BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A23 (882 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700,336... 29 3.7 05_01_0460 - 3644229-3644420,3644623-3644865,3644959-3645237,364... 29 3.7 04_03_0513 - 16681227-16683936,16685572-16685966 29 3.7 05_04_0191 + 18927302-18927707,18928747-18928979,18929062-189291... 28 8.6 >06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700, 3363820-3364098,3364189-3364386,3364475-3365110, 3365209-3365463,3365579-3365685,3365770-3369566, 3369677-3370166,3370918-3371308,3371481-3371573, 3371687-3371810,3372544-3372791 Length = 2380 Score = 29.5 bits (63), Expect = 3.7 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +3 Query: 720 PNNEDRIAYLTERCWPK 770 PNNE+ + Y ++CWP+ Sbjct: 1134 PNNENMVGYNNKKCWPR 1150 >05_01_0460 - 3644229-3644420,3644623-3644865,3644959-3645237, 3645328-3645525,3645614-3646249,3646352-3646606, 3646718-3646824,3646909-3650705,3650816-3651305, 3652043-3652433,3652621-3652713,3652818-3652941, 3653871-3654118 Length = 2350 Score = 29.5 bits (63), Expect = 3.7 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +3 Query: 720 PNNEDRIAYLTERCWPK 770 PNNE+ + Y ++CWP+ Sbjct: 1134 PNNENMVGYNNKKCWPR 1150 >04_03_0513 - 16681227-16683936,16685572-16685966 Length = 1034 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +2 Query: 266 QQGLLHKHESLRKFHDDVQGRIPSQEFGILDLL 364 Q G+LH+ ESL +D+ G IP QE LD L Sbjct: 905 QLGMLHQLESLDLSSNDLSGEIP-QELASLDFL 936 >05_04_0191 + 18927302-18927707,18928747-18928979,18929062-18929127, 18929262-18929340,18929935-18930014,18930099-18930122, 18930254-18930375,18930902-18931109,18931960-18932006, 18932914-18932998,18933292-18933355,18933488-18933609 Length = 511 Score = 28.3 bits (60), Expect = 8.6 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = +3 Query: 630 DEKICYNYGIIKENEQFVM 686 DE +C+ YG ++ENE +++ Sbjct: 459 DEVLCWLYGTVRENEDYIL 477 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,492,762 Number of Sequences: 37544 Number of extensions: 418060 Number of successful extensions: 915 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 897 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 915 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2491484208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -