BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A20 (905 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 35 0.003 AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein p... 30 0.084 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 30 0.084 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 30 0.11 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 29 0.26 AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein p... 28 0.34 AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 28 0.45 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 28 0.45 AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 27 0.59 AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein p... 27 0.78 AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein p... 27 1.0 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 27 1.0 AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein p... 25 2.4 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 25 3.2 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 25 3.2 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 25 3.2 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 25 4.2 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 35.1 bits (77), Expect = 0.003 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = +3 Query: 273 IRCQKCLEFGHWSYECK 323 +RC +CLE GHW+++C+ Sbjct: 660 VRCYRCLELGHWAHDCR 676 >AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein protein. Length = 285 Score = 30.3 bits (65), Expect = 0.084 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +3 Query: 276 RCQKCLEFGHWSYECKGKRKILVRPSRTRIMHKNLKAKEEGQCS 407 +C +C E+GH + C GK R+ H+ + K EG C+ Sbjct: 213 QCYRCYEYGHTAARCHGK-------DRSSKCHRCAEDKHEGPCT 249 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 30.3 bits (65), Expect = 0.084 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +3 Query: 276 RCQKCLEFGHWSYECKG 326 RC KC E GH+S +CKG Sbjct: 417 RCFKCWETGHFSRDCKG 433 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 29.9 bits (64), Expect = 0.11 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +3 Query: 264 PQGIRCQKCLEFGHWSYECKG---KRKILVRPSRTRIMHKNLKAKEEGQCS 407 P+ RC +CLE GH + C+ ++ + +R T HK + E +C+ Sbjct: 503 PERQRCFRCLEMGHIASNCRSTADRQNLCIRCGLTG--HKARSCQNEAKCA 551 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 28.7 bits (61), Expect = 0.26 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = +3 Query: 273 IRCQKCLEFGHWSYECKG---KRKILVRPSRTRIMHKNLKAKEEGQCSNGSCKIP 428 +RC +CLE GH + +C+ ++ + +R + HK EE +C G C P Sbjct: 549 LRCYRCLEHGHNARDCRSPVDRQNVCIRCGQEG--HKAGTCMEEIRC--GKCDGP 599 >AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein protein. Length = 298 Score = 28.3 bits (60), Expect = 0.34 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +3 Query: 276 RCQKCLEFGHWSYECKGKRKILVRPSRTRIMHKNLKAKEEGQC 404 RC +CLE GH EC+G + + HK + + +C Sbjct: 235 RCFRCLERGHMVRECQGTNRSSLCIRCGAANHKAVNCTNDVKC 277 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 27.9 bits (59), Expect = 0.45 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +3 Query: 273 IRCQKCLEFGHWSYECKGK 329 +RC +CLE GH + +C G+ Sbjct: 289 VRCFRCLERGHTTADCAGE 307 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 27.9 bits (59), Expect = 0.45 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 264 PQGIRCQKCLEFGHWSYECK 323 P+ RC +CLE GH ++ C+ Sbjct: 472 PERQRCYRCLERGHLAHACR 491 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 27.5 bits (58), Expect = 0.59 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 273 IRCQKCLEFGHWSYECKGK 329 ++C KC + GH +EC G+ Sbjct: 328 VKCFKCWKLGHKGFECTGQ 346 >AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein protein. Length = 344 Score = 27.1 bits (57), Expect = 0.78 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +3 Query: 276 RCQKCLEFGHWSYECKGKRKILVRPSRTRIMHK-NLKAKEEGQCSN 410 +C KC + GH SY C+ P R+ + K L ++ C+N Sbjct: 276 KCYKCWKVGHTSYHCR-------EPDRSNLCWKCGLSGHKKQACTN 314 >AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein protein. Length = 429 Score = 26.6 bits (56), Expect = 1.0 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 276 RCQKCLEFGHWSYECK 323 RC +CLE GH + EC+ Sbjct: 363 RCYRCLERGHIARECR 378 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 26.6 bits (56), Expect = 1.0 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 273 IRCQKCLEFGHWSYEC 320 +RC +CLE GH S +C Sbjct: 404 LRCYRCLERGHVSRDC 419 >AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein protein. Length = 455 Score = 25.4 bits (53), Expect = 2.4 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 276 RCQKCLEFGHWSYECK 323 RC +CLE GH + +C+ Sbjct: 389 RCYRCLERGHLARDCQ 404 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 25.0 bits (52), Expect = 3.2 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -3 Query: 327 CPCTHSSSVQTPSTSGILCLEEKQQPEL 244 C CTH + + ++ ++E QQP L Sbjct: 608 CMCTHKVDIPLNAIVEVVLVDEVQQPNL 635 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 25.0 bits (52), Expect = 3.2 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 264 EKQQPELLAFSSQPDACYMFPESYSESQR 178 E+QQ A ++QPD PE +E++R Sbjct: 1019 EEQQTLAAAEAAQPDPASSLPEDMAEAER 1047 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 25.0 bits (52), Expect = 3.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 276 RCQKCLEFGHWSYECKGK 329 RC +CLE GH + C G+ Sbjct: 465 RCFRCLERGHIAATCTGE 482 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 24.6 bits (51), Expect = 4.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -1 Query: 152 LNICLELYCSNCNRSSIKI 96 L C+E++CS C R+ + I Sbjct: 792 LQDCIEIFCSWCKRNGLTI 810 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 707,784 Number of Sequences: 2352 Number of extensions: 11854 Number of successful extensions: 36 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97987887 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -