BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_B01 (913 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 5.8 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 22 5.8 EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 22 7.6 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 22 7.6 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/25 (36%), Positives = 10/25 (40%) Frame = +1 Query: 817 PPPXPXPXAXPXRPAPXPPPPXXPP 891 PPP P A P + P PP Sbjct: 11 PPPAPQSAATPISSSGMTSPAAAPP 35 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 22.2 bits (45), Expect = 5.8 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +3 Query: 513 PNXPXXPPPPXPPTXP 560 P P PP P PP P Sbjct: 175 PPLPQVPPLPLPPIFP 190 Score = 21.8 bits (44), Expect = 7.6 Identities = 14/44 (31%), Positives = 15/44 (34%), Gaps = 1/44 (2%) Frame = +1 Query: 778 PPPXXXHXTPHXPPPPXPXPXAXPX-RPAPXPPPPXXPPTPPXP 906 P P P PP P + P P PP PPT P Sbjct: 153 PNPSIIDPGPALPPTGFLCNNYPPLPQVPPLPLPPIFPPTMINP 196 Score = 21.8 bits (44), Expect = 7.6 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +2 Query: 569 PPPPXPPXPXPPGXXXPPAHKTPT 640 P P PP P PP PP P+ Sbjct: 176 PLPQVPPLPLPP--IFPPTMINPS 197 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 21.8 bits (44), Expect = 7.6 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 533 PPXXXPHXPXTTPPPP 580 PP P T PPPP Sbjct: 202 PPTEDCDVPSTIPPPP 217 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 21.8 bits (44), Expect = 7.6 Identities = 13/42 (30%), Positives = 13/42 (30%), Gaps = 3/42 (7%) Frame = +1 Query: 796 HXTPHXP---PPPXPXPXAXPXRPAPXPPPPXXPPTPPXPPP 912 H P P PP P P P TPP P P Sbjct: 62 HKAPIRPVALPPKREIPSPKRSSPILAEKVSVSPTTPPTPSP 103 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.313 0.142 0.497 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,564 Number of Sequences: 336 Number of extensions: 3147 Number of successful extensions: 16 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25444518 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -