BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_B02 (871 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; ... 71 5e-11 UniRef50_Q1YKB3 Cluster: Putative uncharacterized protein; n=1; ... 34 4.1 UniRef50_Q0BU79 Cluster: Hypothetical cytosolic protein; n=1; Gr... 34 5.4 >UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; Bombycoidea|Rep: Putative uncharacterized protein - Lonomia obliqua (Moth) Length = 74 Score = 70.5 bits (165), Expect = 5e-11 Identities = 33/58 (56%), Positives = 40/58 (68%) Frame = +1 Query: 202 IYGTGGLLTPLVAPVLXXXXXXXXXXXXXXXXXXYYGNLVAGSIVSQLTAAAMVAPTP 375 IYGTGGLLTP+VAP+L YYGN+VAGS++SQLT+AAM+APTP Sbjct: 17 IYGTGGLLTPIVAPMLGFGSAGIAAGSTAAAAQAYYGNVVAGSVISQLTSAAMLAPTP 74 >UniRef50_Q1YKB3 Cluster: Putative uncharacterized protein; n=1; Aurantimonas sp. SI85-9A1|Rep: Putative uncharacterized protein - Aurantimonas sp. SI85-9A1 Length = 215 Score = 34.3 bits (75), Expect = 4.1 Identities = 23/74 (31%), Positives = 31/74 (41%), Gaps = 2/74 (2%) Frame = +3 Query: 156 GASSCISGKRGRRCCNIWHWGSVDSISGSRARFQLSGNS-GRKHSRCCTSILRKFSGR-Q 329 G S G GR+ + +G R+ + SGN G+ R C + GR Q Sbjct: 45 GEQSLAPGNSGRQITGKQKRSNNGQEAGQRSEPRHSGNERGKAEQRWCVDESNRRGGRSQ 104 Query: 330 HCVTVDCCCHGSPH 371 CV CHGSP+ Sbjct: 105 LCVAAAMRCHGSPN 118 >UniRef50_Q0BU79 Cluster: Hypothetical cytosolic protein; n=1; Granulibacter bethesdensis CGDNIH1|Rep: Hypothetical cytosolic protein - Granulobacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) Length = 90 Score = 33.9 bits (74), Expect = 5.4 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +3 Query: 138 QKLKEHGA--SSCISGKRGRRCCNIWHWGSVDSISGSRAR 251 Q L+EHG S ++G+R RC N WH G D + R R Sbjct: 42 QALREHGTFQGSMLAGRRILRC-NPWHQGGYDPVPAGRCR 80 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 687,669,643 Number of Sequences: 1657284 Number of extensions: 11186557 Number of successful extensions: 20463 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19580 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20448 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 77472727479 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -