BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A20 (905 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 25 0.62 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 24 1.4 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 3.3 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 22 7.6 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 25.4 bits (53), Expect = 0.62 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 327 CPCTHSSSVQTPSTSGILCLEEKQQPEL 244 C CTH + + I+ ++E QQP L Sbjct: 566 CMCTHKVDIPLNAIVEIVLVDEVQQPNL 593 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 24.2 bits (50), Expect = 1.4 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +3 Query: 351 SRTRIMHKNLKAKEEGQCSNGSCKI 425 ++TR++H++L A+ C N + K+ Sbjct: 609 AKTRVVHRDLAARNVLVCENHTVKV 633 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 23.0 bits (47), Expect = 3.3 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = -3 Query: 327 CPCTHSSSVQTPSTSGILCLEEKQQPEL 244 C CTH + + ++ ++E Q P L Sbjct: 566 CMCTHQVDIPLNAIVEVVLVDEVQSPNL 593 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 21.8 bits (44), Expect = 7.6 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Frame = +1 Query: 295 SLDTGAMSARANARS*FVLHVHESCIRI*KPKKKVNAAMAAARY---PNKKK 441 S+D GA+ A ++ +L E C+++ P+K AA R P+K+K Sbjct: 311 SID-GALEAGPYSKEEGLLSYPEVCVKLANPQKLTTAAGKHLRKVGDPSKRK 361 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,247 Number of Sequences: 336 Number of extensions: 2898 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25237652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -