BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_B04 (864 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g24330.1 68416.m03055 glycosyl hydrolase family 17 protein si... 28 9.2 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 28 9.2 >At3g24330.1 68416.m03055 glycosyl hydrolase family 17 protein similar to elicitor inducible chitinase Nt-SubE76 GI:11071974 from [Nicotiana tabacum] Length = 500 Score = 27.9 bits (59), Expect = 9.2 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 5/44 (11%) Frame = -1 Query: 408 FR*DLRSFKLEIHNYLQ-----YCFKLNASLVLYHEVYFPKDFA 292 FR +LR +EI N+L + + L LY YFP DFA Sbjct: 192 FRPELRDATIEIINFLYSHDSPFTVNIYPFLSLYGNAYFPLDFA 235 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = -1 Query: 168 ASTNAKTKLKIRTKFILPKFYSAGEFKIPNTISFDANAKN 49 AS N TKL++ K+ + Y +GE + P +S +AK+ Sbjct: 477 ASANEHTKLQVDDKYPIILLYKSGEKEKPLKLSTKLSAKD 516 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,252,571 Number of Sequences: 28952 Number of extensions: 228112 Number of successful extensions: 447 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 440 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 447 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2019160800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -