPPVQPPPVQKPPTPTYSPPVKPPP 507 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/108 (20%), Positives = 26/108 (24%) Frame = +1 Query: 343 PXPPCXXXXPPVPXXXXXVLPAXXNRPNXPRQXXXXXXXLFRFPPXXXXXXXXXXXXXXX 522 P P PP P + P ++P P + PP Sbjct: 620 PIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQL 679 Query: 523 XXXXXXXXXXPRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P PP P P PPP Sbjct: 680 PPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPP 727 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 SPP P P PP P P PPP Sbjct: 652 SPPIKPPPVQKPPTPTYSPPVKPPP 676 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPX--PPXPPPPX-TPPXPXPXXPXXXPPPXXP 961 PP P +P PP PPP PP P P PP P Sbjct: 675 PPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVP 714 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPX--PPXPPPPX-TPPXPXPXXPXXXPPPXXP 961 PP P +P PP PPP PP P P PP P Sbjct: 692 PPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVP 731 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = +1 Query: 847 PXPXPXPPIXXPP-PPXPXXNPP-XPXPXXPPPXP---PPXXP 960 P P PPI PP P +PP P P PP P PP P Sbjct: 59 PPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYP 101 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 SPP P P PP P P PPP Sbjct: 96 SPPIYPPPIQKPPTPTYSPPIYPPP 120 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 SPP P P PP P P PPP Sbjct: 113 SPPIYPPPIQKPPTPTYSPPIYPPP 137 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PPI PP PP P +PP PPP P P Sbjct: 125 PTPTYSPPIYPPPIQKPPTPSYSPP----VKPPPVQMPPTP 161 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 SPP P P PP P P PPP Sbjct: 130 SPPIYPPPIQKPPTPSYSPPVKPPP 154 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPX--PPXPPPPX-TPPXPXPXXPXXXPPPXXP 961 PP P +P PP PPP PP P P PP P Sbjct: 136 PPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKP 175 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 SPP P P PP P P PPP Sbjct: 147 SPPVKPPPVQMPPTPTYSPPIKPPP 171 Score = 30.7 bits (66), Expect = 1.5 Identities = 38/208 (18%), Positives = 45/208 (21%), Gaps = 5/208 (2%) Frame = +1 Query: 343 PXPPCXXXXPPVPXXXXXVLPAXXNRPNXPRQXXXXXXXLFRFPPXXXXXXXXXXXXXXX 522 P P PP P + P ++P P + + P Sbjct: 149 PVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKP 208 Query: 523 XXXXXXXXXXPRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPLGXXX 702 P P P P P P PP P P PPP P+ Sbjct: 209 PTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHK-PPTPIYSPPIKPPPVHKPPTPIYSPP 267 Query: 703 XXXXXXXXXXXXXXXXXXXXXXXXX*XXXXXXXXXXXXXXXXXXXXXVPXPXPXPPIXXP 882 P PP+ P Sbjct: 268 VKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKP 327 Query: 883 PPP--XPXXNPP---XPXPXXPPPXPPP 951 P P P PP P P PP PP Sbjct: 328 PTPTYSPPIKPPPVKPPTPIYSPPVKPP 355 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPX--PPXPPPPX-TPPXPXPXXPXXXPPPXXP 961 PP P +P PP PPP PP P P PP P Sbjct: 220 PPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKP 259 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPX--PPXPPPPX-TPPXPXPXXPXXXPPPXXP 961 PP P +P PP PPP PP P P PP P Sbjct: 237 PPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTP 276 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPX--PPXPPPPX-TPPXPXPXXPXXXPPPXXP 961 PP P +P PP PPP PP P P PP P Sbjct: 338 PPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKP 377 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 SPP P P PP P P PPP Sbjct: 533 SPPIKPPPVHKPPTPTYSPPIKPPP 557 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 SPP P P PP P P PPP Sbjct: 567 SPPIKPPPVHKPPTPTYSPPIKPPP 591 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 SPP P P PP P P PPP Sbjct: 584 SPPIKPPPVHKPPTPTYSPPIKPPP 608 Score = 30.7 bits (66), Expect = 1.5 Identities = 22/108 (20%), Positives = 25/108 (23%) Frame = +1 Query: 343 PXPPCXXXXPPVPXXXXXVLPAXXNRPNXPRQXXXXXXXLFRFPPXXXXXXXXXXXXXXX 522 P P PP P + P ++P P PP Sbjct: 586 PIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHK 645 Query: 523 XXXXXXXXXXPRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P PP P P PPP Sbjct: 646 PPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPP 693 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 SPP P P PP P P PPP Sbjct: 601 SPPIKPPPVHKPPTPTYSPPIKPPP 625 Score = 30.7 bits (66), Expect = 1.5 Identities = 22/108 (20%), Positives = 25/108 (23%) Frame = +1 Query: 343 PXPPCXXXXPPVPXXXXXVLPAXXNRPNXPRQXXXXXXXLFRFPPXXXXXXXXXXXXXXX 522 P P PP P + P ++P P PP Sbjct: 603 PIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQK 662 Query: 523 XXXXXXXXXXPRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P PP P P PPP Sbjct: 663 PPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPP 710 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 SPP P P PP P P PPP Sbjct: 618 SPPIKPPPVHKPPTPTYSPPIKPPP 642 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPX--PPXPPPPX-TPPXPXPXXPXXXPPPXXP 961 PP P +P PP PPP PP P P PP P Sbjct: 624 PPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKP 663 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 SPP P P PP P P PPP Sbjct: 635 SPPIKPPPVHKPPTPTYSPPIKPPP 659 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPX--PPXPPPPX-TPPXPXPXXPXXXPPPXXP 961 PP P +P PP PPP PP P P PP P Sbjct: 641 PPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLP 680 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPX--PPXPPPPX-TPPXPXPXXPXXXPPPXXP 961 PP P +P PP PPP PP P P PP P Sbjct: 658 PPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVP 697 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 SPP P P PP P P PPP Sbjct: 686 SPPVKPPPVQVPPTPTYSPPVKPPP 710 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 SPP P P PP P P PPP Sbjct: 703 SPPVKPPPVQVPPTPTYSPPIKPPP 727 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPP-PPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PI PP P P PP P P PP P Sbjct: 272 PVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKP 310 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXP---PPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP P PP +PP P P PP P Sbjct: 283 PPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPP 322 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP P PP P PP PPP Sbjct: 323 PVQKPPTPTYSPPIKPPPVKPPTPI-YSPPVKPPP 356 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPX--PPXPPPPX-TPPXPXPXXPXXXPPPXXP 961 PP P +P PP PPP PP P P PP P Sbjct: 355 PPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKP 394 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPX--PPXPPPPX-TPPXPXPXXPXXXPPPXXP 961 PP P +P PP PPP PP P P PP P Sbjct: 372 PPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKP 411 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP P PP P PP PPP Sbjct: 407 PLQKPPTPTYSPPIKLPPVKPPTPI-YSPPVKPPP 440 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXP---XPXXPPPXPPPXXP 960 P P P PP P PP P P PPP P P Sbjct: 457 PVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTP 497 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXP---XPXXPPPXPPPXXP 960 P P P PP P PP P P PPP P P Sbjct: 507 PIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTP 547 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXP---XPXXPPPXPPPXXP 960 P P P P P P PP P P PPP P P Sbjct: 524 PVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTP 564 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 SPP P P PP P P PPP Sbjct: 550 SPPIKPPPIHKPPTPTYSPPIKPPP 574 Score = 30.3 bits (65), Expect = 2.0 Identities = 22/108 (20%), Positives = 25/108 (23%) Frame = +1 Query: 343 PXPPCXXXXPPVPXXXXXVLPAXXNRPNXPRQXXXXXXXLFRFPPXXXXXXXXXXXXXXX 522 P P PP P + P ++P P PP Sbjct: 569 PIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHK 628 Query: 523 XXXXXXXXXXPRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P PP P P PPP Sbjct: 629 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPP 676 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PPI PP P P P PPP P P Sbjct: 647 PTPTYSPPIKPPPVQKPP-TPTYSPPVKPPPVQLPPTP 683 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXP---PPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP P PP PP P P PP P Sbjct: 653 PPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPP 692 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 SPP P P PP P P PPP Sbjct: 669 SPPVKPPPVQLPPTPTYSPPVKPPP 693 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXP---PPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP P PP PP P P PP P Sbjct: 670 PPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPP 709 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXP---PPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP P PP PP P P PP P Sbjct: 114 PPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPP 153 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPX--PPXPPPPX-TPPXPXPXXPXXXPPPXXP 961 PP P +P PP PPP PP P P PP P Sbjct: 119 PPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMP 158 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXP---PPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP P PP PP P P PP P Sbjct: 131 PPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPP 170 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXP---XPXXPPPXPPPXXP 960 P P P PP P PP P P PPP P P Sbjct: 171 PVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTP 211 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 SPP P P PP P P PPP Sbjct: 197 SPPIKPPPVHKPPTPIYSPPIKPPP 221 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPP 953 SPP P P PP P P PPP Sbjct: 231 SPPVKPPPVHKPPTPIYSPPIKPPP 255 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXP---PPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP P PP PP P P PP P Sbjct: 266 PPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSP 305 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/38 (36%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +3 Query: 858 PXXPXXLSPPXX---PXPQPPPPXPPXXPXXXPPPXPP 962 P P + PP P +PPP P P PP PP Sbjct: 335 PIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPP 372 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXP---PPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP P PP PP P P PP P Sbjct: 687 PPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPP 726 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXP---PPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP P PP PP P P PP P Sbjct: 80 PPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPP 119 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXP---PPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP P PP PP P P PP P Sbjct: 97 PPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPP 136 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXP---PPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP P PP PP P P PP P Sbjct: 384 PPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLP 423 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 4/42 (9%) Frame = +1 Query: 847 PXPXPXPPIXXPP-PPXPXXNPPXP---XPXXPPPXPPPXXP 960 P P P PP P P PP P P PPP P P Sbjct: 540 PVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTP 581 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXP---PPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP P PP PP P P PP P Sbjct: 148 PPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 187 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 SPP P P PP P P PP P Sbjct: 164 SPPIKPPPVHKPPTPTYSPPIKPPVHKP 191 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 SPP P P PP P P PP P Sbjct: 400 SPPIKPPPLQKPPTPTYSPPIKLPPVKP 427 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/37 (32%), Positives = 14/37 (37%) Frame = +1 Query: 556 RPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 +P + P P P P PP P P PPP Sbjct: 471 KPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPP 507 Score = 29.1 bits (62), Expect = 4.6 Identities = 38/200 (19%), Positives = 41/200 (20%), Gaps = 6/200 (3%) Frame = +1 Query: 370 PPVPXXXXXVLPAXXNRPNXPRQXXXXXXXLFRFPPXXXXXXXXXXXXXXXXXXXXXXXX 549 PP P V P +P P + PP Sbjct: 477 PPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPI 536 Query: 550 XPRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPLGXXXXXXXXXXXX 729 P P P P P P PP P P PPP P Sbjct: 537 KPPPVHKPPTPTYSPPIKPPPIHK-PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKP 595 Query: 730 XXXXXXXXXXXXXXXX*XXXXXXXXXXXXXXXXXXXXXVPXPXPXPPIXXPPPP--XPXX 903 P PP+ PP P P Sbjct: 596 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPI 655 Query: 904 NPP----XPXPXXPPPXPPP 951 PP P P PP PP Sbjct: 656 KPPPVQKPPTPTYSPPVKPP 675 Score = 28.7 bits (61), Expect = 6.1 Identities = 24/121 (19%), Positives = 29/121 (23%), Gaps = 5/121 (4%) Frame = +1 Query: 343 PXPPCXXXXPPVPXXXXXVLPAXXNRPNXPRQXXXXXXXLFRFPPXXXXXXXXXXXXXXX 522 P P PP P + P +P P + PP Sbjct: 637 PIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQV 696 Query: 523 XXXXXXXXXXPRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXP-----XXPPPXSXGGXP 687 P P P P P PP P P P PPP + P Sbjct: 697 PPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSPPQGGYGTPPPYAYLSHP 756 Query: 688 L 690 + Sbjct: 757 I 757 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 3/39 (7%) Frame = +1 Query: 853 PXPXPPIXXPPPPX---PXXNPPXPXPXXPPPXPPPXXP 960 P PP+ PP P P PP P P PP P Sbjct: 637 PIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPP 675 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPP----XPXPXXPPPXPPP 951 P PPI PP P PP P P PP PP Sbjct: 66 PIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPP 102 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 +P P +PPP P P PP PP Sbjct: 227 TPTYSPPVKPPPVHKPPTPIYSPPIKPP 254 Score = 28.3 bits (60), Expect = 8.0 Identities = 28/123 (22%), Positives = 30/123 (24%) Frame = +1 Query: 298 PXPYSTP**XXIIXLPXPPCXXXXPPVPXXXXXVLPAXXNRPNXPRQXXXXXXXLFRFPP 477 P P TP I P P PP P V +P P + PP Sbjct: 270 PPPVQTPP-TPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPP 328 Query: 478 XXXXXXXXXXXXXXXXXXXXXXXXXPRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXX 657 P P P P P P PP P P Sbjct: 329 TPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHK-PPTPIYSPPVK 387 Query: 658 PPP 666 PPP Sbjct: 388 PPP 390 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +2 Query: 851 PPXXXPXSPXPPXP---PPPXTPPXPXPXXPXXXPPP 952 PP P PP P PP PP P P PP Sbjct: 704 PPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSPP 740 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 36.7 bits (81), Expect = 0.023 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG G G GG G GGGG G G G G Sbjct: 398 GCGGGGGGGDGGGGQGTGIGGGGGGEQGTGVGGG 431 Score = 36.7 bits (81), Expect = 0.023 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 GG GGG G G G G GGGG G G G T Sbjct: 400 GGGGGGGDGGGGQGTGIGGGGGGEQGTGVGGGGDT 434 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GG G G G GGG Sbjct: 401 GGGGGGDGGGGQGTGIGGGGGGEQGTGVGGGGDTCTQVTHGGG 443 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 933 GXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G GG GGG G G G G GGG Sbjct: 398 GCGGGGGGGDGGGGQGTGIGGGGGGEQGTGVGGG 431 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGG 850 GGG G G G G GGGG GG G GG Sbjct: 400 GGGGGGGDGGGGQGTGIGGGG-GGEQGTGVGGGG 432 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 944 GXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG G + GGGG GG G G G Sbjct: 383 GWGGGGAGAVTQVMQGCGGGGGGGDGGGGQGTG 415 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG G G G GGGG G G GG + G G Sbjct: 385 GGGGAGAVTQVMQGCGGGG-GGGDGGGGQGTGIGG 418 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 36.7 bits (81), Expect = 0.023 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G G GGG G G GGL G G GG GG G Sbjct: 75 GLGGGGGGLGGGGGGLLGGGGFGGGAGGGLG 105 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G G G G G GG G GGG GG G G G Sbjct: 71 GAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGGLG 105 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGG 881 GG GGG G G GGGG G G GG Sbjct: 77 GGGGGGLGGGGGGLLGGGGFGGGAGGG 103 Score = 33.5 bits (73), Expect = 0.21 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 6/47 (12%) Frame = -3 Query: 951 GGGXXXGXXGXGXG-----GVXGGGGXGG-XGDXGXXXGGXXXGGGA 829 GGG G G G G G+ GGG GG G G GG GGGA Sbjct: 54 GGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGA 100 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXG 865 G GGG G G G GG+ GGGG GG G Sbjct: 75 GLGGGG---GGLGGGGGGLLGGGGFGGGAGGG 103 Score = 31.5 bits (68), Expect = 0.86 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXG 838 G G G G G GG GGGG G G G GG G Sbjct: 71 GAGLGLGGGGGGLGG--GGGGLLGGGGFGGGAGGGLGG 106 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G G G G GG G GGG GG G G G Sbjct: 67 GIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAG 101 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = -1 Query: 959 GXXGGGXGGGXXGX-GXGGLXXGXG---GGGXXXGGXGXGXG 846 G G G G G G G GGL G G G G GG G G G Sbjct: 43 GGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLG 84 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXGXXGGXRXXG 866 G G G G G GGGG G G GG G Sbjct: 63 GIGAGIGAGAGLGLGGGGGGLGGGGGGLLGG 93 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGG--XGGXGDXGXXXGG 850 G G G G G GG+ GGGG GG G G GG Sbjct: 69 GAGAGLGLGGGG-GGLGGGGGGLLGGGGFGGGAGGG 103 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G GG G GG G G G GGG Sbjct: 41 GGGGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGG 80 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXG 884 GG GGG GG GGG G G G Sbjct: 81 GGLGGGGGGLLGGGGFGGGAGGGLGG 106 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 36.3 bits (80), Expect = 0.030 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXG 678 P PAP P P PP PK P P PPP S G Sbjct: 388 PPPPAPPPGSGGPKPPPPPGPKGPRP--PPPMSLG 420 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P S PP PPPP PP P P P P Sbjct: 375 PAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGP 411 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPP----PXTPPXPXPXXPXXXPP 949 P P P PP PPP P PP P P P PP Sbjct: 380 PSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 35.1 bits (77), Expect = 0.070 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P P+PPPP PP PP PP Sbjct: 372 PPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPP 406 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 586 APXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 AP P P P P P P PPP S G P Sbjct: 369 APPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKP 402 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P PP P PP P P P PPP Sbjct: 373 PVPAPQMPSSAGPPRPPPPAPP-PGSGGPKPPPPP 406 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +2 Query: 851 PPXXXPXSPXP----PXPPPPXTPPXPXPXXPXXXPP 949 PP P +P P P PPPP P P P P P Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGP 421 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP PP P P P P P P P P P Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 6/40 (15%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP------XPPPXXP 960 P PP+ P P PP P P PPP PPP P Sbjct: 370 PPPPVPAPQMP-SSAGPPRPPPPAPPPGSGGPKPPPPPGP 408 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP PPP PP P P P PPP Sbjct: 386 PRPPPPAPPPGSGGPKPPPP-PGPKGPRPPP 415 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P PP P PP P P PPP Sbjct: 372 PPVPAPQMPSSAGPPRPP-PPAPPPGSGGPKPPP 404 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 PS P P P P PP P P PPP Sbjct: 380 PSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP P PP P P PP P Sbjct: 394 PPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/28 (42%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +3 Query: 882 PPXXPX-PQPPPPXPPXXPXXXPPPXPP 962 PP P P+ PPP P PP PP Sbjct: 160 PPRPPTRPKSPPPRKSSFPPSRSPPPPP 187 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 36.3 bits (80), Expect = 0.030 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXG 678 P PAP P P PP PK P P PPP S G Sbjct: 388 PPPPAPPPGSGGPKPPPPPGPKGPRP--PPPMSLG 420 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P S PP PPPP PP P P P P Sbjct: 375 PAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGP 411 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPP----PXTPPXPXPXXPXXXPP 949 P P P PP PPP P PP P P P PP Sbjct: 380 PSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 35.1 bits (77), Expect = 0.070 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P P+PPPP PP PP PP Sbjct: 372 PPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPP 406 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 586 APXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 AP P P P P P P PPP S G P Sbjct: 369 APPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKP 402 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P PP P PP P P P PPP Sbjct: 373 PVPAPQMPSSAGPPRPPPPAPP-PGSGGPKPPPPP 406 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +2 Query: 851 PPXXXPXSPXP----PXPPPPXTPPXPXPXXPXXXPP 949 PP P +P P P PPPP P P P P P Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGP 421 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP PP P P P P P P P P P Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 6/40 (15%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP------XPPPXXP 960 P PP+ P P PP P P PPP PPP P Sbjct: 370 PPPPVPAPQMP-SSAGPPRPPPPAPPPGSGGPKPPPPPGP 408 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP PPP PP P P P PPP Sbjct: 386 PRPPPPAPPPGSGGPKPPPP-PGPKGPRPPP 415 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P PP P PP P P PPP Sbjct: 372 PPVPAPQMPSSAGPPRPP-PPAPPPGSGGPKPPP 404 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 PS P P P P PP P P PPP Sbjct: 380 PSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP P PP P P PP P Sbjct: 394 PPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/28 (42%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +3 Query: 882 PPXXPX-PQPPPPXPPXXPXXXPPPXPP 962 PP P P+ PPP P PP PP Sbjct: 160 PPRPPTRPKSPPPRKSSFPPSRSPPPPP 187 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 36.3 bits (80), Expect = 0.030 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 VP P P PPP P PP P P P PP P Sbjct: 49 VPPPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMP 87 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXP---PPXXP 960 PP+ PPP P P P P PPP P PP P Sbjct: 63 PPMPMTPPPMPM--TPPPMPMAPPPMPMASPPMMP 95 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXP-PPXPPPXXP 960 P P PP+ PPP P PP P P P P P Sbjct: 64 PMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSP 102 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 8/46 (17%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPX--------PXPXXPPPXPPPXXP 960 P P PP+ PPP P +PP P P P P P P Sbjct: 71 PMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSPLTVPDMPSPPMP 116 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +2 Query: 611 LPXQXPPXPX--PXXPXRPPPXPXGAPP 688 +P PP P P P PPP P +PP Sbjct: 65 MPMTPPPMPMTPPPMPMAPPPMPMASPP 92 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/46 (32%), Positives = 17/46 (36%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXPL 690 P S + P P P P P PP P P PPP P+ Sbjct: 52 PVMSPMPMMTPPPMPMTPPPMPMTPP----PMPMAPPPMPMASPPM 93 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +1 Query: 574 PXXPAPXPXXPXP-AXAXPPXPKXPXPXXPPPXSXGGXPL 690 P P P P P P A PP P P P S PL Sbjct: 66 PMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSPL 105 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP PPPP PP P P PPP P P Sbjct: 9 PPPPPPPPPRLLVLPPLPPPPPPPPPQLPFGP 40 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPP---XXPXXXPPPXPP 962 ++ P P PPPP PP P PPP PP Sbjct: 1 MATPSKRRPPPPPPPPPRLLVLPPLPPPPPPP 32 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PPPP P P PPP PPP Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPPP 32 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 4/32 (12%) Frame = +2 Query: 851 PPXXXPXSPX----PPXPPPPXTPPXPXPXXP 934 PP P P PP PPPP PP P P Sbjct: 9 PPPPPPPPPRLLVLPPLPPPPPPPPPQLPFGP 40 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P L P P P PPPP PP P P P Sbjct: 14 PPPPRLLVLP--PLPPPPPPPPPQLPFGPKLPFP 45 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P P PP P PP P P P PPP P Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPP---PPPQLP 37 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXP--PPXPPP 951 P P P PP PP P PP P P P P P P Sbjct: 10 PPPPPPPPRLLVLPPLPPP-PPPPPPQLPFGPKLPFP 45 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 36.3 bits (80), Expect = 0.030 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXG---GXGDXGXXXGGXXXGGG 832 GGG G G G GG GGG G G G G GG GGG Sbjct: 92 GGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGG 134 Score = 35.9 bits (79), Expect = 0.040 Identities = 18/36 (50%), Positives = 19/36 (52%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 GGG GG G G GG G GGG GG G G G+ Sbjct: 92 GGGSSGGRGGFGGGGGRGGGRGGGSYGGGYG-GRGS 126 Score = 35.1 bits (77), Expect = 0.070 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G GGG G G GG GGG GG G G GG GG Sbjct: 88 GNSGGGGSSGGRGGFGGGGGRGGGRGG-GSYGGGYGGRGSGG 128 Score = 34.7 bits (76), Expect = 0.093 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGG 879 G GGG GGG G G GG G GGG Sbjct: 106 GGRGGGRGGGSYGGGYGGRGSGGRGGG 132 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGG 864 GGG GGG G GG G G GG GG Sbjct: 105 GGGRGGGRGGGSYGGGYGGRGSGGRGGGG 133 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGD 871 G GGG G G G GG GG GG GD Sbjct: 106 GGRGGGRGGGSYGGGYGGRGSGGRGGGGGD 135 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GG G G G GG G G G G G GRG Sbjct: 93 GGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRG 130 Score = 31.9 bits (69), Expect = 0.65 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GG G GG G G GG GG G G G Sbjct: 101 GFGGGGGRGG----GRGGGSYGGGYGGRGSGGRGGGGG 134 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXG 874 GGG G G G G GGGG GG G Sbjct: 154 GGGGYSGGGGGGRYGSGGGGGGGGGG 179 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 938 GGGXXGXGXGGLXXGXGGGGXXXGG 864 GGG G G GG GGGG GG Sbjct: 155 GGGYSGGGGGGRYGSGGGGGGGGGG 179 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 938 GGGXXGXGXGGLXXGXGGGGXXXGG 864 GGG G GG G GGGG GG Sbjct: 154 GGGGYSGGGGGGRYGSGGGGGGGGG 178 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXG 899 G GGG G GG GGGG G Sbjct: 160 GGGGGGRYGSGGGGGGGGGG 179 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXG 893 GG GG G G GGGG G G Sbjct: 156 GGYSGGGGGGRYGSGGGGGGGGG 178 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 692 PRGXPPXEXGGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 P G P GG G G GG G G G G G GRG Sbjct: 81 PDGAPVQGNSGGGGSSG--GRGGFGGGGGRGGGRGGGSYGGGYGGRG 125 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P PP PPP Sbjct: 140 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPP 174 Score = 34.7 bits (76), Expect = 0.093 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +1 Query: 853 PXPXPPIXXPPPPXP--XXNPPXPXPXXPPPXPPP 951 P P P + PPPP P +PP P P PPP Sbjct: 160 PPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPP 194 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 70 PPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPP 104 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 90 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 124 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 110 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 144 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 130 PPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPP 164 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 180 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 214 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 200 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 234 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 220 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 254 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 240 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 274 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 260 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 294 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 280 PPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPP 314 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 290 PPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPP 324 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 300 PPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPP 334 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 80 PPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPP 114 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 100 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 134 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 120 PPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPP 154 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +1 Query: 853 PXPXPPIXX---PPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PPPP +PP P P PPP Sbjct: 169 PPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPP 204 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 190 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 224 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 210 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 244 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 230 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 264 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 250 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 284 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 270 PPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPP 304 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 310 PPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPP 344 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXP-XXNPPXPXPXXPPPXPPP 951 P P P + PPP P +PP P P PPP Sbjct: 150 PPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPP 183 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P + PPP PP P PP PP Sbjct: 53 PSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPP 84 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP PP P P PPP Sbjct: 150 PPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPP 184 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 7/40 (17%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXN----PPXPXPXXPPP---XPPP 951 P P P + PPP P + PP P PPP PPP Sbjct: 330 PPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKPPP 369 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXP 959 SPP P PP PP PPP P Sbjct: 329 SPPPPPYVYKSPPPPPYVDSYSPPPAP 355 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PPPP +PP P P PPP Sbjct: 62 PPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPP 94 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXP 959 SPP P PPP PP PPP P Sbjct: 159 SPPPPPYVYSPPPPPPYV-YQSPPPPP 184 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 320 PPPPPYVYTSPPPPPYVYKSPP-PPPYVDSYSPPP 353 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 6/43 (13%) Frame = +2 Query: 851 PPXXXPXSPXPPX------PPPPXTPPXPXPXXPXXXPPPXXP 961 PP SP PP PPPP P P PPP P Sbjct: 132 PPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPP 174 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P SPP P P PP PPP P Sbjct: 161 PPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPP 194 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 36.3 bits (80), Expect = 0.030 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPP---XPXPXXPPPXPPP 951 P P P PPP P +PP P P P P PPP Sbjct: 68 PPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPP 103 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXP---PPPXTPPXPXPXXPXXXPPPXXP 961 PP P SP P PPP T P P P PP P Sbjct: 43 PPATSPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTP 82 Score = 32.7 bits (71), Expect = 0.37 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXPP---PPXTPPXPXPXXPXXXPPPXXP 961 PP P P PP PP TPP P P PPP P Sbjct: 60 PPPATAAQPPPNQPPNTTPPPTPPSSPP--PSITPPPSPP 97 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXX--PPPXPPPXXP 960 P P P PPP PP P PPP PP P Sbjct: 48 PPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPP 87 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPP--XPXPXXPPPXPPPXXP 960 P PP PP P PP P PPP PP P Sbjct: 62 PATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQP 101 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPX-PXXNPPXPXPXXPPPXPPP 951 P P PP PPP P + P P P PPP Sbjct: 92 PPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPP 125 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +1 Query: 559 PSGLXPXXPAPXPXX-PXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P+ P P+P P PA A P P P PPP P Sbjct: 44 PATSPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPP 87 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP PP P PP P PPP P Sbjct: 78 PPPTPPSSPPPSITP---PPSPPQPQPPPQSTP 107 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPP--XXPXXXPPPXP 959 P PP P PQPPP P P P P P Sbjct: 88 PSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKP 120 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXPPIXXP-PPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP P P P P P P P P P P P Sbjct: 33 PAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAP 68 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXPPIXXP-PPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP P P P P P P P P P P P Sbjct: 44 PTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAP 79 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXPPIXXP-PPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP P P P P P P P P P P P Sbjct: 55 PKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKP 90 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXPPIXXP-PPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP P P P P P P P P P P P Sbjct: 77 PAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAP 112 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNP-PXPXPXXPPPXPPPXXP 960 P P P P P P P P P P P P P P P P Sbjct: 24 PAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPP 62 Score = 35.5 bits (78), Expect = 0.053 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXP-PIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P P P P P PP P P P P PP P Sbjct: 29 PKPKPAPAPTPPKPKPTPAPTPPKPKPK-PAPTPPKPKP 66 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNP-PXPXPXXPPPXPPPXXP 960 P P P P P P P P P P P P P P P P Sbjct: 35 PAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPP 73 Score = 35.5 bits (78), Expect = 0.053 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXP-PIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P P P P P PP P P P P PP P Sbjct: 40 PKPKPTPAPTPPKPKPKPAPTPPKPKPA-PAPTPPKPKP 77 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNP-PXPXPXXPPPXPPPXXP 960 P P P P P P P P P P P P P P P P Sbjct: 46 PAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPP 84 Score = 35.5 bits (78), Expect = 0.053 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXP-PIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P P P P P PP P P P P PP P Sbjct: 51 PKPKPKPAPTPPKPKPAPAPTPPKPKPA-PAPTPPKPKP 88 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNP-PXPXPXXPPPXPPPXXP 960 P P P P P P P P P P P P P P P P Sbjct: 57 PAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPP 95 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXPPIXXP-PPPXPXXNPPXPXPXXPPPXPPP 951 P P P PP P P P P P P P P P P P Sbjct: 66 PAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTP 101 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNP-PXPXPXXPPPXPPPXXP 960 P P P P P P P P P P P P P P P P Sbjct: 68 PAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPP 106 Score = 35.5 bits (78), Expect = 0.053 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXP-PIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P P P P P PP P P P P PP P Sbjct: 73 PKPKPAPAPTPPKPKPKPAPTPPNPKPT-PAPTPPKPKP 110 Score = 35.1 bits (77), Expect = 0.070 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXP-PIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P P P P P PP P P P P PP P Sbjct: 62 PKPKPAPAPTPPKPKPAPAPTPPKPKPK-PAPTPPNPKP 99 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNP-PXPXPXXPPPXPPP 951 P P P P P P P P P P P P P P P Sbjct: 79 PAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAP 114 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXP-PIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P P P P P PP P P P P P P Sbjct: 84 PKPKPKPAPTPPNPKPTPAPTPPKPKP-APAPAPTP 118 Score = 32.7 bits (71), Expect = 0.37 Identities = 19/42 (45%), Positives = 21/42 (50%), Gaps = 4/42 (9%) Frame = +1 Query: 553 PRPSGLXPXX---PAPXPXXPXPAXA-XPPXPKXPXPXXPPP 666 P+P+ P PAP P P PA A PP PK P P PP Sbjct: 55 PKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPK-PKPAPTPP 95 Score = 32.7 bits (71), Expect = 0.37 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGG 681 P P P PAP P P PA A P P P P P + GG Sbjct: 92 PTPPNPKPT-PAPTPPKPKPAPAPAPTP-APKPKPAPKPAPGG 132 Score = 32.3 bits (70), Expect = 0.49 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +1 Query: 553 PRPSGLXPXX-PAPXPXXPXPAXA-XPPXPKXPXPXXPPP 666 P P+ P PAP P P PA A PP PK P P PP Sbjct: 46 PAPTPPKPKPKPAPTPPKPKPAPAPTPPKPK-PAPAPTPP 84 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +1 Query: 583 PAPXPXXPXPAXA-XPPXPKXPXPXXPPP 666 PAP P P PA A PP PK P P PP Sbjct: 24 PAPKPPKPKPAPAPTPPKPK-PTPAPTPP 51 Score = 31.5 bits (68), Expect = 0.86 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXA-XPPXPKXPXPXXPPP 666 P+P P PAP P P P A PP PK P P PP Sbjct: 26 PKPPKPKPA-PAPTPPKPKPTPAPTPPKPK-PKPAPTPP 62 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +1 Query: 553 PRPSGLXPXX-PAPXPXXPXPAXA-XPPXPKXPXPXXPPP 666 P P+ P PAP P P P A PP PK P P PP Sbjct: 68 PAPTPPKPKPAPAPTPPKPKPKPAPTPPNPK-PTPAPTPP 106 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P +P P P PP P P P P P P Sbjct: 92 PTPPNPKPTPAPTPPKPKPAPAPAPTPAPKP 122 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P P P P PP P P P P P Sbjct: 90 PAPTPPNPKPTPAPTPPKPKPAPAPAPTPAP 120 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 872 SPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 S P PP P P P P P P P P Sbjct: 22 SAPAPKPPKPKPAPAPTPPKPKPTPAPTPP 51 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P P P P+P P P P P P P Sbjct: 83 PPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAP 116 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNP-PXPXPXXPPPXPPP 951 P P P P P P P P P P P P P P P Sbjct: 90 PAPTPPNPKPTPAPTPPKPKPAPAPAP-TPAPKPKP 124 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNP-PXPXPXXPPPXPPP 951 P P P P PP P P P P P P P P P Sbjct: 92 PTPPNPKPTPAPTPPKPKPAPAPAPTP-APKPKPAP 126 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +1 Query: 853 PXPXP-PIXXPPPPXPXXNP-PXPXPXXPPPXPPP 951 P P P P PP P P P P P P P P P P Sbjct: 95 PNPKPTPAPTPPKPKPAPAPAPTPAP-KPKPAPKP 128 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQP-PPPXPPXXPXXXPPPXP 959 P P P P P+P P P P P P P P Sbjct: 94 PPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKP 128 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = +1 Query: 553 PRPSGLXPXX-PAPXPXXPXPAXAX-PPXPKX---PXPXXPPP 666 P P+ P PAP P P P A PP PK P P P P Sbjct: 35 PAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKP 77 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/46 (30%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +1 Query: 553 PRPSGLXPXX-PAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P+ P P P P P P P P P P P + P Sbjct: 77 PAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKP 122 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 854 PXXXPXSPXP-PXPPPPXTPPXPXPXXPXXXPPP 952 P P +P P P P PP P P P P P P Sbjct: 90 PAPTPPNPKPTPAPTPPKPKPAPAP-APTPAPKP 122 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 847 PXPXPXP-PIXXPPPPXPXXNP-PXPXPXXPPPXPPP 951 P P P P P P P P P P P P P P P P Sbjct: 95 PNPKPTPAPTPPKPKPAPAPAPTPAPKP-KPAPKPAP 130 >At5g25550.1 68418.m03040 leucine-rich repeat family protein / extensin family protein similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana]; contains Pfam PF00560: Leucine Rich Repeat domains Length = 433 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +2 Query: 854 PXXXPXSPXP-PXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P +P P P PP TPP P P PPP P Sbjct: 389 PSSQPLAPAPSPTSPPLSTPPPARPCPPVYSPPPPPP 425 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +1 Query: 847 PXPXPX-PPIXXPPPPXPXXNPPXPXPXXPPP 939 P P P PP+ PPP P PP P PPP Sbjct: 396 PAPSPTSPPLSTPPPARPC--PPVYSPPPPPP 425 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPP 912 P P PP+ PPPP P P Sbjct: 409 PPARPCPPVYSPPPPPPLSLAP 430 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GGG G GL G GGG G G Sbjct: 72 GGAGGGLGGGLGGGAGSGLGGGLGGGSGIGAGTSGG 107 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 GG G G G GGL G GGG G G G G+ Sbjct: 63 GGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGGGS 98 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGG--GGXXXGGXGXGXGT 843 GG GG G G GGL G G GG GG G G GT Sbjct: 69 GGFGGAGGGLG-GGLGGGAGSGLGGGLGGGSGIGAGT 104 Score = 32.7 bits (71), Expect = 0.37 Identities = 19/41 (46%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXG--XGGGGXXXGGXGXGXGT 843 G GG GGG G G G L G G GG GG G G G+ Sbjct: 49 GLPFGGVGGGVSGPG-GNLGYGGFGGAGGGLGGGLGGGAGS 88 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 944 GXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG G G GL G GGG G G G Sbjct: 37 GYGGGYSGVGDNGLPFGGVGGGVSGPGGNLGYG 69 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GGG GGL G G G GG G Sbjct: 76 GGLGGGLGGGAGSGLGGGLGGGSGIGAGTSGGSTGG 111 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXG-GGGXGG--XGDXGXXXGGXXXGG 835 G GGG G GG G GGG GG G G GG GG Sbjct: 53 GGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGGG 97 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXG---GGGXGGXGDXGXXXGGXXXGG 835 G G G G G G GG G GGG GG G G GG Sbjct: 67 GYGGFGGAGGGLGGGLGGGAGSGLGGGLGGGSGIGAGTSGGSTGG 111 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -1 Query: 959 GXXGG--GXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG G GG G GG G GGG G G G G Sbjct: 54 GVGGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGG 93 Score = 29.5 bits (63), Expect = 3.5 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -1 Query: 686 GXPPXEXGGGXXG-XGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 G P GGG G G LG GG AG G G G G S G G Sbjct: 49 GLPFGGVGGGVSGPGGNLGYGGFGGAG-GGLGGGLGGGAGSGLGGG 93 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GGG G G GGG G G G G Sbjct: 76 GGLGGGLGGGAGSGLGGGLGGGSGIGAGTSGGSTG 110 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXG-GXXXGGGA 829 G G G G G GG+ GG G G G G G G GG+ Sbjct: 64 GNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGGGSGIGAGTSGGS 108 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 687 GGAPXGXGGGRXGXXGLGXGGXCXG 613 GGA G GGG G G G GG G Sbjct: 72 GGAGGGLGGGLGGGAGSGLGGGLGG 96 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 35.9 bits (79), Expect = 0.040 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXG 865 GGG G G G GG GGGG GG GD G Sbjct: 124 GGGYSYGGGGGGYGG--GGGGYGGGGDGG 150 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 938 GGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 GGG G GG G GGGG GG G G Sbjct: 123 GGGGYSYGGGGGGYGGGGGGYGGGGDGGG 151 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 918 GXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG GGG GG G G GG GGG Sbjct: 123 GGGGYSYGGGGGGYGGGGGGYGGGGDGGG 151 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -1 Query: 944 GXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG G GG G GGGG GG G G G Sbjct: 122 GGGGGYSYGGGGG---GYGGGGGGYGGGGDGGG 151 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGG 864 GGG G G G GG G GGGG GG Sbjct: 124 GGGYSYGGGGGGYGGGGGGYGGGGDGGGG 152 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 924 GXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G GGGG G G G GG GGG Sbjct: 122 GGGGGYSYGGGGGGYGGGGGGYGGGGDGGGG 152 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXG 893 G GGG G GG GGGG G G Sbjct: 130 GGGGGGYGGGGGGYGGGGDGGG 151 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GG GG G G GG GGGG GG G G Sbjct: 122 GGGGGYSYGGGGGGYG---GGGGGYGGGGDGGGG 152 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -2 Query: 958 GXGGGXXXGXXG---GXGGGGXGXGXXGG 881 G GGG G G G GGGG G G GG Sbjct: 122 GGGGGYSYGGGGGGYGGGGGGYGGGGDGG 150 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGG 879 G GG GGG G G G G GGGG Sbjct: 126 GYSYGGGGGGYGGGGGGYGGGGDGGGG 152 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGG 879 G G GGG G G GG G GGG Sbjct: 125 GGYSYGGGGGGYGGGGGGYGGGGDGGG 151 >At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ boundaries domain protein 18 (LBD18) identical to LOB DOMAIN 18 [Arabidopsis thaliana] GI:17227164; supported by full-length cDNA gi:17227163 Length = 262 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGG 850 GGG G G GG GGG GG G G GG Sbjct: 3 GGGNTITAVGGGGGGCGGGGSSGGGGSSGGGGGG 36 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGG 879 G GGG GGG G GG G GGGG Sbjct: 12 GGGGGGCGGG--GSSGGGGSSGGGGGG 36 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXG 874 GGG G G GG GGGG G G Sbjct: 14 GGGGCGGGGSSGGGGSSGGGGGGPCG 39 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXG 899 GG GGG G G GGGG G Sbjct: 16 GGCGGGGSSGGGGSSGGGGGG 36 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 938 GGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG GG G GGGG GG G G Sbjct: 3 GGGNTITAVGGGGGGCGGGGSSGGGGSSGGG 33 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGG 881 GG GGG G G GGGG G GG Sbjct: 12 GGGGGG--CGGGGSSGGGGSSGGGGGG 36 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 897 GGGXGGXGDXGXXXGGXXXGGG 832 GGG GG G G GG GGG Sbjct: 12 GGGGGGCGGGGSSGGGGSSGGG 33 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 GGG GGG G G GG G G G G G G Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G GG G G G G G Sbjct: 95 GGGGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDG 132 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -3 Query: 924 GXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G G GG GGGG GG D G GGG+ Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSGSGSGSGGGS 222 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXG 865 GGG G G G GGV G G G G G Sbjct: 192 GGGGGGGGGGGGGGGVDGSGSGSGSGSGG 220 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G GGG GGG G G G G G G GG G Sbjct: 192 GGGGGGGGGGGGGGGVDG--SGSGSGSGSGGGSG 223 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGX--GGLXXGXGGGGXXXGGXGXGXG 846 G G G G GG+ G GGGG GG G G G Sbjct: 72 GYGDGNGNGNAHGRADCPGGIVVGGGGGGGGGGGGGGGSG 111 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGG 864 G GGG GGG G G GG+ G G GG Sbjct: 191 GGGGGGGGGG--GGGGGGVDGSGSGSGSGSGG 220 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G G G G G G G G G G G G G Sbjct: 145 GGGGSGEGSGGGGGGDGSSGSGSGSGSGSGSGTGTASG 182 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGG 881 GG GGG G GG G G G G G Sbjct: 193 GGGGGGGGGGGGGGVDGSGSGSGSGSG 219 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 912 GGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 GG GGGG GG G G G G G+ Sbjct: 96 GGGGGGGGGGGGGGSGGSNGSFFNGSGS 123 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 GG G G G GG G G G G G GT Sbjct: 145 GGGGSGEGSGGGGGGDGSSGSGSGSGSGSGSGTGT 179 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXG 838 G G G G V GGGG GG G G G G Sbjct: 78 GNGNAHGRADCPGGIVVGGGGGGGGGGGGGGGSGGSNG 115 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGG 881 GG GGG G G G G G G G Sbjct: 197 GGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXG 866 GG GGG G GG GG G G G Sbjct: 95 GGGGGGGGGGGGGGGSGGSNGSFFNGSGSGTG 126 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGG 879 G GGG GGG G GG G GGGG Sbjct: 190 GSFGGGGGGGAGSYGGGGAGAGSGGGG 216 Score = 35.1 bits (77), Expect = 0.070 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 918 GXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG GGGG GG G G G GGG Sbjct: 187 GGGGSFGGGGGGGAGSYGGGGAGAGSGGG 215 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 944 GXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG G G GG GGGG G G G Sbjct: 186 GGGGGSFGGGGGGGAGSYGGGGAGAGSGGGG 216 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GG GG G G GG GGG G G G Sbjct: 182 GSRYGGGGGSFGGGGGGGAGSYGGGGAGAGSGGGGG 217 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = -1 Query: 689 RGXPPXEXGGGXXGXGXLGXGGXAXAGXGXXGXGAGXXG 573 +G GGG G G GG G G G G+G G Sbjct: 178 QGRQGSRYGGGGGSFGGGGGGGAGSYGGGGAGAGSGGGG 216 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 938 GGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG G GG G GGG G G G G Sbjct: 187 GGGGSFGGGGGGGAGSYGGGGAGAGSGGGGG 217 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGG 880 G GGG G G GG G G GG Sbjct: 190 GSFGGGGGGGAGSYGGGGAGAGSGGGG 216 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGG-GXGGXGDXG 865 GGG G G G G GGG G G G G Sbjct: 188 GGGSFGGGGGGGAGSYGGGGAGAGSGGGGG 217 >At3g05920.1 68416.m00668 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 126 Score = 35.5 bits (78), Expect = 0.053 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPP 949 PP P P PP P P PP P P PP Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPAPEPPKHVCKPP 104 Score = 31.9 bits (69), Expect = 0.65 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 883 PPPXPXXNPPXPXPXXPPPXPPPXXP 960 PPP P P P P P P P P P Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPAPEPP 97 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 871 IXXPPPPXPXXNPPXPXPXXPPPXPPP 951 + PP P PP P PPP P P Sbjct: 70 VGPPPKPPEPPKPPEPEKPKPPPAPEP 96 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G GGG GGG G GG GGG GG G Sbjct: 78 GRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGG 111 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G GG G GG GG G Sbjct: 73 GGGGGGRGGG--GFGGGGRSFGGGGSSSRGGGGSSSRG 108 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G GG + G G G G G S G G Sbjct: 75 GGGGRGGGGFGGGGRSFGGGGSSSRGGG--GSSSRGGG 110 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGG--GXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GGG GG G GG GG Sbjct: 73 GGGGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGGSSSRGG 117 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 906 VXGGGGXGGXGDXGXXXGGXXXGGG 832 V GGG GG G G GG GGG Sbjct: 70 VKKGGGGGGRGGGGFGGGGRSFGGG 94 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXP---PXXPXXXPPPXP 959 P L PP P QPP P P P P PPP P Sbjct: 856 PSVLQPPLQPQSQPPEPPPEMMPPPPQALPPPLP 889 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PPP PP P P PPP P Sbjct: 870 PEPPPEMMPPPPQALPPPLPHSHPPLVPPPPFSP 903 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +1 Query: 562 SGLXPXXPAPXPXXPX----PAXAXPPXPKXPXPXXPPPXS 672 SG P P P P P P PP P P PPP S Sbjct: 750 SGTPPCVPIPAPGQPAVPATPTSQIPPSPFVQQPIYPPPNS 790 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP---PPXXP 960 P P PP P P PP P PPP P PP P Sbjct: 862 PLQPQSQPPEPPPEMMPP-PPQALPPPLPHSHPPLVP 897 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +1 Query: 868 PIXXPPPPXPXXNPPXPXPXXPPPXP---PPXXP 960 P PP P PP P P PP P PP P Sbjct: 856 PSVLQPPLQPQSQPPEPPPEMMPPPPQALPPPLP 889 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P P P P PP P P PPP Sbjct: 869 PPEPPPEMMPPPPQALPPPLPHSHPPLVPPP 899 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 35.5 bits (78), Expect = 0.053 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG GG G GGG G G G G Sbjct: 52 GEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGG 89 Score = 35.1 bits (77), Expect = 0.070 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G + GGG GG G G GGG Sbjct: 47 GEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGG 89 Score = 34.7 bits (76), Expect = 0.093 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGG-GXGGXGDXGXXXGGXXXGGGA 829 G GGG G G GG GGG G GG G G GGG+ Sbjct: 30 GGNGGGSGKGQWLHGGGGEGGGGEGGGGEGGGGQKISKGGGGGGS 74 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G GG GGG GG GG GGG Sbjct: 35 GSGKGQWLHGGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGG 77 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GGG G G + G GGGG GG G Sbjct: 47 GEGGGGEGGGGEGGGGQKISKGGGGGG-SGGGQRSSSG 83 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G GG GG G G G GG GG Sbjct: 52 GEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGG 94 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 944 GXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G GGG G G G GGGG GG G Sbjct: 68 GGGGGGSGGGQRSSSGGGGGGGEGDGGGG 96 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXG 884 GG GG GG GGGG G G G Sbjct: 71 GGGSGGGQRSSSGGGGGGGEGDGGGG 96 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGG-----GXGGXGDXGXXXGGXXXGGG 832 GGG G G G GG GGG G GG G G GGG Sbjct: 45 GGGEGGG--GEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGG 87 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = -1 Query: 959 GXXGGGX----GGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GGG G G G GGGG G G G Sbjct: 57 GEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGGGG 96 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 671 EXGGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 E GGG G G G G G G G G G S G G Sbjct: 48 EGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGG 87 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXG-XGXXGG 881 GG GGG G GGGG G G GG Sbjct: 68 GGGGGGSGGGQRSSSGGGGGGGEGDGGG 95 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 35.1 bits (77), Expect = 0.070 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P SP PP PPP P P P P P P Sbjct: 85 PASPQPPPPPPIENLPPPPPPLPKFSPSP 113 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 900 PQPPPPXPPXXPXXXPPPXP 959 PQPPPP P PPP P Sbjct: 88 PQPPPPPPIENLPPPPPPLP 107 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXP 924 P P P PPI PPP P P P Sbjct: 88 PQPPPPPPIENLPPPPPPLPKFSPSP 113 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 35.1 bits (77), Expect = 0.070 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 894 PXPQPPPPXPPXXPXXXPPPXPP 962 P PQPPPP P PPP PP Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPPP 120 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXP 945 PP PPPP P N P P PPP P Sbjct: 98 PPPQPPPPPQPL-NLFSPPPPPPPPDP 123 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = +1 Query: 883 PPPXPXXNPPXPXPXX---PPPXPPPXXP 960 PPP P PP P P PPP PPP P Sbjct: 98 PPPQP---PPPPQPLNLFSPPPPPPPPDP 123 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 35.1 bits (77), Expect = 0.070 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PPP P PP P P PP P Sbjct: 298 PCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVP 331 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +1 Query: 844 VPXPXPX---PPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 +P P P PP PPP P PP P PPP P P Sbjct: 207 IPPPVPVYDPPPKKEVPPPVPVYKPP-PKVELPPPIPKKPCP 247 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP---XPPP 951 P P PP PPP P PP P PPP PPP Sbjct: 315 PTKKPCPPKKVDPPPVPVHKPP-PKIVIPPPKIEHPPP 351 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +1 Query: 844 VPXPXPX---PPIXXPPPPXPXXNPPXPXPXXPPPXP 945 VP P P PP PPP P +PP P PPP P Sbjct: 192 VPPPVPVYEPPPKKEIPPPVPVYDPP-PKKEVPPPVP 227 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P P PP PPP P PP P PPP P Sbjct: 245 PCP-PKPPKIEHPPPVPVYKPP-PKIEKPPPVP 275 Score = 31.5 bits (68), Expect = 0.86 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPX---PPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP PPP P PP P PPP P P Sbjct: 256 PPPVPVYKPPPKIEKPPPVPVYKPP-PKIEHPPPVPVHKLP 295 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P P PPP P PP P PPP P Sbjct: 181 PCPPKYSPPVEVPPPVPVYEPP-PKKEIPPPVP 212 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP--XPPP 951 P P PP P PP PP P PP PPP Sbjct: 308 PVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKIVIPPP 344 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +1 Query: 853 PXPXPPIXXPP--PPXPXXNPPXPXPXXPPPXPPP 951 P PPI P PP P PP P P P P P Sbjct: 365 PIYIPPIVKKPCPPPVPIYKPPVVIPKKPCPPPVP 399 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 VP P P + PPP PP P PP P P Sbjct: 226 VPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKP 264 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPP--PXPPXXPXXXPPP 953 P P PP P +PPP PP P PPP Sbjct: 248 PKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKPPP 281 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP---XPPP 951 V P P P PP P +PP PPP PPP Sbjct: 235 VELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPP 273 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P + PP P +PP P PPP P Sbjct: 298 PCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVP 331 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPP 953 P L P P PP PP P PPP Sbjct: 175 PPFLKKPCPPKYSPPVEVPPPVPVYEPPP 203 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/35 (37%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXP-PXXPXXXPPPXP 959 P P + PP P +PPP P PPP P Sbjct: 319 PCPPKKVDPPPVPVHKPPPKIVIPPPKIEHPPPVP 353 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 5/42 (11%) Frame = +2 Query: 851 PPXXXPXSPXPPXPP---PPXT--PPXPXPXXPXXXPPPXXP 961 PP P P PP P PP P P P P P P P Sbjct: 385 PPVVIPKKPCPPPVPVYKPPVVVIPKKPCPPLPQLPPLPKFP 426 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXP---PXXPXXXPPPXP 959 P P PP P + PPP P P PPP P Sbjct: 239 PPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVP 275 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 4/42 (9%) Frame = +1 Query: 847 PXPXPXPPIXXP----PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ P PPP P PP P P P P Sbjct: 379 PVPIYKPPVVIPKKPCPPPVPVYKPPVVVIPKKPCPPLPQLP 420 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +3 Query: 882 PPXXPXPQPPP--PXPPXXPXXXPPP 953 PP P +PPP PP P PPP Sbjct: 193 PPPVPVYEPPPKKEIPPPVPVYDPPP 218 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPP 663 P P P P P P PP PK P P PP Sbjct: 216 PPPKKEVPP-PVPVYKPPPKVELPPPIPKKPCPPKPP 251 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXP---XXPPPXPPPXXP 960 VP P P I PPP P P P PPP P P Sbjct: 274 VPVYKPPPKIEHPPPVPVHKLPKKPCPPKKVDPPPVPVHKPP 315 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPP 953 P P PP P P PP P PPP Sbjct: 328 PPVPVHKPPPKIVIPPPKIEHPPPVPVYKPPP 359 >At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / heat shock transcription factor 7 (HSTF7) identical to heat shock factor protein 7 (HSF7) SP:Q9T0D3 from [Arabidopsis thaliana] Length = 377 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG G G G G GGGG GG G G G Sbjct: 16 GGGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGGGG 50 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G GG G G G G GG G G G G Sbjct: 14 GVGGGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGG 48 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG G G GGGG GG G G Sbjct: 14 GVGGGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGGG 49 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXG 884 G GG G GG GG G G G G Sbjct: 25 GNSGGSSGCGAGGGGGGSGGGGGGGG 50 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 35.1 bits (77), Expect = 0.070 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -1 Query: 689 RGXPPXEXGGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 R PP GGG G G GG G G G G G G + G Sbjct: 55 RWAPPSSGGGGASGGGYRNDGGRTGYGYGAGGGGGGGGGWNNRSGG 100 Score = 34.7 bits (76), Expect = 0.093 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GGG G GG G G GG GG G G Sbjct: 572 GGGGGGGGGGSDYYGGGG-YGGGGYGGAPSGGYGAG 606 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGG 881 GG GGG GG GGGG G GG Sbjct: 576 GGGGGGSDYYGGGGYGGGGYGGAPSGG 602 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G G GGG GG G GG GGG Sbjct: 555 GGRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGGG 593 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 900 GGGGXGGXGDXGXXXGGXXXGGG 832 GGGG GG G GG GGG Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGG 594 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 GGG GG G G G GG GG G Sbjct: 63 GGGASGGGYRNDGGRTGYGYGAGGGGGGGGG 93 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 35.1 bits (77), Expect = 0.070 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -1 Query: 689 RGXPPXEXGGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 R PP GGG G G GG G G G G G G + G Sbjct: 55 RWAPPSSGGGGASGGGYRNDGGRTGYGYGAGGGGGGGGGWNNRSGG 100 Score = 34.7 bits (76), Expect = 0.093 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GGG G GG G G GG GG G G Sbjct: 572 GGGGGGGGGGSDYYGGGG-YGGGGYGGAPSGGYGAG 606 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGG 881 GG GGG GG GGGG G GG Sbjct: 576 GGGGGGSDYYGGGGYGGGGYGGAPSGG 602 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G G GGG GG G GG GGG Sbjct: 555 GGRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGGG 593 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 900 GGGGXGGXGDXGXXXGGXXXGGG 832 GGGG GG G GG GGG Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGG 594 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 GGG GG G G G GG GG G Sbjct: 63 GGGASGGGYRNDGGRTGYGYGAGGGGGGGGG 93 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GGG G G GGG G GG R G G Sbjct: 304 GGGGGGPNAGKKGNGGGGPMAGGVSGGFRPMGGGG 338 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G G GG G GG G GG GGG Sbjct: 256 GGKGAPAAGGGGAGGGKGAGGGAKGGPGNQNQGGGKNGGG 295 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGG 864 G GGG GGG G G GGGG GG Sbjct: 100 GKAGGG-GGGNNNNNKKGQKNGGGGGGGGGGG 130 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXG-GXGDXGXXXGGXXXGG 835 GG G G G GGGG G G G GG GG Sbjct: 288 GGGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGGGPMAGG 326 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGG----GXGGXGDXGXXXGGXXXGGG 832 GGG G G G G G G G G G G G GGG Sbjct: 264 GGGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGG 307 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 35.1 bits (77), Expect = 0.070 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 880 PPPPXPXXNPPXPXPXXPPPXPPPXXP 960 PPP P +PP P PPP PP P Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPSPP 118 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPP---XPPP 951 P P PP PPPP PP P P PP PPP Sbjct: 92 PPPSPPPPSPPPPSQAC-PPPPLPPSPPKKSYCPPP 126 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXP--PPPXTPPXPXPXXPXXXPPP 952 PP P SP PP PPP PP P P PPP Sbjct: 93 PPSPPPPSPPPPSQACPPPPLPPSP-PKKSYCPPPP 127 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P SPP PPPP PP P P PP Sbjct: 93 PPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPPP 127 Score = 33.1 bits (72), Expect = 0.28 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 + PP P P PPPP P PP P Sbjct: 91 IPPPSPPPPSPPPPSQACPPPPLPPSPP 118 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P P P PP PPP +PP PPP Sbjct: 97 PPPSPPPPSQACPPPPLPPSPPKKSYCPPPP 127 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXP----XXPPPXS 672 P P P P P+ A PP P P P PPP S Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPPPS 128 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +2 Query: 593 TPXAXTLPXQXPPXPXPXXPXR---PPPXPXGAP 685 TP +P PP P P P + PPP P P Sbjct: 85 TPCLQNIPPPSPPPPSPPPPSQACPPPPLPPSPP 118 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP P PP +PP P PP PP P Sbjct: 60 PHPHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAP 99 Score = 32.7 bits (71), Expect = 0.37 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXPP--PPXTPPXPXPXXPXXXPPPXXP 961 PP P SP P PP PP PP P P PP P Sbjct: 74 PPVKAPVSP-PAKPPVKPPVYPPTKAPVKPPTKPPVKPP 111 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXPP--PPXTPPXPXPXXPXXXPPPXXP 961 PP P P P PP PP +PP P P PP P Sbjct: 94 PPTKAPVKP-PTKPPVKPPVSPPAKPPVKPPVYPPTKAP 131 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP+ P PP P PP P PP PP P Sbjct: 106 PPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPP 143 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXPP--PPXTPPXPXPXXPXXXPPPXXP 961 PP P P P PP PP +PP P P PP P Sbjct: 166 PPTKAPVKP-PTKPPVKPPVSPPAKPPVKPPVYPPTKAP 203 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP+ P PP P PP P PP PP P Sbjct: 178 PPVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSPPTKPP 215 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPP---PXPPPXXP 960 P PP P P P +PP P PP P PP P Sbjct: 50 PHPPHHHHPHPHPHPHPPAKSPVKPPVKAPVSPPAKP 86 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P PP P PP P PP PP P Sbjct: 90 PPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPP 127 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P PP P PP P PP PP P Sbjct: 162 PPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPP 199 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXPP--PPXTPPXPXPXXPXXXPPPXXP 961 PP P P P PP PP PP P P PP P Sbjct: 146 PPTKAPVKP-PTKPPVKPPVYPPTKAPVKPPTKPPVKPP 183 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP+ P PP P PP P P PP P Sbjct: 102 PPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPP 139 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P+ P PP P PP P PP PP P Sbjct: 126 PPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPP 163 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP+ P PP P PP P P PP P Sbjct: 174 PPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSPP 211 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXP-PPPXTPPXPXPXXPXXXPPPXXP 961 PP P P P PP PP P P PP P Sbjct: 86 PPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPP 123 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 5/42 (11%) Frame = +2 Query: 851 PPXXXPXSP--XPPXPPP---PXTPPXPXPXXPXXXPPPXXP 961 PP P P PP PP P PP P P PP P Sbjct: 110 PPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAP 151 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXP-PPPXTPPXPXPXXPXXXPPPXXP 961 PP P P P PP PP P P PP P Sbjct: 158 PPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPP 195 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +3 Query: 858 PXXPXXLSPPXXPX---PQPPPPXPPXXPXXXPPPXPP 962 P + PP P P PP PP P PP PP Sbjct: 186 PPAKPPVKPPVYPPTKAPVKPPVSPPTKPPVTPPVYPP 223 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P PP P P P PP PP P Sbjct: 182 PPVSPPAKPPVKPPVYPPTKAPVKPPVSPPTKPPVTPP 219 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P PP PP P PP PP P Sbjct: 58 PHPHPHPH----PPAKSPVKPPVKAPVSPPAKPPVKPP 91 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXPP--PPXTPPXPXPXXPXXXPPPXXP 961 PP P P P PP P PP P P PP P Sbjct: 82 PPAKPPVKP-PVYPPTKAPVKPPTKPPVKPPVSPPAKPP 119 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P PP P P P PP PP P Sbjct: 110 PPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPP 147 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P PP P PP P P PP P Sbjct: 122 PPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPP 159 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P PP P PP P P PP P Sbjct: 142 PPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPP 179 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXPP--PPXTPPXPXPXXPXXXPPPXXP 961 PP P P P PP P PP P P PP P Sbjct: 154 PPTKPPVKP-PVYPPTKAPVKPPTKPPVKPPVSPPAKPP 191 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 35.1 bits (77), Expect = 0.070 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 + P P P PPPP P PPP PP Sbjct: 237 VKPDPTPPPPPPPPIPVKQSATPPPPPPP 265 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 6/37 (16%) Frame = +1 Query: 847 PXPXPXPPI------XXPPPPXPXXNPPXPXPXXPPP 939 P P P PPI PPPP P P P PPP Sbjct: 243 PPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 32.7 bits (71), Expect = 0.37 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 9/44 (20%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPP---------PXPPP 951 P P P PP PPPP P P P PP P PPP Sbjct: 239 PDPTPPPP---PPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +3 Query: 867 PXXLSPPXXPXPQ---PPPPXPPXXPXXXPPPXPP 962 P PP P Q PPPP PP P P PP Sbjct: 243 PPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPP 277 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 6/44 (13%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPP------PXPPPXXP 960 P P P PPPP P P P PP P PPP P Sbjct: 241 PTPPPP-----PPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 6/40 (15%) Frame = +2 Query: 851 PPXXXPXSPXPPXP------PPPXTPPXPXPXXPXXXPPP 952 P P P PP P PPP PP P PPP Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPP 278 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 35.1 bits (77), Expect = 0.070 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXG-GGGXGGXGDXGXXXGGXXXGGG 832 G G G G G G GGV G GGG G G G G GGG Sbjct: 135 GVGGLGGVGGLGGAGLGGVGGVGGGIGKAGGIGGLGGLGGAGGG 178 Score = 35.1 bits (77), Expect = 0.070 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G G GGV G G GG G G GG GG Sbjct: 164 GGIGGLGGLGGAGGGLGGVGGLGKAGGIGVGGGIGGGHGVVGG 206 Score = 34.7 bits (76), Expect = 0.093 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G G GG+ GG GG G G GG GG Sbjct: 143 GGLGGAGLGGVGGVG-GGIGKAGGIGGLGGLGGAGGGLGGVGG 184 Score = 34.7 bits (76), Expect = 0.093 Identities = 20/44 (45%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXG-GGGXGGXGDXGXXXGGXXXGGG 832 G GGG G GG+ G GGG GG G G GG GGG Sbjct: 154 GGVGGGIGKAGGIGGLGGLGGAGGGLGGVGGLG-KAGGIGVGGG 196 Score = 33.5 bits (73), Expect = 0.21 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 4/42 (9%) Frame = -1 Query: 959 GXXGGGXGG-GXXGXGXGGLXX--GXGGGGXXX-GGXGXGXG 846 G GGG GG G G G GGL G GG G GG G G G Sbjct: 120 GGVGGGVGGLGGVGGGVGGLGGVGGLGGAGLGGVGGVGGGIG 161 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G GG+ G GG GG G GG GG Sbjct: 149 GLGGVGGVGGGIGKA-GGIGGLGGLGGAGGGLGGVGGLGKAGG 190 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 34.7 bits (76), Expect = 0.093 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +1 Query: 883 PPPXPXXNPPXPXPXXPPPXPP 948 PPP P +PP P PPP PP Sbjct: 37 PPPPPVYSPPISPPPPPPPPPP 58 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXP---XXXPPPXPP 962 P P SPP P P PPPP P PP PP Sbjct: 37 PPPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPP 74 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 34.7 bits (76), Expect = 0.093 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXP---XXPPPXPP 948 P P P PP PPP P P P P PPP P Sbjct: 1134 PSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAP 1170 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P +PP P P P PPP P Sbjct: 1119 PSFPAGSPPLPHESPPSPPPQPPSSPPPPSSP 1150 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 5/38 (13%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPX--PXPXXPP---PXPPP 951 P PP+ PP P PP P P PP P PPP Sbjct: 1122 PAGSPPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPP 1159 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 6/44 (13%) Frame = +1 Query: 847 PXPXPXPPIXXPPP---PXPXXNPPXPXPXXPPP---XPPPXXP 960 P P PP P P P P +PP P PP PPP P Sbjct: 1127 PLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAP 1170 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = +3 Query: 879 SPPXXPXPQPP-PPXPPXXPXXXPPPXPP 962 SPP P PQPP P PP P P PP Sbjct: 1132 SPPSPP-PQPPSSPPPPSSPPQLAPAPPP 1159 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 611 LPXQXPPXPXPXXPXRPPPXPXGAP 685 LP + PP P P P PPP P P Sbjct: 1128 LPHESPPSPPPQPPSSPPP-PSSPP 1151 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P P P P PP P P P P P Sbjct: 1126 PPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPP 1159 >At4g39680.1 68417.m05614 SAP domain-containing protein contains Pfam domain PF02037: SAP domain Length = 633 Score = 34.7 bits (76), Expect = 0.093 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP PPPP P PP P P PPP P Sbjct: 560 PPTALPPPP-PLAKPPHVVERLPLPPPPPIAP 590 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPP 953 P P PP P PP PP P PP Sbjct: 565 PPPPPLAKPPHVVERLPLPPPPPIAPEEQEPP 596 >At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1 predicted transmembrane domain; Length = 175 Score = 34.7 bits (76), Expect = 0.093 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 GGG G G G GG G GGGG GG G Sbjct: 144 GGGSHGHGCGGGGGGGGGGLGGGGCGGGGCG 174 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -1 Query: 938 GGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG G G GG G GGGG GG G G G Sbjct: 144 GGGSHGHGCGG---GGGGGGGGLGGGGCGGG 171 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXG 573 GGG G G G GG G G G G G G Sbjct: 144 GGGSHGHGCGGGGGGGGGGLGGGGCGGGGCG 174 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXG 867 G G G GGG G G GGL G GGG G Sbjct: 146 GSHGHGCGGGGGG-GGGGLGGGGCGGGGCGG 175 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 952 GGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG G GG GGGG G G GG G G Sbjct: 145 GGSHGHGCGGGGGGGGGGLG-GGGCGGGGCGG 175 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXG 899 GG GGG G GG GGGG G Sbjct: 155 GGGGGGGGLGG-GGCGGGGCG 174 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 34.7 bits (76), Expect = 0.093 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPP-IXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P + P PP P P P PPP PPP P Sbjct: 40 PPVDPSPSSVHRPYPPPPPLPDFAPQPLLPPPSPPPPPP 78 >At2g11005.1 68415.m01177 glycine-rich protein Length = 170 Score = 34.7 bits (76), Expect = 0.093 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -3 Query: 924 GXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G G GG GGGG G G GG GGG+ Sbjct: 11 GSGDGGGSGGGGGSGDGSGSGDGGGSGDGGGS 42 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GG G G G G GGG G G G GGG+ Sbjct: 13 GDGGGSGGGGGSGDGSGSGDGGGSGDGGGSRDSDGSGDSSGGGS 56 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G G GGG G G G G G GG G G Sbjct: 11 GSGDGGGSGGGGGSGDGSGSGDGGGSGDGGG 41 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -1 Query: 938 GGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 G G G GG G G G GG G G G+ Sbjct: 11 GSGDGGGSGGGGGSGDGSGSGDGGGSGDGGGS 42 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 G GG GG G G G G GGG GG G+ Sbjct: 11 GSGDGGGSGGGGGSGDGS-GSGDGGGSGDGGGSRDSDGS 48 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G G GGG G GG GG Sbjct: 19 GGGGGSGDGSGSGDGGGSGDGGGSRDSDGSGDSSGGGSGDSGG 61 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +1 Query: 868 PIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P+ PPPP P + P P P PP PPP Sbjct: 219 PLQPPPPPPP--SQPLPRPLLLPPPPPP 244 Score = 34.7 bits (76), Expect = 0.093 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 885 PXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P PPP P P PPP PP Sbjct: 219 PLQPPPPPPPSQPLPRPLLLPPPPPP 244 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 34.3 bits (75), Expect = 0.12 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXP 919 P SP PP PPPP PP P Sbjct: 68 PPSPSPPPPPPPRPPPPP 85 Score = 32.7 bits (71), Expect = 0.37 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 9/47 (19%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXP---------XPXXPPPXPPPXXP 960 P P P PP PPPP + P PPP PPP P Sbjct: 71 PSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPP 117 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 904 NPPXPXPXXPPPXPPPXXP 960 NPP P P PPP PP P Sbjct: 67 NPPSPSPPPPPPPRPPPPP 85 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPP 913 PP P P PP PPPP P Sbjct: 68 PPSPSPPPPPPPRPPPPPLSP 88 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 13/48 (27%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXP-------------XXNPPXPXPXXPPPXPPP 951 P P P PP PPP P + P P PPP PPP Sbjct: 69 PSPSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPP 116 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +2 Query: 872 SPXPPXPPPPXTPPXPXP----XXPXXXPPP 952 S PP PPPP PP P P PPP Sbjct: 102 SVLPPPPPPPPPPPPPSSTWDFWDPFIPPPP 132 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXP 935 +PP P PPPP PP P Sbjct: 67 NPPSPSPPPPPPPRPPPPP 85 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 894 PXPQPPPPXPPXXPXXXPPPXPP 962 P P PPPP PP PPP P Sbjct: 69 PSPSPPPPPPPR---PPPPPLSP 88 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P PP PPPP P P PPP Sbjct: 105 PPPPPPPPPPPPPSSTWDFWDPFIPPP 131 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P SP PP P T P P P PPP P Sbjct: 35 PPTTTPSSP-PPSPSTNSTSPPPSSPLPPSLPPPSPP 70 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP-XPPPXXP 960 P P PP PP P PP P P P P P P Sbjct: 55 PPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSP 93 Score = 32.3 bits (70), Expect = 0.49 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 909 PPPXPPXXPXXXPPPXPP 962 PPP PP P PPP PP Sbjct: 217 PPPKPPSPPRKPPPPPPP 234 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXP-XPXXPXXXPP 949 P P +P P PP P TP P P P PP Sbjct: 78 PQPSPSAPITPSPPSPTTPSNPRSPPSPNQGPP 110 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP PPP + P P P PPP P Sbjct: 28 PPAASSPPPTTTPSSPPPSPSTNSTSPPPSSP 59 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 4/38 (10%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPP--XTP--PXPXPXXPXXXPPP 952 PP P P P P PP TP P P P P PP Sbjct: 54 PPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPP 91 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 900 PQPPPPXPPXXPXXXPPPXPP 962 P P PP PP P PPP PP Sbjct: 217 PPPKPPSPPRKP--PPPPPPP 235 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P L P P P P P PP P P PP G P Sbjct: 70 PGSLTP--PLPQPSPSAPITPSPPSPTTPSNPRSPPSPNQGPP 110 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P PPP PP P PPP P Sbjct: 15 PPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSP 47 Score = 28.7 bits (61), Expect = 6.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 895 PXXNPPXPXPXXPPPXPPP 951 P PP P PPP PPP Sbjct: 217 PPPKPPSPPRKPPPPPPPP 235 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 844 VPXPXPXPPI-XXPPPPXPXXNP-PXPXPXXPPPXPP 948 +P P P PI PP P NP P P PP P Sbjct: 77 LPQPSPSAPITPSPPSPTTPSNPRSPPSPNQGPPNTP 113 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGG 864 G GG GG G G GG G GGGG GG Sbjct: 207 GMASGGGGGLGGGNGSGGGGGGGGGGGRISGG 238 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -3 Query: 933 GXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G G GG+ GG G GG G G GG GG + Sbjct: 207 GMASGGGGGLGGGNGSGG-GGGGGGGGGRISGGSS 240 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGG 905 GG GGG G GG GGGG Sbjct: 214 GGLGGGNGSGGGGGGGGGG 232 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 932 GXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G G GGL G G GG GG G G Sbjct: 207 GMASGGGGGLGGGNGSGGGGGGGGGGG 233 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGG 880 GGG G G G GG GGGG GG Sbjct: 212 GGGGLGGGNGSGGGG--GGGGGGG 233 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GG G G GG GG Sbjct: 113 GYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGG 155 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG GG G G G GGG GG G G G Sbjct: 111 GGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGG 145 Score = 32.7 bits (71), Expect = 0.37 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = -3 Query: 960 GXXGGGXXXGXXGX--GXGGVXGGGGX--GGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GGGG G G GG GGG Sbjct: 94 GHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGG 140 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G GGG G GG GGGG GG G G Sbjct: 103 GGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGG 140 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GGG GG G GG GGGG G G G Sbjct: 94 GHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 129 Score = 31.9 bits (69), Expect = 0.65 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGG--VXGGGG--XGGXGDXGXXXGGXXXGGG 832 G GGG G G GG GGGG GG G GG GGG Sbjct: 88 GSGGGGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGG 134 Score = 31.9 bits (69), Expect = 0.65 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGG----GGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G GG GG GG G GG GGG Sbjct: 99 GSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGG 145 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 GGG GG G GG G GGG GG G Sbjct: 127 GGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 157 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = -3 Query: 951 GGGXXXGXXG----XGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G G GG GGG G G G GG G G Sbjct: 111 GGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSG 154 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGG-GXXXGGXGXGXG 846 G G GGG G G G GGG G GG G G G Sbjct: 120 GYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 158 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 665 GGGXXGXGXLGXGGXAXAGXGXXGXGAGXXGXSPEGRG 552 GGG G G G GG G G G G G S G G Sbjct: 92 GGGHRGGGSYGGGGGRREGGG--GYSGGGGGYSSRGGG 127 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -3 Query: 951 GGGXXX-GXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G GG GG G G G GG GGG Sbjct: 118 GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 158 Score = 28.3 bits (60), Expect = 8.0 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 6/44 (13%) Frame = -1 Query: 959 GXXGGGXG----GGXXGXGXGGLXXGXGG--GGXXXGGXGXGXG 846 G GGG G GG G GG G GG GG G G G G Sbjct: 113 GYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 156 >At2g05530.1 68415.m00585 glycine-rich protein Length = 115 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXG 865 G GGG G G GG GGGG G G G Sbjct: 50 GYNGGGGYNGGGGHNGGGYNGGGGYNGGGHGG 81 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G GG GGGG G G G GG GGG Sbjct: 43 GGHGGNGGYNGGGGYNGGGGHNGGGYNG---GGGYNGGG 78 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGX-GGGGXXXGGXGXGXG 846 G GG GGG G G G GGGG GG G G Sbjct: 46 GGNGGYNGGGGYNGGGGHNGGGYNGGGGYNGGGHGGRHG 84 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGG-XGGXGDXGXXXGG 850 G G G G G GG GGG GG G G GG Sbjct: 44 GHGGNGGYNGGGGYNGGGGHNGGGYNGGGGYNGGGHGG 81 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXG--GGGXXXGGXGXGXG 846 GG GG G GG G G GGG GG G G Sbjct: 43 GGHGGNGGYNGGGGYNGGGGHNGGGYNGGGGYNGGG 78 >At1g48100.1 68414.m05368 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to polygalacturonase PG1 GI:5669846, PG2 GI:5669848 from [Glycine max]; contains PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 475 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP PPPP NPP P P P P P Sbjct: 41 PLPP--PPPPPLETANPPDQVPSDPYPSPDP 69 >At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative similar to SP|O94761 ATP-dependent DNA helicase Q4 (RecQ4) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 911 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PPP P P P P PPP P P Sbjct: 51 PKAPTHPPPNPSQEAPVPSPYPPPPPPSP 79 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P PP P P P P PPP P Sbjct: 51 PKAPTHPPPNPSQEAPVPSPYPPPPPPSP 79 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G GG GG GG G G GGG Sbjct: 153 GGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGG 195 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GG G G GG G G GG GG G G Sbjct: 165 GGASGGASGGASGGGPGG-ASGGGPGGASGGGPGGASG 201 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G G G GG GG G G G GGG Sbjct: 140 GGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGG 179 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGG--GGXGGXGDXGXXXGGXXXGGG 832 G GG G G GG GG GG G G G GG G Sbjct: 157 GGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASG 201 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GG G G GG GG G G G GGG Sbjct: 145 GGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGG 187 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGG-GXGGXGDXGXXXGG 850 G GG G G G GG GGG G G G GG Sbjct: 165 GGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGG 202 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGG--GGXGGXGDXGXXXGGXXXGGG 832 G GG G G GG GG GG G G G GG G Sbjct: 149 GGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASG 193 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GG G G GG GG GG G G GG + Sbjct: 161 GGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGGAS 204 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G GG GGG G GG GGG G G Sbjct: 170 GASGGASGGGPGGASGGGPGGASGGGPGGASGGASG 205 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GG G G GG GG G G G GG + Sbjct: 141 GDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGAS 184 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G GG G G GG GG G GD G GG Sbjct: 177 GGGPGGASGGGPGGASGGGPGGASGGASGDKPEGAPGDKPGG 218 >At4g29240.1 68417.m04182 leucine-rich repeat family protein / extensin family protein contains Pfam PF00560: Leucine Rich Repeat domains; similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana] Length = 415 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXGXXGGXRXXG 866 G GGG G GG GGGG G GG G Sbjct: 31 GVGGGVGVGIGGGGGGGGGGVWVGGGYNNGG 61 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGG 864 GGG G G G G GG GGG GG Sbjct: 33 GGGVGVGIGGGGGGGGGGVWVGGGYNNGG 61 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G GGG G G GG+ G GGGG G G G Sbjct: 340 GGMPAGMGGGMPGMG-GGMPAGMGGGGMPGAGGGMPGG 376 Score = 29.9 bits (64), Expect = 2.6 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGG--GGXGGXGDXGXXXGGXXXGGG 832 G GGG G G G G+ GG G GG G G GG GGG Sbjct: 336 GGMGGGMPAG-MGGGMPGMGGGMPAGMGGGGMPG-AGGGMPGGGG 378 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G GG+ GG G G G GG GG Sbjct: 290 GGGFPGGMPGGFPGGMPGGFPGGMGGMPGGFPGGMGGMGG 329 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGGGGXXXGG 864 GG GG G GG+ G GGG GG Sbjct: 328 GGMPGGFPGGMGGGMPAGMGGGMPGMGG 355 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGG--GGXGGXGDXGXXXGGXXXGG 835 G GG G G G GG+ GG GG GG G G GG Sbjct: 299 GGFPGGMPGGFPG-GMGGMPGGFPGGMGGMGGMPGGFPGGMGGG 341 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGG 864 GGG G G G G G GGG GG Sbjct: 354 GGGMPAGMGGGGMPGAGGGMPGGGGMPGG 382 >At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical to cDNA glycine-rich protein 3 short isoform (GRP3S) GI:4206766 Length = 116 Score = 33.9 bits (74), Expect = 0.16 Identities = 20/44 (45%), Positives = 21/44 (47%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GGG G G G GG GGGG G G GG GGG+ Sbjct: 45 GDNGGGRYQG--GGGHGG-HGGGGYQGGGGRYQGGGGRQGGGGS 85 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 933 GXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G GGGG GG G G GG GG Sbjct: 43 GFGDNGGGRYQGGGGHGGHGGGGYQGGGGRYQGG 76 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG G G GG G GGG GG G G Sbjct: 41 GGGFGDNGGGRYQGGGGHGGHGGGGYQGGGGRYQG 75 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP P +PP P P PPP P Sbjct: 236 PTPPPPPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPPP 273 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPP 949 PP P P P PP P TPP P P PP Sbjct: 131 PPSPSPPMPDTPNPPTPKTPPDVVP--PIWEPP 161 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 853 PXPXPPIXXPP-PPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ P PP P P P PP PP P Sbjct: 132 PSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFP 168 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXP--PPPXTPPXPXPXXPXXXPPPXXP 961 P P SP PP P P P TP P P PP P Sbjct: 126 PEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPP 164 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQ-PPPPXP-PXXPXXXPPPXP 959 P P L PP P P+ P PP P P P PP P Sbjct: 112 PSDPPPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTP 147 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +1 Query: 847 PXPX-PXPPIXXPPPPX--PXXNPPXPXPXXPPPXPPP 951 P P P PP PP P PP P PP PPP Sbjct: 137 PMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPPP 174 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P +P P P PP +P P P P P P Sbjct: 116 PPLGPPQTPGPEFPVPP-SPSPPMPDTPNPPTPKTPP 151 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P + PP P+PP PP P P PP Sbjct: 147 PKTPPDVVPPIWEPPRPPDIFPPESPPPGIDPPPP 181 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXP--PPPXTPPXPXPXXPXXXPPPXXP 961 P P +P PP P PP PP P P PP P Sbjct: 134 PSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESP 172 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PPI PP P P P P PP P Sbjct: 151 PDVVPPIWEPPRPPDIFPPESPPPGIDPPPP 181 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAPX-PXXPXPAXAXPPXPKXPXPXXPP 663 P P G P P P P P P+ P P P P PP Sbjct: 115 PPPLG-PPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPP 151 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P P PP P PP P P P P P P Sbjct: 121 PQTPGPEFPVPPSPSPPM-PDTPNPPTPKTPPDVVPP 156 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPP 663 P P P+P P P P PP PK P PP Sbjct: 124 PGPEFPVPPSPSP--PMPDTPNPPTPKTPPDVVPP 156 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P +P P PP PP P PP PP Sbjct: 139 PDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPP 173 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXP-PPXPPPXXP 960 P P P P P P P P P PP P P P Sbjct: 101 PSETPPEVTTVPSDPPPLGPPQTPGPEFPVPPSPSPPMP 139 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +1 Query: 574 PXXPAPX--PXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P P P P P PP P P P P P + P Sbjct: 112 PSDPPPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPP 151 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXN-PPXPXPXXPPPXPPP 951 P PP+ P P P PP P P P PP Sbjct: 112 PSDPPPLGPPQTPGPEFPVPPSPSPPMPDTPNPP 145 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 VP P P PP P P PP PPP PPP Sbjct: 21 VPLPPPPPPPMRRSAPSP---PPMSGRVPPPPPPPP 53 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +2 Query: 875 PXPPXPPPP--XTPPXPXPXXPXXXPPPXXP 961 P PP PPPP + P P P PPP P Sbjct: 22 PLPPPPPPPMRRSAPSPPPMSGRVPPPPPPP 52 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 906 PPPPXPPXXPXXXPPPXPP 962 P PP PP P PPP PP Sbjct: 148 PLPPPPPPMPRRSPPPPPP 166 Score = 30.7 bits (66), Expect = 1.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 868 PIXXPPPPXPXXNPPXPXP 924 P+ PPPP P +PP P P Sbjct: 148 PLPPPPPPMPRRSPPPPPP 166 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP+ P P + P P PPP P Sbjct: 25 PPPPPPMRRSAPSPPPMSGRVPPPPPPPPMFDP 57 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 894 PXPQPPPPXPPXXPXXXPPPXP 959 P P PPPP P P PPP P Sbjct: 148 PLPPPPPPMPRRSP---PPPPP 166 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/39 (35%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXP-KXPXPXXPPP 666 P G P P P P A + PP + P P PPP Sbjct: 15 PPMRGRVPLPPPPPPPMRRSAPSPPPMSGRVPPPPPPPP 53 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 880 PPPPXPXXNPPXPXPXXPPPXPPP 951 PPPP P PP P P P PP Sbjct: 107 PPPPPPKPQPPPPPPRSQKPMQPP 130 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXP 924 P P PP PPPP P P P Sbjct: 107 PPPPPPKPQPPPPPPRSQKPMQPP 130 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 885 PXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P PP P PP P P P Sbjct: 104 PKRPPPPPPKPQPPPPPPRSQKPMQP 129 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 + P P P P P PP P P PP Sbjct: 102 VKPKRPPPPPPKPQPPPPPPRSQKPMQPP 130 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXP 946 P P PP P P PP P P P Sbjct: 104 PKRPPPPPPKPQPPPPPPRSQKPMQPP 130 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGG 864 GGG GGG G G G G GGG GG Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGGPPRGG 87 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGG 881 GG GGG G G GGGG G G G Sbjct: 60 GGMGGGGGGGGGSGGGGGGRGGGPPRG 86 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 952 GGGXXXGXXGGXGGGGXGXGXXGGXRXXG 866 GGG G GG G GG G G GG G Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGGPPRGG 87 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGG 879 G GGG GGG G G GG G GG Sbjct: 61 GMGGGGGGGGGSGGGGGGRGGGPPRGG 87 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/28 (50%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Frame = -3 Query: 912 GGVXGGGGXGG--XGDXGXXXGGXXXGG 835 GG+ GGGG GG G G GG GG Sbjct: 60 GGMGGGGGGGGGSGGGGGGRGGGPPRGG 87 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGG 881 G GGG G GG GGG G GG Sbjct: 61 GMGGGGGGGGGSGGGGGGRGGGPPRGG 87 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXR 875 GG GGG G GG GGG G R Sbjct: 64 GGGGGGGGSGGGGGGRGGGPPRGGLDNVR 92 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 853 PXPXPP-IXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPPP P +PP P P P PP P Sbjct: 80 PIPSTPSTPSPPPPAPKKSPPPPTP-KKSPSPPSLTP 115 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXP--XPXXPPPXP 945 P P P P PPPP P +P P P P P P Sbjct: 88 PSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTP 122 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P +P P PPPP P P P P P Sbjct: 77 PSTPIPSTPSTPSPPPPAPKKSPPPPTPKKSPSP 110 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +1 Query: 847 PXPXPXPPIXXP--PPPXPXXNP-PXPXPXXPPPXP 945 P P PP P P P P +P P P P PPP P Sbjct: 104 PKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAP 139 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPP P PP P P PP P Sbjct: 118 PHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTP 153 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNP--PXPXPXXPPPXPP 948 P P P P + P P P P P P PP PP Sbjct: 126 PSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPPP 161 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 872 SPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 SP P P P T P P P P PPP P Sbjct: 76 SPSTPIPSTPST-PSPPPPAPKKSPPPPTP 104 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +2 Query: 587 RPTPXAXTLPXQXPPXPX--PXXPXRPPPXPXGAPP 688 + +P P PP P P P PPP P +PP Sbjct: 123 KKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPP 158 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +3 Query: 867 PXXLSPPXXPXPQP-PPPXPPXXPXXXPPPXP 959 P PP P P P PP P PPP P Sbjct: 130 PTPSLPPPAPKKSPSTPSLPPPTPKKSPPPPP 161 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P P P P TP P P PPP Sbjct: 128 PPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPP 160 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 L PP P P P PP PPP PP Sbjct: 229 LPPPPPPPPHQAQPPPPPPSGLFPPPPPP 257 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP PPPP PP P PP PPP Sbjct: 230 PPPP---PPPPHQAQPPPPPPSGLFPPPPPP 257 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 583 PAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGG 681 P P P P A PP P P PPP + G Sbjct: 230 PPPPPPPPHQAQPPPPPPSGLFPPPPPPMANNG 262 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +1 Query: 844 VPXPXPXPP--IXXPPPPXPXXNPPXPXP 924 +P P P PP PPPP PP P P Sbjct: 229 LPPPPPPPPHQAQPPPPPPSGLFPPPPPP 257 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 VP P PP PPP P +P P PP P Sbjct: 178 VPVISPDPPATLPPPKVPVISPDPPTTLPPPLVP 211 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P SP PP PP P P P PPP P Sbjct: 176 PKVPVISPDPPATLPPPKVPVISPDPPTTLPPPLVP 211 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +2 Query: 854 PXXXPXSPXPPXP--PPPXTPPXPXPXXPXXXPPP 952 P P P P P PPP P P P P P P Sbjct: 151 PPTAPVMPPPQVPVMPPPQVPVKPHPKVPVISPDP 185 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P P P PPP P P P P P P P Sbjct: 144 PSSFCPKPPTAPVMPPPQVPVMPPPQVP-VKPHPKVP 179 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXPP--PPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P+ PP P P P P P PPP P Sbjct: 158 PPPQVPVMPPPQVPVKPHPKVPVISPDPPATLPPPKVP 195 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXN-PPXPXPXXPPPXPPPXXP 960 VP P PP PPP P N PP P P P P Sbjct: 194 VPVISPDPPTTLPPPLVPVINLPPVTSPPQFKLPPLPQIP 233 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P P PP P P P P PPP P Sbjct: 141 PVQPSSFCPKPPTAPVMPPPQVP-VMPPPQVP 171 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P+ P PP P P PP PP Sbjct: 190 PPPKVPVISPDPPTTLPPPLVPVINLPPVTSPP 222 >At1g11850.1 68414.m01363 expressed protein Length = 93 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = -1 Query: 950 GGGXGGGXXGXGXG-GLXXGXG-GGGXXXGGXGXGXG 846 GGG G G G G G G G G GGG GG G G G Sbjct: 54 GGGAGLGGLGIGAGIGAGAGLGLGGGGFGGGAGGGLG 90 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXG-GXG---DXGXXXGGXXXGGGA 829 GGG G G GG G GG G G G G GG GGGA Sbjct: 41 GGGGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGFGGGA 85 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -3 Query: 951 GGGXXXGXXGXGXG-GVXGGGGXGGXGDXGXXXGG 850 GGG G G G G G G G GG G G GG Sbjct: 54 GGGAGLGGLGIGAGIGAGAGLGLGGGGFGGGAGGG 88 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXGXXGG 881 G G G G G GGGG G G GG Sbjct: 63 GIGAGIGAGAGLGLGGGGFGGGAGGG 88 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGX-GXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G G G G G G GG+ G G G G GG G G Sbjct: 43 GGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGFGGGAG 86 >At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; glycine-rich protein 14 (GRP14) PMID:11431566; PIR:JQ1063 Length = 193 Score = 33.1 bits (72), Expect = 0.28 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG GGG G GGL GGGG G G G G Sbjct: 115 GGGLGGGGLPGGLGGL----GGGGLPGGLGGLGGG 145 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGG--XGXGXXGG 881 GG GGG G GG GGGG G G GG Sbjct: 116 GGLGGGGLPGGLGGLGGGGLPGGLGGLGG 144 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGG 879 G GGG GG G G GGL G GG G Sbjct: 117 GLGGGGLPGGLGGLGGGGLPGGLGGLG 143 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXG 865 GGG G G GG+ GGG GG G G Sbjct: 115 GGGLGGGGLPGGLGGLGGGGLPGGLGGLG 143 >At5g07190.1 68418.m00819 embryo-specific protein 3, putative similar to embryo-specific protein 3 GI:3335171 from [Arabidopsis thaliana] Length = 213 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXP 959 S P P P PP PP P PPP P Sbjct: 155 SSPDLPPPHFPPEFPPETPTTPPPPPP 181 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 875 PXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P PPP PP P P PPP Sbjct: 154 PSSPDLPPPHFPPEFPPETPTTPPPP 179 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 880 PPPPXPXXNPPXPXPXXPPPXPP 948 PPP P PP P PPP PP Sbjct: 160 PPPHFPPEFPP-ETPTTPPPPPP 181 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P PP P PP P P P P P P Sbjct: 47 PPSQPPTQPPTQPPSHPPTQPPTPPPSQSPSQPSPLPP 84 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P PP P PP P PP PP P Sbjct: 39 PSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSP 76 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 PP P P PP PP P PP PP Sbjct: 43 PPTQP-PSQPPTQPPTQPPSHPPTQPP 68 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +1 Query: 865 PPIXXP--PPPXPXXNPPXPXPXXPPPXPPPXXP 960 PP P PP P PP P PP PP P Sbjct: 27 PPSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPP 60 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +2 Query: 851 PPXXXPXSPX-PPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P P PP PP P P PP P Sbjct: 27 PPSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPP 64 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P PP P +PP P PPP P P Sbjct: 43 PPTQPPSQPPTQPPTQPPSHPP-TQPPTPPPSQSPSQP 79 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 33.1 bits (72), Expect = 0.28 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 Query: 872 SPXPPXPPPPXTPPXPXPXXPXXXPPP 952 +P PP PP +PP P P PPP Sbjct: 44 NPSPPPPPSNPSPPPPSPTTTACPPPP 70 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P P P P + PP PPP S GG P Sbjct: 40 PCQPNPSPPPPPSNPSPPPPSPTTTACPPPPSSSGGGP 77 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P PP PPP P PP P PP P Sbjct: 43 PNPSPP---PPPSNPSPPPPSPTTTACPPPP 70 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPP 950 P P PP P PPPP P PP Sbjct: 40 PCQPNPSPPPPPSNPSPPPPSPTTTACPPPP 70 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXP--XXXPPP 952 P P P PPPP + P P P P PPP Sbjct: 40 PCQPNPS-PPPPPSNPSPPPPSPTTTACPPP 69 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +1 Query: 853 PXPXPPIXXPPPPXP---XXNPPXPXPXXPPPXPPP 951 P P P + PPP P PP P PP PPP Sbjct: 45 PLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPP 80 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXP--XXPPPXPP 948 P P P PPPP +PP P P PP PP Sbjct: 55 PPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPP 90 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/36 (38%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +1 Query: 853 PXPXPPIXXPPPPXP---XXNPPXPXPXXPPPXPPP 951 P P P + PPP P +PP P P PPP Sbjct: 65 PPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPP 100 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +1 Query: 859 PXPPIXX---PPPPXPXXNPPXPXPXXPPPXPPP 951 P PP PPPP +PP P P PPP Sbjct: 87 PRPPYVYKSPPPPPFVYSSPPPPTYIYNSPPPPP 120 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +1 Query: 853 PXPXPPIXXPPPPXP---XXNPPXPXPXXPPPXPP 948 P P P + PP P P PP P PP PP Sbjct: 35 PPPQPYVYSPPLPSPYVYKSPPPSPYLYSSPPPPP 69 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXP 959 SPP P PP PP PPP P Sbjct: 54 SPPPSPYLYSSPPPPPYVYNSPPPPPP 80 >At3g08640.1 68416.m01003 alphavirus core protein family contains Pfam profile: PF00944 alphavirus core protein Length = 337 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 GG GGG G GG G GGGG GG G Sbjct: 61 GGGGGGSTGNNGGG--SGSGGGGGGFGGSG 88 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXG 874 GGG G G G G GGGG GG G Sbjct: 63 GGGGSTGNNGGGSGSGGGGGGFGGSG 88 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXG 884 GG GGG GG G GG G G G Sbjct: 61 GGGGGGSTGNNGGGSGSGGGGGGFGG 86 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXGXXGG 881 G GGG G GG G G G G GG Sbjct: 61 GGGGGGSTGNNGGGSGSGGGGGGFGG 86 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 948 GGXXXGXXGXGXGGVXGGGGXGGXGDXG 865 GG G G GG GGG GG G G Sbjct: 61 GGGGGGSTGNNGGGSGSGGGGGGFGGSG 88 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 881 PPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP PPPP TP P PPP P Sbjct: 193 PPPPPPPPTPRPPRLLSSQPAPPPTPP 219 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP P PP + P P P P P P Sbjct: 193 PPPPPPPPTPRPPRLLSSQPAPPPTPPVSLPSP 225 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +1 Query: 880 PPPPXPXXNPPX--PXPXXPPPXPPPXXP 960 PPPP P PP PPP PP P Sbjct: 195 PPPPPPTPRPPRLLSSQPAPPPTPPVSLP 223 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXP--XPXXPPPXPPPXXP 960 +P P P P + PPPP PP P PP PP P Sbjct: 26 IPNPNPNPSL-TPPPPQQHSQPPVAPLVPPGPPYAPPAQIP 65 >At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi domain-containing protein contains Pfam profiles PF02170: PAZ domain, PF02171: Piwi domain Length = 1194 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G G G G GGGG G G G G GGG Sbjct: 36 GGDGDRGYSGRGDGHGRGGGGDRGRGYSGRGDGRGRGGGG 75 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G G G G GGGG G G G G GGG Sbjct: 55 GGDRGRGYSGRGDGRGRGGGGDRGRGYSGRGDGHGRGGGG 94 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G G G GG G G G G GGG Sbjct: 17 GGGGDRGRGYSGRGDGRGRGGDGDRGYSGRGDGHGRGGGG 56 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 150 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 184 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 170 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 204 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 190 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 224 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 210 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 244 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 230 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 264 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 250 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 284 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 270 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 304 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 290 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 324 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 370 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 404 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 390 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 424 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 410 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 444 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 50 PPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPP 84 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 70 PPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPP 104 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 90 PPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPP 124 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 110 PPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPP 144 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 120 PPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPP 154 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 130 PPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPP 164 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 140 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 174 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 160 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 194 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 180 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 214 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 200 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 234 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 220 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 254 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 240 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 274 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 260 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 294 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 280 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 314 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 300 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 334 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 310 PPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPP 344 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 320 PPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPP 354 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 360 PPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 394 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 380 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 414 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 400 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 434 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 420 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPP 454 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 60 PPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPP 94 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 80 PPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPP 114 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 100 PPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPP 134 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +1 Query: 853 PXPXPPIXXPPPPXP--XXNPPXPXPXXPPPXPPP 951 P P P + PPP P +PP P P PPP Sbjct: 350 PPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPP 384 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +P P P PPP Sbjct: 430 PPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPP 464 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P P P P Sbjct: 330 PPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSP 364 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P PPPP +PP P PPP Sbjct: 340 PPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPP 374 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 33.1 bits (72), Expect = 0.28 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -3 Query: 951 GGGXXXGXXGXGX---GGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG G G G GG GGGG G G+ G G GGG Sbjct: 23 GGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGG 65 Score = 31.5 bits (68), Expect = 0.86 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G GGG G G G G + GGG G G G G GG Sbjct: 51 GEGGGGGGDGTKGGGDG-ISGGGHGDGLGCSGGGGDGTKGGG 91 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -3 Query: 951 GGGXXXGXXG-XGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G G GG GG G G GD G GG G G Sbjct: 39 GGGEGGGGEGTSGEGGGGGGDGTKGGGD-GISGGGHGDGLG 78 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 938 GGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 GGG G G G G GGGG G G G Sbjct: 39 GGGEGGGGEGTSGEGGGGGGDGTKGGGDG 67 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GG GG G G G GGG Sbjct: 41 GEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGG 83 Score = 29.1 bits (62), Expect = 4.6 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = -1 Query: 950 GGGXG----GGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG G GG G G G G GGGG G G G G Sbjct: 30 GGGEGKKKNGGGEGGGGEG-TSGEGGGGGGDGTKGGGDG 67 >At5g61660.1 68418.m07736 glycine-rich protein Length = 134 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXG 865 G GGG G G G G GGG GG G G Sbjct: 90 GSGGGGARGGGYGYGSGNGRSGGGGGGGGFNG 121 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGG 864 G GGG GG G G G G GGGG G Sbjct: 90 GSGGGGARGGGYGYGSGNGRSGGGGGGGGFNG 121 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G G G G G G GGGG GG G G G Sbjct: 72 GSGYGYGSGSGSGTGYGYGSGGGGARGGGYGYGSG 106 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 G G G G G GG G G G GG G G Sbjct: 86 GYGYGSGGGGARGGGYGYGSGNGRSGGGGGGGG 118 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXG-GLXXGXGGGGXXXGG 864 G G GGG G G G G G GGG GG Sbjct: 86 GYGYGSGGGGARGGGYGYGSGNGRSGGGGGGGG 118 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G G G G G GG GGG G G+ G GG GG Sbjct: 82 GSGTGYGY-GSGGGGARGGGYGYGSGN-GRSGGGGGGGG 118 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP+ PPP +PP P P PPP Sbjct: 77 PPPYEHPPVKYPPPIKTYPHPPVKYP-PPEQYPPP 110 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP--XPPP 951 P PP+ PPPP P P PPP PPP Sbjct: 226 PHPPVKYPPPPYKTY-PHPPIKTYPPPKECPPP 257 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPP--XPXPXXPPPXPPPXXP 960 P P PP PP P +PP P P P PP P Sbjct: 63 PPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYP 102 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PPI PPP PP P P PP Sbjct: 241 PHPPIKTYPPPKECPPPPEHYPWPPKKKYPP 271 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP P PP PP P P PP P Sbjct: 251 PKECPPPPEHYPWPPKKKYPPPVEYPSPPYKKYPPADP 288 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 4/38 (10%) Frame = +2 Query: 851 PPXXXPXSPXPPX---PPP-PXTPPXPXPXXPXXXPPP 952 PP P PP PPP PP P P PPP Sbjct: 53 PPKPPPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPP 90 >At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar to RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF00397: WW domain Length = 713 Score = 32.7 bits (71), Expect = 0.37 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -1 Query: 686 GXPPXEXGGGXXGXGXLGXGGXAXAGXGXXG-XGAGXXGXSPEGRG 552 G P GGG G G G GG +G G G G G G S GRG Sbjct: 621 GTPSSGGGGGRGGYGDSGYGGRGESGYGSRGDSGYGGRGDS-GGRG 665 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGG 850 GGG G GGGG GG GD G G Sbjct: 610 GGGGMNKFRRWGTPSSGGGGGRGGYGDSGYGGRG 643 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP+ PPP P P PPP P Sbjct: 32 PPPATPPPVATPPPVATPPPAATPAPATPPPAATP 66 Score = 31.5 bits (68), Expect = 0.86 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 872 SPXPPXPPPPXTPPXPXPXXPXXXPPP 952 +P P PPP TPP P PPP Sbjct: 25 APTPTATPPPATPPPVATPPPVATPPP 51 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPP---PXPXXNPPXPXPXXPPPXPPP 951 P P PP PPP P P PP P P PPP Sbjct: 26 PTPTATPPPATPPPVATPPPVATPP-PAATPAPATPPP 62 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 553 PRPSGLXPXXPA-PXPXXPXPAXAXPPXPKXPXPXXPPP 666 P P+ PA P P P A PP P P PPP Sbjct: 24 PAPTPTATPPPATPPPVATPPPVATPPPAATPAPATPPP 62 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P +P P PPP TPP P P P P Sbjct: 24 PAPTPTATPPPATPPPVATPPPVATPPPAATPAPATP 60 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 590 PTPXAXTLPXQXPPXPXPXXPXRPPPXPXGAP 685 PTP A P PP P PPP AP Sbjct: 26 PTPTATPPPATPPPVATPPPVATPPPAATPAP 57 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPX---SPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P +P P P P TPP P PP P Sbjct: 38 PPVATPPPVATPPPAATPAPATPPPAATPAPATTPPSVAP 77 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXPP-PPXTPPXPXPXXPXXXPPPXXP 961 PP P P P PP PP P P PPP P Sbjct: 584 PPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPPSTP 621 Score = 32.3 bits (70), Expect = 0.49 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 6/40 (15%) Frame = +1 Query: 847 PXPXPXPP-IXXPPPPXPXXN-----PPXPXPXXPPPXPP 948 P P PP I PPP P + PP P PPP PP Sbjct: 745 PPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPP 784 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 SPP P PP PP PPP PP Sbjct: 757 SPPPPPTVHYNPPPPPSPAHYSPPPSPP 784 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP +P P P PP P P P PP P Sbjct: 546 PPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIP 582 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PP P P P +P P P PP P Sbjct: 452 PSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSP 485 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +1 Query: 553 PRPSGLXPXXPA-PXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 P P G P P P P P+ P P P P S GG P Sbjct: 475 PTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSP 520 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXP---XXNPPXPXPXXPPPXPPP 951 P P P P PPP P +PP P P PPP Sbjct: 768 PPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPP 805 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 847 PXPXPXPPIXXPPP---PXPXXNPPXP--XPXXPPPXPPPXXP 960 P P PPI P P P P +PP P P P P P P Sbjct: 426 PSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSP 468 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXP 959 PP P PPP PP PPP P Sbjct: 770 PPPSPAHYSPPPSPPVYYYNSPPPPP 795 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P P PPPP + P P P P PP Sbjct: 791 PPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPP 824 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNP-PXPXPXXPPPXPPPXXP 960 P P PPI P PP +P P P P P P P Sbjct: 523 PSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSP 561 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P SP P P TP P P P PP Sbjct: 536 PPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPP 568 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 4/38 (10%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXP----XXPPPXPP 948 P P P PPPP P P P P PP PP Sbjct: 758 PPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPP 795 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P P P P + P P P P P P P Sbjct: 536 PPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISP 573 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PI PP P P P PP P P Sbjct: 552 PTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSP 584 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +1 Query: 853 PXPXPPIXX---PPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP+ PPPP P P P PPP Sbjct: 779 PPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPP 814 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P SPP P P P PP P PP PP Sbjct: 570 PISPGQNSPPIIPSPPFTGPSPPSSPS---PPLPP 601 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +2 Query: 851 PPXXXPX---SPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P SP PP PPP + P P P PPP Sbjct: 702 PPPPAPYYYSSPQPP-PPPHYSLPPPTPTYHYISPPP 737 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/45 (33%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +1 Query: 556 RPSGLXPXXPA-PXPXXPXPAXAXPPXPKXPXPXXPPPXSXGGXP 687 RP + P P P P P+ + P P P P S GG P Sbjct: 405 RPPVVVPSPPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSP 449 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXS 672 P P P P P + P P P P PP S Sbjct: 465 PGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSS 497 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXP----XXPPPXPPP 951 P P P PPP P + P P P PPP P P Sbjct: 703 PPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTP 741 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPP---PPXPXXNPPXPXPXXPPPXPPP 951 P P P P PP PP +PP P P PPP Sbjct: 735 PPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPP 772 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXP 959 SPP P PP PP PPP P Sbjct: 790 SPPPPPAVHYSPPPPPVIHHSQPPPPP 816 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP P P P +PP P PP P P Sbjct: 501 PTPGGSPP-SSPTTPSPGGSPPSPSISPSPPITVPSPP 537 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP-PPXXP 960 P P P P P P P N P P P P PP P Sbjct: 557 PIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSP 595 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P P P PPP P P P PPP Sbjct: 713 PQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPP 747 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP +P PP P +PP P PPP Sbjct: 760 PPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPP 793 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +3 Query: 876 LSPPXXPXP--QPPPPXPPXXPXXXPPPXP 959 +SPP P P PPP P PPP P Sbjct: 733 ISPPPPPTPIHSPPPQSHPPCIEYSPPPPP 762 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/35 (37%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +1 Query: 865 PPIXXPPPPX---PXXNPPXPXPXXPPPXPPPXXP 960 PP+ P PP P +PP P PP P P Sbjct: 406 PPVVVPSPPTTPSPGGSPPSPSISPSPPITVPSPP 440 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPP-XPXPXXPPPXP 945 P P P P PP +PP P P PP P Sbjct: 419 PGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSP 452 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPX-PXPXXPPPXPPP 951 PPI P PP +PP P P PP P P Sbjct: 578 PPII-PSPPFTGPSPPSSPSPPLPPVIPSP 606 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/40 (35%), Positives = 16/40 (40%), Gaps = 4/40 (10%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXP----PPXPPP 951 +P P P PPPP + P P P P PPP Sbjct: 723 LPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPP 762 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXT--PPXPXPXXPXXXPPPXXP 961 PP P PP PP P P P PPP P Sbjct: 736 PPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSP 774 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 GG GGG G G GG G GGG GG G Sbjct: 12 GGAGGGGGHGGGAGG---GFGGGAGGGGGHG 39 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 912 GGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GG GGGG GG G G GG GGG Sbjct: 12 GGAGGGGGHGG-GAGGGFGGGAGGGGG 37 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGG 880 G GGG G G G GG GGGG G Sbjct: 13 GAGGGGGHGGGAGGGFGGGAGGGGGHG 39 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXG 874 GG G G G GG GGG GG G Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGGGG 37 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -1 Query: 959 GXXGGGXG-GGXXGXGXGGLXXGXGGGG 879 G GGG G GG G G GG G GG G Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGGGGHG 39 >At3g21215.1 68416.m02681 RNA-binding protein, putative contains RNA recognition motif, Pfam:PF00076; contains AT-AC splice sites at intron 8 Length = 339 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXN--PPXPXPXXPPPXPPP 951 P PP PPPP + PP P P P PPP Sbjct: 8 PYHQQWPPAGAPPPPAAVSSAAPPHPPPIHHHPPPPP 44 >At2g35920.1 68415.m04409 helicase domain-containing protein similar to DEIH-box RNA/DNA helicase [Arabidopsis thaliana] GI:5881579; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 995 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXG 884 G GGG G GG GGGG G G G Sbjct: 11 GRRGGGHSSGRRGGRGGGGRGGGGGG 36 >At2g28670.1 68415.m03485 disease resistance-responsive family protein / fibroin-related contains similarity to silk fibroin heavy chain [Bombyx mori] gi|765323|gb|AAB31861; contains disease resistance response protien domain Pfam:FP03018 Length = 447 Score = 32.7 bits (71), Expect = 0.37 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXG-GXGDXGXXXG-GXXXGGGA 829 G G G G G G G GGGG G G G G G GGGA Sbjct: 165 GGAGAGSALGGGGAGAGPALGGGGAGAGPALGGGVAGSGSALGGGA 210 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G G G G G G GGG G G G GGGA Sbjct: 128 GTGSALGG-GPGAGSALGGGAGAGPALGGGAGAGPALGGGA 167 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = -1 Query: 950 GGGXGGGXX---GXGXGGLXXGXGGG-GXXXGGXGXGXG 846 GGG G G G G G G G G G GG G G G Sbjct: 154 GGGAGAGPALGGGAGAGSALGGGGAGAGPALGGGGAGAG 192 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PP PPPP P P PP PP Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPPPPHLPP 73 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP PPPP P PPP PPP P Sbjct: 42 PHPPPPPPPPPPPLY---FSYFSLPPPPPPPHLP 72 Score = 31.5 bits (68), Expect = 0.86 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 875 PXPPXPPPPXTPPXPXPXXPXXXPPP 952 P PP PPPP PP PPP Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPP 67 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 885 PXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P P PPPP P PP PP Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPP 67 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PPP PP P P PP P Sbjct: 25 PPGAYPPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYP 61 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPP---XPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PPPP P PP P P P P P Sbjct: 38 PPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSGP 78 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP P P PP PP P P PPP Sbjct: 30 PPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPP 63 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P P PP PPPP P P P P Sbjct: 50 PPPHGYPPAAYPPPPGAYPPAGYPGPSGPRP 80 >At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 561 Score = 24.6 bits (51), Expect(2) = 5.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 872 SPXPPXPPPP 901 SP PP PPPP Sbjct: 364 SPPPPPPPPP 373 Score = 23.4 bits (48), Expect(3) = 0.40 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPP 898 PP P PP PPP Sbjct: 359 PPLVYSPPPPPPPPPP 374 Score = 23.4 bits (48), Expect(3) = 0.40 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 872 SPXPPXPPPP 901 +P PP PPPP Sbjct: 393 NPPPPPPPPP 402 Score = 22.6 bits (46), Expect(2) = 5.2 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 881 PPXPPPPXTP 910 PP PPPP P Sbjct: 394 PPPPPPPPPP 403 Score = 22.6 bits (46), Expect(3) = 0.40 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 884 PXPPPPXTPP 913 P PPPP PP Sbjct: 394 PPPPPPPPPP 403 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P PP PP P T P P PPP P Sbjct: 198 PLPPLPPLPPTTGLTLPHSPFPPPPPGPP 226 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 L+ P P P PPP PP PP PP Sbjct: 211 LTLPHSPFPPPPPGPPPKEQDFVRPPLPP 239 Score = 31.9 bits (69), Expect = 0.65 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 875 PXPPXPPPPXTPPXPXPXXPXXXPP 949 P PP PPP PP P P PP Sbjct: 378 PRPPYGPPPGPPPMMRPPLPPGPPP 402 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP+ PP P P P PPP PPP Sbjct: 198 PLPPLPPLPPTTGLTLPHSPFPP-PPPGPPP 227 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPP 936 P PP PP P P PP P P PP Sbjct: 378 PRPPYGPPPGPPPMMRPPLP-PGPPP 402 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXP--XXPXXXPPPXXP 961 PP P P PPPP PP P PPP P Sbjct: 206 PPTTGLTLPHSPFPPPPPGPPPKEQDFVRPPLPPPPQLP 244 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PP PP P P P P P Sbjct: 217 PFPPPPPGPPPKEQDFVRPPLPPPPQLPQSSQPPPP 252 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 10/43 (23%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXP----------XPXXPPPXPPP 951 P P PPPP +PP P P PPP PPP Sbjct: 348 PPPGMLRFPPPPPPLDMHPPHPGMFVGHLIPRPPYGPPPGPPP 390 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 11/47 (23%) Frame = +1 Query: 853 PXPXPPIXXPPP----------PXPXXNPPX-PXPXXPPPXPPPXXP 960 P P PP+ PP P P PP P P PP PP P Sbjct: 356 PPPPPPLDMHPPHPGMFVGHLIPRPPYGPPPGPPPMMRPPLPPGPPP 402 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 32.3 bits (70), Expect = 0.49 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 872 SPXPPXPPPPXTPPXPXPXXP 934 SP PP PPPP TP P P Sbjct: 49 SPPPPSPPPPSTPTTACPPPP 69 Score = 31.5 bits (68), Expect = 0.86 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P+ PPP P P PPP PP Sbjct: 42 PCSPVQSSPPPPSPPPPSTPTTACPPPPSPP 72 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +3 Query: 885 PXXPXPQPPPPXPPXXP--XXXPPPXPP 962 P P PP P PP P PPP PP Sbjct: 45 PVQSSPPPPSPPPPSTPTTACPPPPSPP 72 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P + PPPP PP P PPP P Sbjct: 201 PPPGGMMRGPPPPHGMQGPPPSRPGMPPPGGAP 233 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP--PPXXP 960 P P + PPP P PP P PP P PP P Sbjct: 210 PPPPHGMQGPPPSRPGMPPPGGAPMFAPPHPGMPPAPP 247 >At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family protein similar to SP|P42925 22 kDa peroxisomal membrane protein {Mus musculus}; contains Pfam profile PF04117: Mpv17 / PMP22 family Length = 288 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXG 874 G GG G G G GG GGGG G G Sbjct: 79 GNSGGSGGLGGSGGGGGGSGGGGGDGSDG 107 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXG 852 GG GG G G G G GGG G G G Sbjct: 78 GGNSGGSGGLGGSGGGGGGSGGGGGDGSDGKG 109 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 32.3 bits (70), Expect = 0.49 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPP--XPXPXXP-PPXPPPXXP 960 +P P PP+ PP P P N P P P P P P P P Sbjct: 180 LPDPSFPPPLQDPPNPSPLPNLPIVPPLPNLPVPKLPVPDLP 221 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PI P P P P P P P P PP P Sbjct: 195 PSPLPNLPIVPPLPNLPV--PKLPVPDLPLPLVPPLLP 230 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXP-XPXXPXXXPPPXXP 961 PP P +P P P P PP P P P P P P Sbjct: 268 PPSIIPPNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIP 305 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P P PP P PP P P PPP Sbjct: 322 PTLPPIPTIPTLPPLPVLPPVPIVNPPSLPPPP 354 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 5/44 (11%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXP-XPXXPP----PXPPPXXP 960 +P P P P+ PP P PP P P PP P PP P Sbjct: 350 LPPPPPSFPVPLPPVPGLPGIPPVPLIPGIPPAPLIPGIPPLSP 393 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PPPP P P P P P P P Sbjct: 341 PVPIVNPP-SLPPPPPSFPVPLPPVPGLPGIPPVPLIP 377 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P P PPP PP P P PP Sbjct: 178 PLLPDPSFPPPLQDPPNPSPLPNLPIVPP 206 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 +P PP+ PP P NPP P PP P P P Sbjct: 327 IPTIPTLPPLPV-LPPVPIVNPP-SLPPPPPSFPVPLPP 363 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTP-PXPXPXXPXXXPPPXXP 961 P P P P PP P P P P P PP P Sbjct: 274 PNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIPTPPTLP 311 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +1 Query: 844 VPXPXPXPPI-XXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 +P P PPI P PP P P P P P P P Sbjct: 292 IPSPPSLPPIPLIPTPPTLPTIPLLPTPPTPTLPPIPTIP 331 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P P P PP P PP P P P P P Sbjct: 307 PPTLPTIPLLPTPPTPTLPPIPT--IPTLPPLPVLP 340 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 32.3 bits (70), Expect = 0.49 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 574 PXXPAPXPXXPXPAXAXPPXPKXPXPXXPPP 666 P +P P P P+ + PP P P PPP Sbjct: 39 PTICSPPPSKPSPSMSPPPSPSLPLSSSPPP 69 Score = 31.9 bits (69), Expect = 0.65 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXPP 962 PP P P PP P P PP PP Sbjct: 45 PPSKPSPSMSPPPSPSLPLSSSPPPPP 71 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 6/34 (17%) Frame = +1 Query: 865 PPIXXPPP--PXPXXNPPX----PXPXXPPPXPP 948 P I PPP P P +PP P PPP PP Sbjct: 39 PTICSPPPSKPSPSMSPPPSPSLPLSSSPPPPPP 72 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 847 PXPXPXPPIXX-PPPPXPXXNPPXPXPXXPPPXP 945 P P P P+ PPPP P + P P P P Sbjct: 55 PPPSPSLPLSSSPPPPPPHKHSPPPLSQSLSPPP 88 >At4g34440.1 68417.m04894 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 670 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP+ P P NP P P P PP P Sbjct: 72 PSSSPPVVANPSPQTPENPSPPAPEGSTPVTPPAPP 107 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P PP PPP + P P PP P Sbjct: 26 PSNESSPPTPPSSPPPSSISAPPPDISASFSPPPAP 61 >At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibrillarin 2 GI:9965655 from [Arabidopsis thaliana] Length = 320 Score = 32.3 bits (70), Expect = 0.49 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -1 Query: 959 GXXGG-GXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G GG G GG G G GG G GGGG GG G Sbjct: 11 GFSGGRGRGGYSGGRGDGGFSGGRGGGG-RGGGRG 44 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG G G G GG G G GG G G G G Sbjct: 9 GGGFSG---GRGRGGYSGGRGDGGFSGGRGGGGRG 40 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 G GGG G G GG G G G R G G Sbjct: 7 GSGGGFSGGRGRGGYSGGRGDGGFSGGRGGGGRG 40 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G GG G G GG GGG G G G GGA Sbjct: 19 GGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGPPRGGA 62 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPP +PP P PPP PP P Sbjct: 391 PPPPCPDVYKPPPYVYSSPP-PYVYNPPPSSPPPSP 425 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 4/38 (10%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPPXXP 960 P P PPPP P P P PP PPP P Sbjct: 384 PPPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSP 421 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPP 951 P P P + PPP PP P PP PPP Sbjct: 33 PSPPPYVYSSPPPYTYSPPPSPYVYKSPPYVYSSPPP 69 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 PP SP P PP + P P P PPP Sbjct: 401 PPPYVYSSPPPYVYNPPPSSPPPSPSYSYSSPPP 434 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXP-------XXNPPXPXPXXPPPXPPPXXP 960 P P P PP+ PP P +P P P P PPP P Sbjct: 72 PNPNPNPPVLGSSPPSPTDSSSSTSISPNPPAPIVNPNPPPPSTP 116 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P PI P PP P + P P P PP P Sbjct: 99 PNPPAPIVNPNPPPP--STPNPPPEFSPPPP 127 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXN-PPXPXPXXPPPXPPP 951 P P P PPP PP P P P PPP Sbjct: 116 PNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPP 149 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P P PPP +PP P PPP Sbjct: 110 PPPPSTPNPPPEFSPPPPDLDTTTAPPPP 138 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +1 Query: 880 PPPPXPXXNPPXPXPXXPPP--XPPP 951 PP P NPP P PPP PPP Sbjct: 101 PPAPIVNPNPPPPSTPNPPPEFSPPP 126 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P PPPP P P PP P Sbjct: 102 PAPIVNPNPPPPSTPNPPPEFSPPPP 127 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP PPP PP PP P P Sbjct: 108 PNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIP 143 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 P P SPP P PP PPP P Sbjct: 116 PNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPP 149 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 32.3 bits (70), Expect = 0.49 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 875 PXPPXPPPPXTPPXPXPXXPXXXPPP 952 P PP PPP P P P PPP Sbjct: 539 PRPPLPPPARARPLPPPARARPMPPP 564 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P P PP P P P P P P P PPP Sbjct: 539 PRPPLPPPARARPLPPPARARPMPPPARARPLPPP 573 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXP 946 P SP PP PPPP P P P P P Sbjct: 56 PHSPSPPPPPPPQWGP-PSPHYPQGQP 81 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PP PP P P P PP PP Sbjct: 62 PPPPPPQWGPPSPHYPQGQPYSSPAYPPHQPP 93 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXPXXPXXXP 946 P SP PP PPPP P P P P P Sbjct: 56 PHSPSPPPPPPPQWGP-PSPHYPQGQP 81 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P P PP PP P P P PP PP Sbjct: 62 PPPPPPQWGPPSPHYPQGQPYSSPAYPPHQPP 93 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 32.3 bits (70), Expect = 0.49 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPP 926 L+PP P P PPPP PP Sbjct: 245 LAPPPPPPPPPPPPPPP 261 Score = 30.7 bits (66), Expect = 1.5 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 872 SPXPPXPPPPXTPPXP 919 +P PP PPPP PP P Sbjct: 246 APPPPPPPPPPPPPPP 261 Score = 30.3 bits (65), Expect = 2.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 907 PPXPXPXXPPPXPPP 951 PP P P PPP PPP Sbjct: 247 PPPPPPPPPPPPPPP 261 >At1g35617.1 68414.m04424 hypothetical protein Length = 121 Score = 32.3 bits (70), Expect = 0.49 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXP 919 PP P S PP PP P PP P Sbjct: 22 PPAPPPESSSPPTPPEPPDPPDP 44 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXPPPXP 959 L PP P P PPP PP P P P Sbjct: 21 LHPPSAPLPPPPPLPPPPPPRQSHPESP 48 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 886 PPXPXXNPPXPXPXXPPPXPPPXXP 960 P P +PP PPP PPP P Sbjct: 16 PYSPHLHPPSAPLPPPPPLPPPPPP 40 >At5g67060.1 68418.m08455 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 241 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 GGG GGG G GG+ GGGG G G GT Sbjct: 193 GGGGGGGRVLIGGGGMTAASGGGG-GGGVVMKGCGT 227 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 31.9 bits (69), Expect = 0.65 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 880 PPPPXPXXNPPXPXPXXPPP 939 PPPP P P P P PPP Sbjct: 349 PPPPPPVIQPELPQPQPPPP 368 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 867 PXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P + P P PPPP P P P PP Sbjct: 336 PQLVEPSRVQSPSPPPPPPVIQPELPQPQPPP 367 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P L P PPP PP P P PP Sbjct: 332 PTLPPQLVEPSRVQSPSPPPPPPVIQPELPQPQPP 366 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPP 952 P P P PPPP PP P P PPP Sbjct: 336 PQLVEPSRVQSPSPPPP--PPVIQPELPQPQPPP 367 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 31.9 bits (69), Expect = 0.65 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPP 913 P P S PP PPPP TPP Sbjct: 263 PNRPPPPSSPPPPPPPPPTPP 283 Score = 31.5 bits (68), Expect = 0.86 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXPXP 925 P P PP PPP PP P P Sbjct: 263 PNRPPPPSSPPPPPPPPPTP 282 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 895 PXXNPPXPXPXXPPPXPPPXXP 960 P PP P PPP PPP P Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPP 283 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 881 PPXPPPPXTPPXPXPXXP 934 P PPPP +PP P P P Sbjct: 263 PNRPPPPSSPPPPPPPPP 280 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 868 PIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P PPPP PP P P PPP PP Sbjct: 262 PPNRPPPPSS---PPPPPP--PPPTPP 283 >At5g35190.1 68418.m04170 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 328 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 232 PPPPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSP 265 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P + PPP P +P PP PP P Sbjct: 249 PPPYVYSSPPPPPYYSPSPEVSYKSPPPPPYYSP 282 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP PP P P P P PPP Sbjct: 248 PPPPYVYSSPPPPPYYSPSPEVSYKSPPPPP 278 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 82 PPPPYYSPSPKEDYKSPPPPYVYNSPPPP 110 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 107 PPPPYYSPSPKVDYKSPPPPYVYNSPPPP 135 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 132 PPPPYYSPSPKVEYKSPPPPYVYNSPPPP 160 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 207 PSPPYYSPSPKVDYKSPPPPYVYNSPPPP 235 >At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical to gi_11935088_gb_AAG41964 Length = 209 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP P P +PP P P P P P Sbjct: 73 PAPVSESSPPPTPVPESSPPVPAPMVSSPVSSPPVP 108 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PP+ P P +PP P P P P P Sbjct: 85 PVPESSPPVPAPMVSSPVSSPPVPAPVADSPPAPVAAP 122 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXP-XXNPPXP--XPXXPPPXPPP 951 VP P P+ PP P P +PP P P P P P Sbjct: 93 VPAPMVSSPVSSPPVPAPVADSPPAPVAAPVADVPAPAP 131 >At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi|20465684|gb|AY096677.1| Length = 158 Score = 31.9 bits (69), Expect = 0.65 Identities = 19/44 (43%), Positives = 21/44 (47%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G G G G G G GG+ G GG GG G G G GGG+ Sbjct: 110 GVGGIGGDPGI-GSGIGGLGGAGGLGGIGGVGGLGG---IGGGS 149 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGG--GGXXXGGXGXGXG 846 G G G G G G GG+ G GG G GG G G G Sbjct: 47 GGAAGIGGAGGVGAGLGGVAGGVGGVAGVLPVGGVGGGIG 86 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG GG G G GGL GG G GG G G G Sbjct: 79 GGVGGGIGG--LGGGVGGL----GGLGGLGGGSGLGHG 110 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GG G G GG+ G G G GG G G Sbjct: 96 GGLGGLGGGSGLGHGVGGI-GGDPGIGSGIGGLGGAGG 132 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXG----GGGXGGXGDXGXXXGGXXXGG 835 G GG G G GG+ G G G GG G G G GG Sbjct: 96 GGLGGLGGGSGLGHGVGGIGGDPGIGSGIGGLGGAGGLGGIGGVGG 141 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP PPP PP P P PPP Sbjct: 182 PPPPYGMRPPPQQFSGPPPPQYGQRPMIPPP 212 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPP-PXPPP 951 P P + PPPP P PP P PP P PP Sbjct: 220 PPPPHGMQGPPPPRPGM-PPAPGGFAPPRPGMPP 252 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 P PP PPP PP P P PPP Sbjct: 182 PPPPYGMRPPPQQFSGPPPPQYGQRPMIPPP 212 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPP-PXPPP 951 P P + PPPP P PP P PP P PP Sbjct: 220 PPPPHGMQGPPPPRPGM-PPAPGGFAPPRPGMPP 252 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 160 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSP 193 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 212 PPPPYYSPSPKVGYKSPPAPYVYSSPPPPPYYSP 245 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PPP P Sbjct: 238 PPPPYYSPSPKVNYKSPPPPYVYSSPP-PPPYSP 270 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 350 PPPPYYSPSPTVNYKSPPPPYVYNSPPPPPYYSP 383 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 186 PPPPYYSPSPKVEYKSPPPPYVYSFPPPPPYYSP 219 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 376 PPPPYYSPFPKVEYKSPPPPYIYNSPPPPPYYSP 409 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PPPP + P P PP PP P Sbjct: 322 PSPRVDYKSPPPPYVYNSLPPPYVYNSPPPPPYYSP 357 >At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226 DnaJ domain Length = 580 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 GG GGG G G G G GGGG G G Sbjct: 24 GGGGGGHGGGGHGRGGHGRGGGGIFFFGGG 53 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 897 GGGXGGXGDXGXXXGGXXXGGG 832 GGG GG G G GG GGG Sbjct: 24 GGGGGGHGGGGHGRGGHGRGGG 45 >At3g56990.1 68416.m06344 glycine-rich protein conserved hypothetical protein SPCC330.09 - Schizosaccharomyces pombe, PIR:T41319 Length = 711 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 935 GGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GG G G GG GGG GG G G G Sbjct: 678 GGFRGRGGGGFRGRGGGGSRGKGGRGGGRG 707 >At3g49300.1 68416.m05388 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 86 Score = 31.9 bits (69), Expect = 0.65 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 883 PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P +P P PPP PPP P Sbjct: 54 PGPDPKHDPTKPGYGFPPPPPPPLSP 79 Score = 29.1 bits (62), Expect = 4.6 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXP 919 P PP PPPP +PP P Sbjct: 65 PGYGFPPPPPPPLSPPPP 82 >At3g43583.1 68416.m04636 hypothetical protein Length = 100 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXP-XPXXPXXXPPP 952 PP P PP P PP +P P P P PP Sbjct: 22 PPEKPPSPEPPPSPEPPPSPEKPTSPEQPSSPEPP 56 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 P P PP P P PP P P P P PP Sbjct: 23 PEKPPSPEPPPSPEP-PPSPEKPTSPEQPSSPEPP 56 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P P P P PP P +P P PPP Sbjct: 27 PSPEPPPSPEPPPSPEKPTSPEQPSSPEPPP 57 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +1 Query: 853 PXPXPPIXXPPP-PXPXXNPPXPXPXXPP--PXPPP 951 P PP PPP P P +P P P P PPP Sbjct: 22 PPEKPPSPEPPPSPEPPPSPEKPTSPEQPSSPEPPP 57 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/41 (31%), Positives = 15/41 (36%) Frame = +1 Query: 556 RPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXSXG 678 RP P P P P+ P P+ P PPP G Sbjct: 21 RPPEKPPSPEPPPSPEPPPSPEKPTSPEQPSSPEPPPHCQG 61 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/28 (42%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +2 Query: 881 PPXPPPPXTP-PXPXPXXPXXXPPPXXP 961 PP P PP +P P P P P P P Sbjct: 26 PPSPEPPPSPEPPPSPEKPTSPEQPSSP 53 >At3g07540.1 68416.m00900 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 841 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +3 Query: 867 PXXLSPPXXP-XPQPPPPXPPXXPXXXPPPXP 959 P SPP P PP PP P PPP P Sbjct: 43 PSTFSPPFFPLYSSTSPPPPPSPPQPLPPPAP 74 >At2g43800.1 68415.m05445 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 894 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 V P P PP P P + P PPP PPP Sbjct: 84 VANPPPPPPSPPHPNPFFPSSDPTSTASHPPPAPPP 119 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXP--PPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PP P P P P P PPP P P Sbjct: 88 PPPPPSPPHPNPFFPSSDPTSTASHPPPAPPPPASLPTFP 127 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGG 864 G GG GGG G G G GGG GG Sbjct: 136 GAPAGGYGGGAGGYGGNSSYSGNAGGGGGYGG 167 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G GGG G G GGG GG G G GGG Sbjct: 122 GGPGGGYGASDGGYGAPAGGYGGGAGGYGGNSSYSGNAGGGGG 164 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGG 850 G GG G G GGGG GG G GG Sbjct: 141 GYGGGAGGYGGNSSYSGNAGGGGGYGGNSSYGGNAGG 177 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 718 PPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSP 751 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 769 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSP 802 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPP-----XPPP 951 P P P PPPP +PP P P P PPP Sbjct: 725 PSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPP 762 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPPP +PP P P P P P Sbjct: 348 PSPKPAYKSPPPPYVYSSPPPPY-YSPSPKPTYKSP 382 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPPP +PP P P P P P Sbjct: 625 PSPKPTYKSPPPPYVYSSPPPPY-YSPTPKPTYKSP 659 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPPP +PP P P P P P Sbjct: 650 PTPKPTYKSPPPPYVYSSPPPPY-YSPSPKPTYKSP 684 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPPP +PP P P P P P Sbjct: 675 PSPKPTYKSPPPPYVYSSPPPPY-YSPAPKPTYKSP 709 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPPP +PP P P P P P Sbjct: 700 PAPKPTYKSPPPPYVYSSPPPPY-YSPSPKPTYKSP 734 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPPP +PP P P P P P Sbjct: 223 PSPKPVYKSPPPPYVYSSPPPPY-YSPSPKPAYKSP 257 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P P PPPP +PP P P P P Sbjct: 248 PSPKPAYKSPPPPYVYSSPPPPY-YSPSPKP 277 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPPP +PP P P P P P Sbjct: 323 PSPKPVYKSPPPPYVYNSPPPPY-YSPSPKPAYKSP 357 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P P PPPP +PP P P P P Sbjct: 373 PSPKPTYKSPPPPYVYSSPPPPY-YSPSPKP 402 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPPP +PP P P P P P Sbjct: 600 PAPKPVYKSPPPPYVYNSPPPPY-YSPSPKPTYKSP 634 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P P PPPP +PP P P P P Sbjct: 198 PSPKPTYKSPPPPYIYSSPPPPY-YSPSPKP 227 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPPP +PP P P P P P Sbjct: 273 PSPKPIYKSPPPPYVYNSPPPPY-YSPSPKPAYKSP 307 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P P PPPP +PP P P P P P Sbjct: 398 PSPKPVYKSPPPPYIYNSPPPPY-YSPSPKPSYKSP 432 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P PP P P +PP P PP PP Sbjct: 516 PPPPYYSPSPKVIYKSPPHPHVCVCPPPPP 545 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPP----XPXPXXPPPXPPP 951 P P P PPPP +PP P P PPP Sbjct: 123 PSPKPTYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPP 159 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP P P Sbjct: 795 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYYSP 828 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 5/38 (13%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPP-----XPPP 951 P P PPPP +PP P P P PPP Sbjct: 22 PTPKVDYKSPPPPYVYSSPPPPLSYSPSPKVDYKSPPP 59 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 66 PPPPYYSPSPKVEYKSPPPPYVYSSPPPP 94 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 91 PPPPYYSPSPKVDYKSPPPPYVYSSPPPP 119 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 116 PPPPYYSPSPKPTYKSPPPPYVYNSPPPP 144 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 141 PPPPYYSPSPKVEYKSPPPPYVYSSPPPP 169 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 166 PPPPYYSPSPKVDYKSPPPPYVYNSPPPP 194 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 241 PPPPYYSPSPKPAYKSPPPPYVYSSPPPP 269 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P P P PPPP PP P P P P Sbjct: 298 PSPKPAYKSPPPPYVYSFPPPPY-YSPSPKP 327 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 341 PPPPYYSPSPKPAYKSPPPPYVYSSPPPP 369 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 366 PPPPYYSPSPKPTYKSPPPPYVYSSPPPP 394 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 416 PPPPYYSPSPKPSYKSPPPPYVYSSPPPP 444 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 491 PPPPYYSPSPKPSYKSPPPPYVYNSPPPP 519 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P +PP P PP PP P Sbjct: 542 PPPPCYSHSPKIEYKSPPTPYVYHSPPPPPYYSP 575 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 618 PPPPYYSPSPKPTYKSPPPPYVYSSPPPP 646 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 643 PPPPYYSPTPKPTYKSPPPPYVYSSPPPP 671 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 668 PPPPYYSPSPKPTYKSPPPPYVYSSPPPP 696 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 693 PPPPYYSPAPKPTYKSPPPPYVYSSPPPP 721 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 744 PPPPYYSPSPKVEYKSPPPPYVYSSPPPP 772 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 31.5 bits (68), Expect = 0.86 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPP 913 PP P +P PP PPPP P Sbjct: 244 PPQQPPATPPPPPPPPPVEVP 264 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPP 926 L PP P P PPPP PP Sbjct: 379 LIPPPSPPPPPPPPPPP 395 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 881 PPXPPPPXTPPXPXPXXPXXXP 946 PP PPPP PP P P P Sbjct: 297 PPSPPPPPPPPPPQPLIAATPP 318 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 894 PXPQPPPPXPPXXPXXXPPPXPP 962 P P PPPP PP P PP Sbjct: 296 PPPSPPPPPPPPPPQPLIAATPP 318 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXP 919 PP P P PPPP PP P Sbjct: 373 PPQYQSLIPPPSPPPPPPPPPPP 395 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 882 PPXXPXPQPPPPXPPXXPXXXPP 950 PP P P PPPP P PP Sbjct: 296 PPPSPPPPPPPPPPQPLIAATPP 318 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 871 IXXPPPPXPXXNPPXPXPXXPPPXPP 948 + PP PP P P PPP PP Sbjct: 370 VTEPPQYQSLIPPPSPPPPPPPPPPP 395 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 883 PPPXPXXNPPXPXPXXPPPXPPP 951 PP PP P PPP PPP Sbjct: 373 PPQYQSLIPPPSPPPPPPPPPPP 395 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 854 PXXXPXSPXPPXPPPPXTPPXPXPXXP 934 P P P PPPP PP P P Sbjct: 241 PSSPPQQPPATPPPPPPPPPVEVPQKP 267 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 875 PXPPXPPPPXTPPXPXPXXPXXXP 946 P P PP TPP P P P P Sbjct: 241 PSSPPQQPPATPPPPPPPPPVEVP 264 Score = 29.1 bits (62), Expect = 4.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 866 PXSPXPPXPPPPXTP 910 P SP PP PPPP P Sbjct: 297 PPSPPPPPPPPPPQP 311 Score = 28.7 bits (61), Expect = 6.1 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 900 PQPPPPXPPXXPXXXPPPXP 959 P PP PP P PPP P Sbjct: 241 PSSPPQQPPATPPPPPPPPP 260 Score = 28.7 bits (61), Expect = 6.1 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXP 923 P + PP P P PPPP P Sbjct: 374 PQYQSLIPPPSPPPPPPPPPPP 395 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPP-XPXPXXP--PPXPPP 951 P P PP PPP PP P P P P PPP Sbjct: 306 PPPTIQPPYQPPPPTQSLHQPPYQPPPQQPQYPQQPPP 343 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXS 672 PSG P P P P + PP P P PPP S Sbjct: 348 PSGYNPEEP------PYPQQSYPPNPPRQPPSHPPPGS 379 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 +PP P PPP P PP PP Sbjct: 366 NPPRQPPSHPPPGSAPSQQYYNAPPTPP 393 >At4g12490.1 68417.m01974 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 182 Score = 31.5 bits (68), Expect = 0.86 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPK-XPXPXXPP--PXSXGGXPL 690 PS P P P P P+ P P P P PP P S G P+ Sbjct: 55 PSPYVPTPSVPSPSVPTPSVPSPSVPSPNPTPVIPPRTPGSSGNCPI 101 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +1 Query: 844 VPXPX-PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 VP P P P + P P P P P P PP P Sbjct: 59 VPTPSVPSPSVPTPSVPSPSVPSPNPTPVIPPRTP 93 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXP--PXPKXPXPXXPPP 666 PS P P P P P+ P P P P P P P Sbjct: 45 PSPKVPTPSVPSPYVPTPSVPSPSVPTPSVPSPSVPSP 82 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXP--PXPKXPXPXXPPP 666 P P+ P P P P P P P P P P P P Sbjct: 38 PLPNPKVPSPKVPTPSVPSPYVPTPSVPSPSVPTPSVPSP 77 >At3g46240.1 68416.m05005 protein kinase-related similar to light repressible receptor protein kinase (GI:1321686) [Arabidopsis thaliana] Length = 441 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXG 858 G G GG G G G G G GG GG G Sbjct: 312 GSGSGSGSGGSGGGGSGSSGSGSGSGGTSKGGTG 345 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 938 GGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GG G G G G GGGG G G G G Sbjct: 307 GGNETGSGSGSGSGGSGGGGSGSSGSGSGSG 337 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 GG G G GG GGGG G G G GG GG Sbjct: 307 GGNETGSGSGSGSGG-SGGGGSGSSGS-GSGSGGTSKGG 343 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GGG G G GG G GG G Sbjct: 320 GGSGGGGSGSSGSGSGSGGTSKGGTGGSNEVSPGG 354 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GGG G G G GG G GG G G Sbjct: 321 GSGGGGSGSSGSGSGSGGTSKGGTGGSNEVSPGGSTNG 358 >At1g51090.1 68414.m05744 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 171 Score = 31.5 bits (68), Expect = 0.86 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXP 947 L PP P PQP PP P P P Sbjct: 75 LEPPKPPQPQPQPPQKPTAPAPAP 98 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 31.5 bits (68), Expect = 0.86 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P P PP+ PPP +PP PPP Sbjct: 66 PLPSILPPLTDSPPPPSDSSPPVDSTPSPPP 96 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P + PPP P N P PP PP P Sbjct: 124 PPPSQDLQSPPPSSPSPNVGPTNPESPPLQSPPAPP 159 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 4/39 (10%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPP----XPPXXPXXXPPPXPP 962 P P SPP P PPPP P PP PP Sbjct: 78 PPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPP 116 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXP 946 PP P P P P PP P P P P Sbjct: 177 PPPIQPSGPATSPPANPNAPPSPFPTVPPKTP 208 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXP--PPXPPPXXP 960 P PP+ PP P P +P P P P PPP P Sbjct: 144 PTNPESPPLQSPPAP-PASDPTNSPPASPLDPTNPPPIQP 182 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPP 949 PP P + P P P PP P P PP Sbjct: 158 PPASDPTNSPPASPLDPTNPPPIQPSGPATSPP 190 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +3 Query: 879 SPPXXPX-PQPPPPXPPXXPXXXPPPXP 959 SPP P P PPP P P PP P Sbjct: 166 SPPASPLDPTNPPPIQPSGPATSPPANP 193 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = +1 Query: 859 PXPPIXXPPPP-XPXXNPPXPXPXXPPPXPP 948 P PP PPP P N P PP PP Sbjct: 13 PAPPADTAPPPETPSENSALPPVDSSPPSPP 43 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/37 (35%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +1 Query: 847 PXPXPXPPIXX---PPPPXPXXNPPXPXPXXPPPXPP 948 P PP+ PPPP +P P PP PP Sbjct: 80 PPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPP 116 Score = 27.5 bits (58), Expect(2) = 3.1 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +1 Query: 553 PRPSGLXPXXPAPXPXXPXPAXAXPPXPKXPXPXXPPPXS 672 P PS L P +P P P+ + PP P P PPP S Sbjct: 66 PLPSILPPLTDSPPP----PSDSSPPVDSTPSP--PPPTS 99 Score = 20.6 bits (41), Expect(2) = 3.1 Identities = 9/30 (30%), Positives = 10/30 (33%) Frame = +1 Query: 343 PXPPCXXXXPPVPXXXXXVLPAXXNRPNXP 432 P PP PP LP + P P Sbjct: 13 PAPPADTAPPPETPSENSALPPVDSSPPSP 42 >At1g18170.1 68414.m02258 immunophilin / FKBP-type peptidyl-prolyl cis-trans isomerase family protein similar to (Peptidyl-prolyl cis-trans isomerase) (PPiase) (Rotamase) (SP:Q26486) [Spodoptera frugiperda]; contains Pfam profile: PF00254 FKBP-type peptidyl-prolyl cis-trans isomerases Length = 247 Score = 31.5 bits (68), Expect = 0.86 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 904 NPPXPXPXXPPPXPPPXXP 960 NPP P PPP PPP P Sbjct: 33 NPPEPESSSPPPPPPPPQP 51 >At1g07135.1 68414.m00759 glycine-rich protein Length = 155 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 900 GGGGXGGXGDXGXXXGGXXXGGG 832 GGGG GG G G GG GGG Sbjct: 66 GGGGGGGRGGGGARSGGRSRGGG 88 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGG 882 G GGG G G G GG G GGG Sbjct: 65 GGGGGGGGRGGGGARSGGRSRGGGGG 90 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P P PPP P P P P PPP P Sbjct: 404 PLLPTLPPPPVIEITRDPSPPPSPVQPPPPPSPP 437 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 +P P P I P P PP P PPP PPP Sbjct: 406 LPTLPPPPVIEITRDPSP---PPSPVQPPPPPSPPP 438 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXP 935 SPP P PPPP PP P Sbjct: 422 SPPPSPVQPPPPPSPPPQP 440 >At4g37900.1 68417.m05360 glycine-rich protein Length = 787 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -3 Query: 945 GXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGGA 829 G G G G GG GGGG GG G G GGG+ Sbjct: 713 GGHCGGCG-GCGGCGGGGGCGGGGRCGGMTKIEGCGGGS 750 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGG 835 G GG G G G GG GGG GG GG GG Sbjct: 714 GHCGGCGGCGGCGGG-GGCGGGGRCGGMTKIEGCGGGSCTGG 754 >At4g12500.1 68417.m01975 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 177 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXPPXPK-XPXPXXPP--PXSXGGXPL 690 PS P P P P P+ P P P P PP P S G P+ Sbjct: 50 PSPSIPSPSVPTPSVPTPSVPTPSVPSPNPTPVTPPRTPGSSGNCPI 96 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/35 (37%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +1 Query: 844 VPXPX-PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 +P P P P + P P P P P P PP P Sbjct: 54 IPSPSVPTPSVPTPSVPTPSVPSPNPTPVTPPRTP 88 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 559 PSGLXPXXPAPXPXXPXPAXAXP--PXPKXPXPXXPPP 666 PS P P P P P+ P P P P P P P Sbjct: 40 PSPKVPSPKYPSPSIPSPSVPTPSVPTPSVPTPSVPSP 77 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 6/45 (13%) Frame = +1 Query: 844 VPXPX-PXPPIXXPPPPXPXX-NPPXPXPXXPPPXP----PPXXP 960 VP P P P I P P P P P P P P P PP P Sbjct: 44 VPSPKYPSPSIPSPSVPTPSVPTPSVPTPSVPSPNPTPVTPPRTP 88 >At3g08630.1 68416.m01002 expressed protein Length = 339 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXG 884 GG GGG GG G GG G G G Sbjct: 61 GGGGGGSIGNHGGGSGSGGGGGGYGG 86 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXGXXGG 881 G GGG G GG G G G G GG Sbjct: 61 GGGGGGSIGNHGGGSGSGGGGGGYGG 86 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGGGG 879 GG GGG G GG G GGGG Sbjct: 61 GGGGGGSIGNHGGGSGSGGGGGG 83 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GG GGG G GG G GGGG GG G G Sbjct: 15 GGRDGGGGGRFGGGGGRFG-GGGGRFGGGGGRFGG 48 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = -1 Query: 680 PPXEXGGGXXGXGXL--GXGGXAXAGXGXXGXGAGXXG 573 PP GGG G G G GG G G G G G G Sbjct: 3 PPMRGGGGFRGRGGRDGGGGGRFGGGGGRFGGGGGRFG 40 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 951 GGGXXXGXXGXGXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 GGG G G GG GG GG G GG GGG Sbjct: 7 GGGGFRGRGGRDGGG---GGRFGGGGGRFGGGGGRFGGGG 43 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 952 GGGXXXGXXGGXGGGGXGXGXXGGXRXXG 866 GGG G GG GGG G GG R G Sbjct: 20 GGGGRFGGGGGRFGGGGGRFGGGGGRFGG 48 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXGXXGG 881 G GGG G G GGGG G GG Sbjct: 19 GGGGGRFGGGGGRFGGGGGRFGGGGG 44 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG G G GG G GGG GG G G Sbjct: 8 GGGFRGRGGRDGGGGGRFGGGGGRFGGGGGRFGGG 42 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 GGG G G GG GGGG GG G G Sbjct: 7 GGGGFRGRGGRDGGGGGRFGGGGGRFGGGGGRFGG 41 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXGXGXXGGXRXXG 866 G GGG G G GGGG G GG R G Sbjct: 26 GGGGGRFGGGGGRFGGGG---GRFGGFRDEG 53 >At2g40820.1 68415.m05038 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 903 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 880 PPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP NP P PPP PP P Sbjct: 744 PNPPMTNTNPQMQQPYYPPPMQPPPPP 770 >At1g70250.1 68414.m08082 receptor serine/threonine kinase, putative similar to to receptor serine/threonine kinase PR5K gi|1235680|gb|AAC49208 Length = 799 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPP 948 P PP PPP PP P PP PP Sbjct: 101 PPPPPDLFPPPSAQMLPPPPASSPAPPSPP 130 >At1g53620.1 68414.m06094 glycine-rich protein Length = 143 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GGG G G GGG G G GG G G Sbjct: 70 GGCGGGGDGGGCDGDAGGGDG-GGCGGCGGCGVCG 103 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGG 879 G GGG GGG G GG G GG G Sbjct: 71 GCGGGGDGGGCDGDAGGGDGGGCGGCG 97 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 27.9 bits (59), Expect(2) = 1.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXP 935 L+ P P PPPP PP P Sbjct: 274 LASEFHPSPPPPPPPPPPLP 293 Score = 26.6 bits (56), Expect(2) = 1.5 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 872 SPXPPXPPPPXTP 910 SP PP PPPP P Sbjct: 281 SPPPPPPPPPPLP 293 Score = 25.0 bits (52), Expect(2) = 4.1 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 866 PXSPXPPXPPPP 901 P P PP PPPP Sbjct: 280 PSPPPPPPPPPP 291 Score = 25.0 bits (52), Expect(2) = 4.1 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 916 PXPXXPPPXPPP 951 P P PPP PPP Sbjct: 280 PSPPPPPPPPPP 291 Score = 22.6 bits (46), Expect(2) = 4.1 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 884 PXPPPPXTPP 913 P PPPP PP Sbjct: 329 PPPPPPPPPP 338 Score = 22.6 bits (46), Expect(2) = 1.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 890 PPPPXTPPXP 919 PPPP PP P Sbjct: 329 PPPPPPPPPP 338 Score = 22.6 bits (46), Expect(2) = 4.1 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 931 PPPXPPPXXP 960 PPP PPP P Sbjct: 329 PPPPPPPPPP 338 Score = 21.0 bits (42), Expect(2) = 1.9 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +3 Query: 909 PPPXPPXXPXXXPPPXPP 962 PPP PP P PP Sbjct: 329 PPPPPPPPPPVEYYKSPP 346 >At5g63120.2 68418.m07924 ethylene-responsive DEAD box RNA helicase, putative (RH30) strong similarity to ethylene-responsive RNA helicase [Lycopersicon esculentum] GI:5669638; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 591 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 918 GXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G V GGG GG G G GG GGG Sbjct: 70 GGFSVGRGGGRGGYGQYGDRNGGGNWGGG 98 >At5g63120.1 68418.m07925 ethylene-responsive DEAD box RNA helicase, putative (RH30) strong similarity to ethylene-responsive RNA helicase [Lycopersicon esculentum] GI:5669638; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 484 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 918 GXGGVXGGGGXGGXGDXGXXXGGXXXGGG 832 G V GGG GG G G GG GGG Sbjct: 70 GGFSVGRGGGRGGYGQYGDRNGGGNWGGG 98 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 868 PIXXPPPPXPXXNPPXPXPXXPPP 939 P PPPP P +PP P PP Sbjct: 61 PYGNPPPPSPQYSPPPPPSQSSPP 84 Score = 28.7 bits (61), Expect = 6.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 895 PXXNPPXPXPXXPPPXPP 948 P NPP P P PP PP Sbjct: 61 PYGNPPPPSPQYSPPPPP 78 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 8/41 (19%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPP----XPXP----XXPPPXPPP 951 P P P PPPP +PP P P PP PPP Sbjct: 65 PPPPSPQYSPPPPPSQSSPPRSRCPPVPTTGCCNQPPGPPP 105 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGG 885 GGG GGG G G GG G G Sbjct: 128 GGGQGGGGQGGGGGGAEGGTTG 149 >At5g22560.1 68418.m02635 hypothetical protein contains Pfam profile PF03140: Plant protein of unknown function Length = 517 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXP 934 PP +P P PPP T P P P P Sbjct: 299 PPPIETKTPPLPPPPPTLTQPHPKPLTP 326 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP 939 P PP+ PPP P P P P PPP Sbjct: 301 PIETKTPPL---PPPPPTLTQPHPKPLTPPP 328 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 PPI PP P P P P PPP Sbjct: 300 PPIETKTPPLPPPPPTLTQPHPKPLTPPP 328 >At5g19910.1 68418.m02369 SOH1 family protein contains Pfam profile: PF05669 SOH1 Length = 196 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 894 PXPQPPPPXPPXXPXXXPPPXP 959 P P+P PP PP P PP P Sbjct: 134 PLPEPVPPQPPVAPSTSLPPAP 155 >At3g55950.1 68416.m06217 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to cytokinin-regulated kinase 1 [Nicotiana tabacum] gi|10998537|gb|AAG25966 Length = 814 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +3 Query: 879 SPPXX-PXPQPPPPXPPXXPXXXPP 950 SPP P P PPPP PP PP Sbjct: 363 SPPSQFPLPPPPPPPPPSPSTSSPP 387 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 904 NPPXPXPXXPPPXPPPXXP 960 +PP P PPP PPP P Sbjct: 363 SPPSQFPLPPPPPPPPPSP 381 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPP-PXTPPXP 919 PP P P PP PPP P T P Sbjct: 364 PPSQFPLPPPPPPPPPSPSTSSPP 387 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPP 936 PP P PP P PP P PP Sbjct: 364 PPSQFPLPPPPPPPPPSPSTSSPP 387 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXP 919 PP SP PP PPPP PP P Sbjct: 66 PPHPMMFSPPPPQPPPP--PPRP 86 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP---XPPP 951 P P PPPP +PP PPP PPP Sbjct: 71 PPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPP 104 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 5/36 (13%) Frame = +1 Query: 859 PXPPIX-XPPPPXPXXNPPXPXPXXPPP----XPPP 951 P PP+ PPPP +PP PPP PPP Sbjct: 94 PPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 129 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPP 951 P P PPPP +PP PPP PPP Sbjct: 39 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 73 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPP 951 P P PPPP +PP PPP PPP Sbjct: 55 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPP 89 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPP 951 P P PPPP +PP PPP PPP Sbjct: 111 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 145 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPP 951 P P PPPP +PP PPP PPP Sbjct: 127 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 161 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/36 (38%), Positives = 16/36 (44%), Gaps = 5/36 (13%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP-----XPPP 951 P PP+ PP +PP P PPP PPP Sbjct: 78 PPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPP 113 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP---XPPP 951 P P PPPP +PP PPP PPP Sbjct: 71 PPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPP 104 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 5/36 (13%) Frame = +1 Query: 859 PXPPIX-XPPPPXPXXNPPXPXPXXPPP----XPPP 951 P PP+ PPPP +PP PPP PPP Sbjct: 94 PPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 129 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPP 951 P P PPPP +PP PPP PPP Sbjct: 39 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 73 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPP 951 P P PPPP +PP PPP PPP Sbjct: 55 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPP 89 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPP 951 P P PPPP +PP PPP PPP Sbjct: 111 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 145 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP----XPPP 951 P P PPPP +PP PPP PPP Sbjct: 127 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 161 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/36 (38%), Positives = 16/36 (44%), Gaps = 5/36 (13%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPP-----XPPP 951 P PP+ PP +PP P PPP PPP Sbjct: 78 PPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPP 113 >At1g54970.1 68414.m06278 proline-rich family protein similar to proline-rich protein GI:170048 from [Glycine max] Length = 335 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPPXPXPXXPPP 939 +P P PP+ P P P PP P PP Sbjct: 42 LPPPVYTPPVHKPTLPPPVYTPPVHKPTLSPP 73 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 853 PXPXPPIXXPPPPXPXXNPPXPXPXXPPP--XPPPXXP 960 P P+ P P P PP P PPP PP P Sbjct: 31 PVYTSPVNKPTLPPPVYTPPVHKPTLPPPVYTPPVHKP 68 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 858 PXXPXXLSPPXXPXPQPPPPXPPXXPXXXPPP 953 P LSPP P PPP P PPP Sbjct: 160 PVYKPTLSPPVYTKPTLPPPVYKKSPSYSPPP 191 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNPP-XPXPXXPPPXPPP 951 V P PP+ PP P +PP P PPP P Sbjct: 51 VHKPTLPPPVYTPPVHKPTLSPPVYTKPTLPPPAYTP 87 >At1g47660.1 68414.m05295 hypothetical protein Length = 275 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 P P PPP P P P P PP P Sbjct: 31 PARPTTPPPARPTTPPPVWPTTPPPAGAP 59 >At1g15130.1 68414.m01807 hydroxyproline-rich glycoprotein family protein Length = 846 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPP 949 P P + PP PP P P P P PP Sbjct: 737 PSVHQPTASSPPPPPETQNPSHPHPHAPYYRPP 769 >At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein similar to SP|Q15459 Splicing factor 3 subunit 1 (Spliceosome associated protein 114) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01805: Surp module Length = 785 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 883 PPPXPXXNPPXPXPXXPPPXP 945 PPP P PP P PPP P Sbjct: 654 PPPMPGMAPPPPPEEAPPPLP 674 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXP--XXNPPXPXPXXPPPXPP 948 +P P P PI P PP P N P P P P P Sbjct: 545 LPPPRPGVPIVRPLPPPPNLALNLPRPPPSAQYPGAP 581 >At3g05470.1 68416.m00599 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 884 Score = 25.8 bits (54), Expect(2) = 1.8 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 904 NPPXPXPXXPPPXPPP 951 N P P PPP PPP Sbjct: 420 NVPNSQPRPPPPPPPP 435 Score = 23.0 bits (47), Expect(2) = 1.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXP 897 V P P PP PPPP P Sbjct: 365 VSAPPPPPP---PPPPLP 379 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 7/45 (15%) Frame = +1 Query: 847 PXPXPXPPIXXPPPPXPXX-------NPPXPXPXXPPPXPPPXXP 960 P P P PP PP +PP P P PPP PP P Sbjct: 124 PPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPP--PPPPPPTITP 166 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPP--XPXPXXPXXXPPPXXP 961 P P PP PPP TPP PPP P Sbjct: 152 PPPPPPPPPPPTITPPVTTTTTGHHHHRPPPPPP 185 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 900 PQPPPPXPPXXPXXXPP 950 P PPPP PP P PP Sbjct: 120 PPPPPPPPPPPPTITPP 136 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 900 PQPPPPXPPXXPXXXPP 950 P PPPP PP P PP Sbjct: 151 PPPPPPPPPPPPTITPP 167 Score = 29.1 bits (62), Expect = 4.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPP 913 P P PP PPP TPP Sbjct: 121 PPPPPPPPPPPTITPP 136 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P PP PP T PPP P Sbjct: 120 PPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPP 156 >At4g03120.1 68417.m00425 proline-rich family protein similar to U1 small nuclear ribonucleoprotein C; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 207 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPP---XPXPXXPXXXPPPXXP 961 PP P PP P P PP P P P PP P Sbjct: 86 PPGSMPMGMRPPVLPRPMMPPQGYMPPPGVPQMMAPPGAP 125 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = +1 Query: 859 PXPPIXXPPPPXP-XXNPP-XPXPXXPPP--XPPPXXP 960 P PP+ PP P PP P P PP PPP P Sbjct: 79 PRPPMMLPPGSMPMGMRPPVLPRPMMPPQGYMPPPGVP 116 >At3g54590.1 68416.m06040 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 743 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 646 PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSP 679 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 330 PPPPYYSPSPKVDYKSPPPPYVYSSPP-PPTYSP 362 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 380 PPPPYYSPSPKVEYKSPPPPYVYSSPP-PPTYSP 412 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 80 PPPPTYSPSPKVDYKSPPPPYVYSSPPPP 108 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 105 PPPPYYSPSPKVDYKSPPPPYVYNSPPPP 133 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 130 PPPPYYSPSPKVDYKSPPPPYVYSSPPPP 158 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 155 PPPPYYSPSPKVEYKSPPPPYVYSSPPPP 183 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 180 PPPPYYSPSPKVDYKSPPPPYVYSSPPPP 208 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 205 PPPPYYSPSPKVEYKSPPPPYVYSSPPPP 233 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 230 PPPPYYSPSPKVDYKSPPPPYVYSSPPPP 258 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 255 PPPPYYSPSPKVDYKSPPPPYVYSSPPPP 283 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 280 PPPPYYSPSPKVDYKSPPPPYVYSSPPPP 308 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 305 PPPPYYSPSPKVDYKSPPPPYVYSSPPPP 333 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 355 PPPPTYSPSPKVDYKSPPPPYVYSSPPPP 383 >At3g54580.1 68416.m06039 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 951 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 671 PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSP 704 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 80 PPPPTYSPSPKVEYKSPPPPYVYSSPP-PPTYSP 112 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 105 PPPPTYSPSPKVEYKSPPPPYVYSSPP-PPTYSP 137 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 130 PPPPTYSPSPKVEYKSPPPPYVYSSPP-PPTYSP 162 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 155 PPPPTYSPSPKVEYKSPPPPYVYSSPP-PPTYSP 187 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 205 PPPPYYSPSPKVEYKSPPPPYVYSSPP-PPTYSP 237 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 255 PPPPYYSPSPKVEYKSPPPPYVYSSPP-PPTYSP 287 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 305 PPPPYYSPSPKVDYKSPPPPYVYSSPP-PPTYSP 337 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 330 PPPPTYSPSPKVEYKSPPPPYVYSSPP-PPTYSP 362 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 355 PPPPTYSPSPKVEYKSPPPPYVYSSPP-PPTYSP 387 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 380 PPPPTYSPSPKVEYKSPPPPYVYSSPP-PPTYSP 412 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 430 PPPPYYSPSPKVEYKSPPPPYVYSSPP-PPTYSP 462 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 913 PPPPYYSPSPKVEYKSPPPPYVYKSPP-PPSYSP 945 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 180 PPPPTYSPSPKVEYKSPPPPYVYSSPPPP 208 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 230 PPPPTYSPSPKVDYKSPPPPYVYSSPPPP 258 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 280 PPPPTYSPSPKVDYKSPPPPYVYSSPPPP 308 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 405 PPPPTYSPSPKVEYKSPPPPYVYSSPPPP 433 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 455 PPPPTYSPSPKVDYKSPPPPYVYSSPPPP 483 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 596 PPPPYHSPSPKVQYKSPPPPYVYSSPPPP 624 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 813 PPPPYYSPSPKVEYKSPPPPYVYSSPPPP 841 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 838 PPPPYYSPSPKVDYKSPPPPYVYSSPPPP 866 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 863 PPPPYYSPSPKVDYKSPPPPYVYSSPPPP 891 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 868 PIXXPPPPXPXXNPPXPXPXXPPPXPPP 951 PI PPP + P P PPP PPP Sbjct: 135 PITPSPPPPSKTHEPS-RPNTPPPPPPP 161 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +3 Query: 879 SPPXXPXPQPP-PPXPPXXPXXXPPPXPP 962 S P P P PP P P PPP PP Sbjct: 133 SRPITPSPPPPSKTHEPSRPNTPPPPPPP 161 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 900 PQPPPPXPPXXPXXXPPPXPP 962 P PPPP PP PP PP Sbjct: 9 PPPPPPPPPSFRSIPRPPPPP 29 >At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, putative strong similarity to L-galactono-1,4-lactone dehydrogenase, Brassica oleracea, Z97060 [gi:2760543], and gi:3986289 from Ipomea batatas Length = 610 Score = 30.3 bits (65), Expect = 2.0 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXP 923 L+PP P P+PPPP P Sbjct: 42 LTPPPPPPPRPPPPPP 57 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PPI P P +PP P PP P Sbjct: 122 PPPPIYSPSPKVDYKSPPPPYVYSSPPPP 150 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXPPPXXP 960 P PP P P +PP P PP PP P Sbjct: 980 PPPPYYSPSPKVDYKSPPPPYVYSSPP-PPSYSP 1012 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 72 PPPPYYSPSPKVEYKSPPPPYVYNSPPPP 100 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 97 PPPPYYSPSPKVDYKSPPPPYVYSSPPPP 125 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 222 PPPPYYSPSPKVDYKSPPPPYVYSSPPPP 250 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 272 PPPPYYSPSPKVDYKSPPPPYVYSSPPPP 300 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 322 PPPPYYSPTPKVDYKSPPPPYVYSSPPPP 350 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 347 PPPPYYSPSPKVDYKSPPPPYVYSSPPPP 375 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 422 PPPPYYSPSPKVDYKSPPPPYVYSSPPPP 450 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 472 PPPPYYSPSPKVDYKSPPPPYVYSSPPPP 500 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 864 PPPPYYSPSPKVDYKSPPPPYVYSSPPPP 892 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 889 PPPPYYSPSPKVDYKSPPPPYVYSSPPPP 917 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 914 PPPPYYSPSPKVDYKSPPPPYVYSSPPPP 942 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 859 PXPPIXXPPPPXPXXNPPXPXPXXPPPXP 945 P PP P P +PP P PP P Sbjct: 939 PPPPYYSPAPKVDYKSPPPPYVYSSPPPP 967 >At3g18360.1 68416.m02335 VQ motif-containing protein contains PF05678: VQ motif Length = 285 Score = 30.3 bits (65), Expect = 2.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 907 PPXPXPXXPPPXPPP 951 PP P P PPP PPP Sbjct: 201 PPQPPPHPPPPPPPP 215 >At3g15400.1 68416.m01954 anther development protein, putative similar to anther development protein ATA20 GB:AAC50042 GI:2708813 from [Arabidopsis thaliana] Length = 416 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 950 GGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXGT 843 G G G G G G G G GG G G G G+ Sbjct: 253 GSGFGEGIGSSGGSGFGEGIGSGGGTGIGIGEGIGS 288 >At3g01560.1 68416.m00086 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 511 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P P P PPP P P P PP P Sbjct: 288 PPPSHP-QPPPSNPPPYQAPQTQTPHQPSYQSPPQQP 323 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +3 Query: 858 PXXPXXLSPPXXP-XPQPPPPXPPXXPXXXPP 950 P P SPP P PQ PPP P PP Sbjct: 311 PHQPSYQSPPQQPQYPQQPPPSSGYNPEEQPP 342 >At2g28440.1 68415.m03455 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; + Length = 268 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 854 PXXXPXSPXPPXPPP-PXTPPXPXPXXPXXXPPP 952 P SP PP PPP P +P P P P P Sbjct: 137 PESLADSPSPPPPPPQPESPSSPSYPEPAPVPAP 170 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXP 959 SPP P PQP P P P P P P Sbjct: 145 SPPPPP-PQPESPSSPSYPEPAPVPAP 170 >At2g05540.1 68415.m00586 glycine-rich protein Length = 135 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -3 Query: 960 GXXGGGXXXGXXGXGXGGVXGGG-GXGGXGDXGXXXGGXXXGGG 832 G GG G G G GG GGG G G G G GGG Sbjct: 48 GGFPGGGYGGFPGGGYGGNPGGGYGNRGGGYRNRDGGYGNRGGG 91 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 959 GXXGGGXGGGXXGXGXGGLXXGXGGGGXXXGGXGXGXG 846 G GG GGG G GG GG G GG G G Sbjct: 61 GGYGGNPGGGYGNRG-GGYRNRDGGYGNRGGGYGNRGG 97 >At1g63600.1 68414.m07189 protein kinase-related low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 302 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 876 LSPPXXPXPQPPPPXPPXXPXXXPPP 953 LS P P P PPPP P P P Sbjct: 253 LSSPPPPYPSPPPPSSPLFSPLLPSP 278 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXXXPXSPXPPXPPPPXTPPXPXPXXPXXXPPPXXP 961 PP P PP PPP T P P P PP P Sbjct: 120 PPITRPPIIIPPIQPPPVTTP-PGLLPPITTPPGLLP 155 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 851 PPXXXPXSPXPPX-PPPPXTPPXPXPXXPXXXPP 949 PP P PP PPP T P P P PP Sbjct: 165 PPVTTPPGLLPPIINPPPVTVPPPSSGYPPYGPP 198 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +1 Query: 865 PPIXXPPP---PXPXXNPP-XPXPXXPPPXPPP 951 PP+ PPP P P PP P PPP P Sbjct: 108 PPVVYPPPIVRPPPITRPPIIIPPIQPPPVTTP 140 >At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family protein Length = 558 Score = 30.3 bits (65), Expect = 2.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 881 PPXPPPPXTPPXPXP 925 PP PPPP PP P P Sbjct: 258 PPTPPPPPPPPPPRP 272 Score = 29.9 bits (64), Expect = 2.6 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 866 PXSPXPPXPPPPXTPPXP 919 P +P P PPPP PP P Sbjct: 255 PFAPPTPPPPPPPPPPRP 272 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXP 935 SP P P PPPP PP P Sbjct: 254 SPFAPPTPPPPPPPPPPRP 272 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXPPPXPP 962 +PP P P PPPP P PP Sbjct: 257 APPTPPPPPPPPPPRPLAKAARAQKSPP 284 >At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi domain-containing protein similar to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}, SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1013 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 961 GGXGGGXXXGXXGGXGGGGXGXGXXGGXRXXGXXG 857 GG GGG G G GGG G G G R G G Sbjct: 22 GGGGGGGEQGRDRGYGGGEQGRG-RGSERGGGNRG 55 >At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family protein weak similarity to SP|Q00765 Polyposis locus protein 1 (TB2 protein) {Homo sapiens}; contains Pfam profile PF03134: TB2/DP1, HVA22 family Length = 315 Score = 30.3 bits (65), Expect = 2.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 881 PPXPPPPXTPPXPXP 925 PP PPPP PP P P Sbjct: 234 PPGPPPPPPPPPPSP 248 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 866 PXSPXPPXPPPPXTP 910 P P PP PPPP +P Sbjct: 234 PPGPPPPPPPPPPSP 248 >At1g17790.1 68414.m02202 DNA-binding bromodomain-containing protein similar to SP|P13709 Female sterile homeotic protein (Fragile-chorion membrane protein) {Drosophila melanogaster}; contains Pfam profile PF00439: Bromodomain Length = 487 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +1 Query: 844 VPXPXPXPPIXXPPPPXPXXNP-PXPXPXXPPPXPPPXXP 960 + P P P I P P P P P PPP PP P Sbjct: 250 IEFPAPAPSIAPIVEPLPAIVPSPSPSSPPPPPPPPVAAP 289 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 5/33 (15%) Frame = +1 Query: 583 PAPXPXX-----PXPAXAXPPXPKXPXPXXPPP 666 PAP P P PA P P P P PPP Sbjct: 253 PAPAPSIAPIVEPLPAIVPSPSPSSPPPPPPPP 285 >At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein similar to human splicing factor GB:CAA59494 GI:899298 from [Homo sapiens]; contains Pfam profile PF01805: Surp module Length = 735 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 865 PPIXXPPPPXPXXNPPXPXPXXPPP 939 PP+ PPP P P P P P P Sbjct: 642 PPMAEMPPPPPPGEAPPPLPEEPEP 666 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +1 Query: 844 VPXPX-PXPPIXX---PPPPXPXXNPPXPXPXXPPPXPPPXXP 960 VP P PP+ PPP PP P PPP P P Sbjct: 624 VPQPYGQLPPLSMGMMQPPPMAEMPPPPPPGEAPPPLPEEPEP 666 >At5g56140.1 68418.m07003 KH domain-containing protein Length = 315 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 958 GXGGGXXXGXXGGXGGGGXG 899 G GGG G GG GGGG G Sbjct: 8 GGGGGGGGGSGGGIGGGGGG 27 >At4g32340.1 68417.m04603 expressed protein Length = 238 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 947 GGXGGGXXGXGXGGLXXGXGGGGXXXGG 864 GG GG G G G G GGGG G Sbjct: 85 GGSNGGFGGRGGDGAGGGGGGGGGSVDG 112 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 854 PXXXPXSPX-PPXPPPPXTPPXPXPXXPXXXPPP 952 P P +P PP PP P +P P P PP Sbjct: 141 PPSTPSTPSSPPSPPSPPSPSLPPSSLPPSASPP 174 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +3 Query: 879 SPPXXPXPQPPPPXPPXXPXXXP-PPXPP 962 SPP P PP P P P PP PP Sbjct: 130 SPPSTPSTPSSPPSTPSTPSSPPSPPSPP 158 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,167,978 Number of Sequences: 28952 Number of extensions: 329491 Number of successful extensions: 35951 Number of sequences better than 10.0: 345 Number of HSP's better than 10.0 without gapping: 1326 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15599 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2324382072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -