BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_B04 (864 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1B2.02c |ugo1||mitochondrial fusion and transport protein Ug... 31 0.16 SPAPB1A10.07c |||sphingolipid biosynthesis protein|Schizosacchar... 29 0.64 SPBC2D10.17 |clr1||cryptic loci regulator Clr1|Schizosaccharomyc... 26 6.0 >SPAC1B2.02c |ugo1||mitochondrial fusion and transport protein Ugo1|Schizosaccharomyces pombe|chr 1|||Manual Length = 421 Score = 31.5 bits (68), Expect = 0.16 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -1 Query: 279 AIAGPALINPSRTLRPTFSIFLKSFHLGSGAALTAP 172 AIA P +I+P ++RP S+F+KS A + +P Sbjct: 202 AIADPNIISPIDSVRPLLSLFIKSITSAISALILSP 237 >SPAPB1A10.07c |||sphingolipid biosynthesis protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 441 Score = 29.5 bits (63), Expect = 0.64 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -1 Query: 126 FILPKFYSAGEFKIPNTISFDANAKNDQILRIPYSEXVV 10 F+L FY+A NT S N KND +RI +S V Sbjct: 373 FVLAAFYTASLLTNWNTTSVYENQKNDVFVRIGFSYAAV 411 >SPBC2D10.17 |clr1||cryptic loci regulator Clr1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1238 Score = 26.2 bits (55), Expect = 6.0 Identities = 15/57 (26%), Positives = 25/57 (43%) Frame = -1 Query: 183 LTAPRASTNAKTKLKIRTKFILPKFYSAGEFKIPNTISFDANAKNDQILRIPYSEXV 13 LT ++ K I + F+ G KIP SFD K+ + IP+++ + Sbjct: 842 LTKDISTVKRKEYFGIESTSSKQPFHDTGSIKIPAKRSFDTIDKDFRSSNIPFADKI 898 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,591,784 Number of Sequences: 5004 Number of extensions: 46222 Number of successful extensions: 114 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 430470850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -