BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_B03 (851 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 29 0.24 AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein p... 28 0.41 AY017417-1|AAG54081.1| 383|Anopheles gambiae arrestin protein. 25 3.9 AJ304409-1|CAC39103.2| 383|Anopheles gambiae arrestin protein. 25 3.9 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 6.7 AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. 24 6.7 CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline... 23 8.9 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 23 8.9 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 28.7 bits (61), Expect = 0.24 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 412 QAHKQKGPSRPQVDRPTKPQQNCIR*LQRQNQQESLLEVYPRVGKQ-QSLL 561 Q +Q+ RPQ RP + + R QR+ + L+EV P G+ +SLL Sbjct: 463 QQPQQQQQQRPQQQRPQQQRPQQQRSQQRKPAKPELIEVSPNEGQDWESLL 513 Score = 24.6 bits (51), Expect = 3.9 Identities = 24/106 (22%), Positives = 40/106 (37%) Frame = +1 Query: 268 QGSREASDRKRQEEHHGLRLPVMDKGWKGNRQILLPHPV*SDLHRADCQAHKQKGPSRPQ 447 QG R + RQ+ R + + +Q V L + Q Q+ + Q Sbjct: 260 QGERYVPPQLRQQRQQQQRPRQQQQQQQQQQQQQGERYVPPQLRQQRQQQQHQQQQQQQQ 319 Query: 448 VDRPTKPQQNCIR*LQRQNQQESLLEVYPRVGKQQSLLQDHVHRGQ 585 R + +Q + QRQ QQ+ + + +QQ Q H+ Q Sbjct: 320 QQRQQQQRQQQRQQQQRQQQQQQQQQQRQQQQRQQQQQQQQQHQQQ 365 >AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein protein. Length = 285 Score = 27.9 bits (59), Expect = 0.41 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +3 Query: 135 LTPHLHQELMTYWRSSCI*VSSLVNTRPLSPN 230 L P HQE MT WR + RP +P+ Sbjct: 100 LAPMSHQETMTLWREVAAALDGKAKCRPRTPS 131 >AY017417-1|AAG54081.1| 383|Anopheles gambiae arrestin protein. Length = 383 Score = 24.6 bits (51), Expect = 3.9 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -2 Query: 673 SGVEGVSGAITVDDTVIXRTFRVI-ELQVLFVLGGHDLEVNSVVFQ 539 SGVE + G + +DD I +V ++ F G + EV + FQ Sbjct: 31 SGVEPIDGIVVLDDEYIRDNRKVFGQIVCSFRYGREEDEVMGLNFQ 76 >AJ304409-1|CAC39103.2| 383|Anopheles gambiae arrestin protein. Length = 383 Score = 24.6 bits (51), Expect = 3.9 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -2 Query: 673 SGVEGVSGAITVDDTVIXRTFRVI-ELQVLFVLGGHDLEVNSVVFQ 539 SGVE + G + +DD I +V ++ F G + EV + FQ Sbjct: 31 SGVEPIDGIVVLDDEYIRDNRKVFGQIVCSFRYGREEDEVMGLNFQ 76 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.8 bits (49), Expect = 6.7 Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = -2 Query: 214 LVFTNDDTHIQLLR---QYVISSWCKCGVRSQRTHGEDEGKQS 95 LV N+ +QL +++S+WC + TH D K S Sbjct: 1408 LVNLNNQKRVQLTGAKVHHIMSNWCYAEMTIDTTHTADGSKLS 1450 >AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. Length = 163 Score = 23.8 bits (49), Expect = 6.7 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -3 Query: 219 AVSYSPMTTLIYSCSASTSSVLGASVA 139 A+S SP++ + SASTS+ ASV+ Sbjct: 87 ALSLSPVSVSKFDTSASTSNSSNASVS 113 >CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline phosphatase protein. Length = 548 Score = 23.4 bits (48), Expect = 8.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 142 GVRSQRTHGEDEGKQSQSH 86 G+R +RT GED K Q H Sbjct: 284 GIRGRRTDGEDLIKHWQHH 302 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 23.4 bits (48), Expect = 8.9 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 185 YMSVVIGEYETAIAKCSEYLKEKKGEV 265 YM +I + E +C + LKEK +V Sbjct: 550 YMEAIIVDTEKTARRCIQILKEKMLDV 576 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 864,472 Number of Sequences: 2352 Number of extensions: 18766 Number of successful extensions: 64 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90545769 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -