BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A19 (1042 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 41 3e-04 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 36 0.012 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 31 0.014 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 35 0.022 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 34 0.029 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 33 0.066 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 33 0.088 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 33 0.088 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 32 0.15 SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 31 0.20 SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex p... 31 0.35 SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1... 28 1.9 SPBC902.04 |||RNA-binding protein|Schizosaccharomyces pombe|chr ... 27 3.3 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 27 5.8 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 27 5.8 SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|S... 26 7.6 SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccha... 26 7.6 SPAC26A3.09c |rga2||GTPase activating protein Rga2|Schizosacchar... 26 7.6 SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1... 26 7.6 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 41.1 bits (92), Expect = 3e-04 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P PPP P PPPPPP P GP PP Sbjct: 744 PAPAPIPVPPPAPIMGGPPPPPP--PPGVAGAGPPPP 778 Score = 40.3 bits (90), Expect = 4e-04 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 PPPPP P P P P PP G PP G A A PP P Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 38.3 bits (85), Expect = 0.002 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRG 133 P P PPP P P PPPPPP P PP G Sbjct: 746 PAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPAVSAG 788 Score = 32.3 bits (70), Expect = 0.12 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP-PPPPPXNXPPXTXRGPR 109 P PPPPP P PPPPP P + G R Sbjct: 756 PIMGGPPPPPPPPGVAGAGPPPPPPPPPAVSAGGSR 791 Score = 30.7 bits (66), Expect = 0.35 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXPA 707 PP PPP A P P PP PA Sbjct: 761 PPPPPPPPGVAGAGPPPPPPPPPA 784 Score = 27.9 bits (59), Expect = 2.5 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 4/36 (11%) Frame = +1 Query: 19 PPXPPP----PPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PPP P P P PP P PP P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPP 767 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 35.5 bits (78), Expect = 0.012 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXP 84 P P PPPPPP PP PP P Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPP 29 Score = 33.9 bits (74), Expect = 0.038 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 41 PXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPPPP PP P PP Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 31.9 bits (69), Expect = 0.15 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP 73 P PPPPP P PPPPP Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPP 28 Score = 30.7 bits (66), Expect = 0.35 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXG 102 PP PPPPP P PP + P P G Sbjct: 5 PPGNPPPPPP-PPGFEPPSQPPPPPPPG 31 Score = 30.7 bits (66), Expect = 0.35 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXP--XPPPPPP 73 P PPPPP P PPPPPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPP 29 Score = 29.1 bits (62), Expect = 1.1 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 41 PXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPPPP P + P PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPP 29 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 31.1 bits (67), Expect = 0.27 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 1/56 (1%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP-PXLXXRGXASAAGXDPPXLXP 175 P P P PPPPPP P T P P S PP P Sbjct: 224 PPTYTPKQADPLPAPPPPPPPTLPPQSTNTSQLPMPSRNVNNLGSQVNIPPPPATP 279 Score = 27.9 bits (59), Expect(2) = 0.014 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +1 Query: 22 PXPPPPPPXXXPP 60 P PPPPPP PP Sbjct: 236 PAPPPPPPPTLPP 248 Score = 26.2 bits (55), Expect(2) = 0.014 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 19 PPXPPPPPP 45 PP PPPPPP Sbjct: 189 PPPPPPPPP 197 Score = 26.2 bits (55), Expect = 7.6 Identities = 16/53 (30%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +3 Query: 864 PPRPPXPPXXTXXXXXXXXXXA---LXPXXXXPPPPGXXARXXXPPXAAXTRA 1013 PP P PP T L PPPP ++ PP A TR+ Sbjct: 241 PPPPTLPPQSTNTSQLPMPSRNVNNLGSQVNIPPPPATPSQPPRPPTNASTRS 293 Score = 25.8 bits (54), Expect(2) = 0.67 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 32 PPXPXXPXPPPPPPXN 79 PP P P PP PP N Sbjct: 273 PPPPATPSQPPRPPTN 288 Score = 22.2 bits (45), Expect(2) = 0.67 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 5 PXPXXXPPPPP 37 P P PPPPP Sbjct: 234 PLPAPPPPPPP 244 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 34.7 bits (76), Expect = 0.022 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +1 Query: 28 PPPPPPXXXPPXTPPXEXPT--XXPXGPP 108 PPPPPP P PP PT P GPP Sbjct: 1882 PPPPPPMALPKAGPPSAAPTSALPPAGPP 1910 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 34.3 bits (75), Expect = 0.029 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG P GG G G F GG GG G G GGG G G Sbjct: 194 GGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGFGGG 250 Score = 31.5 bits (68), Expect = 0.20 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGG-GXGXXGXGGG-GGXXXGXG 4 GG G G F GG GG G G G GGG GG G G Sbjct: 221 GGHGGFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGGGPG 259 Score = 27.5 bits (58), Expect = 3.3 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 105 GPRXVXGGXFXGGGG-GGXGXXGXGGGGGXXXGXG 4 GP GG GGG GG G G GG GG G G Sbjct: 236 GPGGFGGGPGGFGGGLGGFG-GGPGGFGGGPGGHG 269 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 33.1 bits (72), Expect = 0.066 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PP P P PP PPP PP Sbjct: 1172 PAPSSGIPPVPKPAAGVPPVPPPSEAPP 1199 Score = 31.9 bits (69), Expect = 0.15 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPP-XTXRGPRPP 115 P PP P P PP PPP PP T PP Sbjct: 1193 PPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPP 1228 Score = 31.1 bits (67), Expect = 0.27 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PP P P PP P P PP Sbjct: 1095 PKPSVAAPPVPKPSVAVPPVPAPSGAPP 1122 Score = 30.3 bits (65), Expect = 0.47 Identities = 16/50 (32%), Positives = 18/50 (36%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 PP P P PP P P PP PP + + A PP P Sbjct: 1022 PPVPLPSADAPPIPVPSTAPPVPIPTSTPP--VPKSSSGAPSAPPPVPAP 1069 Score = 30.3 bits (65), Expect = 0.47 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P P P P P PP PP Sbjct: 1182 PKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPP 1218 Score = 29.5 bits (63), Expect = 0.82 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P P P P P PP PP Sbjct: 1124 PKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPP 1160 Score = 29.5 bits (63), Expect = 0.82 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP-PPPPXNXPPXTXRGPRPP 115 P P PP P P PP P P PP PP Sbjct: 1162 PKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPP 1199 Score = 29.1 bits (62), Expect = 1.1 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P P P P P PP PP Sbjct: 1105 PKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPP 1141 Score = 28.3 bits (60), Expect = 1.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPP P P P P P PP PP Sbjct: 1063 PPPVPAPSSEIPSIPAPSGAPPVPAPSGIPP 1093 Score = 28.3 bits (60), Expect = 1.9 Identities = 17/52 (32%), Positives = 20/52 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDP 160 P P PP P P PP P P PP P+P A ++G P Sbjct: 1134 PVPSGA-PPVPKPSVAAPPVPAPSGAPPV----PKPSVAAPPVPAPSSGIPP 1180 Score = 27.9 bits (59), Expect = 2.5 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP +P P PP P Sbjct: 1208 PPVPPPSTAPPVPTPSAGLPPVP 1230 Score = 27.5 bits (58), Expect = 3.3 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP +P P PP P Sbjct: 1189 PPVPPPSEAPPVPKPSVGVPPVP 1211 Score = 27.5 bits (58), Expect = 3.3 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PP P P PP P P + P Sbjct: 1220 PTPSAGLPPVPVPTAKAPPVPAPSSEAP 1247 Score = 26.6 bits (56), Expect = 5.8 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PPP P +P E P P P Sbjct: 963 PAAPPSIPPPLPVSNILSSPTSEPPKDHPPSAP 995 Score = 26.6 bits (56), Expect = 5.8 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXPA 707 PP P P +P P PP PA Sbjct: 1150 PPVPAPSGAPPVPKPSVAAPPVPA 1173 Score = 26.2 bits (55), Expect = 7.6 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 3/32 (9%) Frame = +1 Query: 19 PPXPPPP---PPXXXPPXTPPXEXPTXXPXGP 105 PP P P PP P PP PT P P Sbjct: 1022 PPVPLPSADAPPIPVPSTAPPVPIPTSTPPVP 1053 Score = 26.2 bits (55), Expect = 7.6 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PP P P PP P P + PP Sbjct: 1025 PLPSADAPPIPVP-STAPPVPIPTSTPP 1051 Score = 26.2 bits (55), Expect = 7.6 Identities = 12/37 (32%), Positives = 12/37 (32%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P P P P PP PP Sbjct: 1086 PAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPP 1122 Score = 26.2 bits (55), Expect = 7.6 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXPA 707 PP P P +P P PP PA Sbjct: 1131 PPVPVPSGAPPVPKPSVAAPPVPA 1154 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 32.7 bits (71), Expect = 0.088 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PPPP PP PP P P PP P Sbjct: 1705 PTPPPPPMSVPPPPSAPP--MPAGPPSAPPPP 1734 Score = 32.3 bits (70), Expect = 0.12 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 PPPPP P P PP PP P P Sbjct: 1707 PPPPPMSVPPPPSAPPMPAGPPSAPPPPLP 1736 Score = 31.5 bits (68), Expect = 0.20 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP--PPPXNXPPXTXRGPRP 112 P P PPPP P P PP PPP P P Sbjct: 1709 PPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 30.3 bits (65), Expect = 0.47 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P P PP P P PPP P + P G R L Sbjct: 1715 PPPPSAPPMPAGPPSAPPPPLPASSAPSVPNPGDRSALL 1753 Score = 27.9 bits (59), Expect = 2.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXP 96 T P P PPPP P PP P P Sbjct: 1706 TPPPPPMSVPPPPSAPPMPAGPPSAPPPPLP 1736 Score = 27.5 bits (58), Expect = 3.3 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 32 PPXPXXPXPPPPPPXNXPPXTXRGPRP 112 PP P PPPPP + PP P P Sbjct: 1699 PPQMSAPTPPPPPM-SVPPPPSAPPMP 1724 Score = 26.6 bits (56), Expect = 5.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T P P PP P PP P P PP P Sbjct: 1689 TPPVRPQSAAPPQMSAPTPPPPPMSVP-PPPSAPPMP 1724 Score = 26.2 bits (55), Expect = 7.6 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 1/22 (4%) Frame = +3 Query: 645 PPPXASPXXA-XPXXPXPPXPA 707 PPP A P A P P PP PA Sbjct: 1716 PPPSAPPMPAGPPSAPPPPLPA 1737 Score = 24.6 bits (51), Expect(2) = 0.51 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 502 GPXXRPPPPXPXPAAXPXP 558 GP PPPP P +A P Sbjct: 1726 GPPSAPPPPLPASSAPSVP 1744 Score = 23.8 bits (49), Expect(2) = 0.51 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 370 PXPXPPPXXPXPPP 411 P P PPP PPP Sbjct: 1705 PTPPPPPMSVPPPP 1718 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 32.7 bits (71), Expect = 0.088 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PP P PP PP P P PP P Sbjct: 420 PPSLPPSAPPSLPPSAPP-SLPMGAPAAPPLP 450 Score = 31.9 bits (69), Expect = 0.15 Identities = 21/58 (36%), Positives = 23/58 (39%), Gaps = 12/58 (20%) Frame = +2 Query: 23 PPPPPXPXX------PXPP------PPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDP 160 PPPPP P P PP PPPP P T R P PP R ++ P Sbjct: 337 PPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQP-PPLSSSRAVSNPPAPPP 393 Score = 28.3 bits (60), Expect = 1.9 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +1 Query: 40 PPXXXPPXTPPXEXPTXXPXGPP 108 PP PP PP P+ P PP Sbjct: 415 PPVPTPPSLPPSAPPSLPPSAPP 437 Score = 28.3 bits (60), Expect = 1.9 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXP-XXPXPPPPPPXNXPPXTXRGPRP 112 P P P PP P P PP PP P P P Sbjct: 448 PLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPAP 484 Score = 27.9 bits (59), Expect = 2.5 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 T PP PP P P P P P PP Sbjct: 225 TSTSAPPIPPSIPSSRPPERVPSLSAPAPPPIPPP 259 Score = 27.9 bits (59), Expect = 2.5 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 28 PPPPPPXXXPPXTPPXEXPTXXPXGP 105 PP P P PP PP P+ P P Sbjct: 415 PPVPTPPSLPPSAPPSLPPSAPPSLP 440 Score = 27.5 bits (58), Expect = 3.3 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPPP P PP N + P PP Sbjct: 311 PPPPPPPSRRNRGKPPIGNGSSNSSLPPPPP 341 Score = 26.6 bits (56), Expect = 5.8 Identities = 12/37 (32%), Positives = 12/37 (32%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P P PP P P P P Sbjct: 418 PTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAP 454 Score = 26.2 bits (55), Expect = 7.6 Identities = 13/38 (34%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP-PPPPPXNXPPXTXRGPRPP 115 P PPPPP P PPP + P PP Sbjct: 355 PQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPP 392 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 31.9 bits (69), Expect = 0.15 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPR-PPXLXXRGXASAAGXDPP 163 PP P P PPP P + PP + P P L +A PP Sbjct: 139 PPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPP 185 Score = 27.5 bits (58), Expect = 3.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 50 PXPPPPPPXNXPPXTXRGPRPPXL 121 P PPPPPP P P PP + Sbjct: 3 PAPPPPPP--APAPAAAAPAPPLM 24 Score = 27.5 bits (58), Expect = 3.3 Identities = 18/60 (30%), Positives = 19/60 (31%), Gaps = 3/60 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP---PPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P PPP P P P PP P PP P SA PP + P Sbjct: 144 PPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPP 203 Score = 26.6 bits (56), Expect = 5.8 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 22 PXPPPPPPXXXPPXTPP 72 P PPPPPP P P Sbjct: 3 PAPPPPPPAPAPAAAAP 19 Score = 26.2 bits (55), Expect = 7.6 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPP 73 PPPPP P P PP Sbjct: 6 PPPPPAPAPAAAAPAPP 22 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 31.5 bits (68), Expect = 0.20 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GGRG G F GG GG G G GGG G Sbjct: 9 GGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARG 45 Score = 30.3 bits (65), Expect = 0.47 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G G GG GG GG GG GG G Sbjct: 27 GFGGGRGGARGGGRGGARGG--RGGRGGARGGRGG 59 Score = 29.9 bits (64), Expect = 0.62 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 129 RXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 R G RG R G G GGG G G GG GG G G Sbjct: 8 RGGRGGSRGGRGGFNGGRGGFGGGRGGARG-GGRGGARGGRG 48 Score = 29.9 bits (64), Expect = 0.62 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 129 RXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 R GGRG G F GGG GG G GG G G G Sbjct: 11 RGGSRGGRGGFNGGRGGF-GGGRGGARGGGRGGARGGRGGRG 51 Score = 29.9 bits (64), Expect = 0.62 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 129 RXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 R GGRG G GGG GG G GG GG G G Sbjct: 18 RGGFNGGRGGFGGGRGGARGGGRGG-ARGGRGGRGGARGGRG 58 Score = 28.7 bits (61), Expect = 1.4 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGG 28 GG A R GGRG R GG G GG G G GG Sbjct: 29 GGGRGGARGGGRGGARGGRGGR---GGARGGRGGSSGGRGGAKGG 70 Score = 27.1 bits (57), Expect = 4.4 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 129 RXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 R GGRG G GG GG G GG GG G G Sbjct: 25 RGGFGGGRGGARGGGRGGARGGRGGRG-GARGGRGGSSGGRG 65 Score = 26.6 bits (56), Expect = 5.8 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G G GG GG GG GG GG G Sbjct: 39 GRGGARGGRGGR--GGARGGR--GGSSGGRGGAKG 69 >SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex protein Gar1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 194 Score = 30.7 bits (66), Expect = 0.35 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -2 Query: 129 RXXXXGGRG-PRXVXGGXFXGG-GGGGXGXXGXGGGGGXXXG 10 R GGRG R GG GG GGG G G G GG G Sbjct: 140 RGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGG 181 Score = 27.1 bits (57), Expect = 4.4 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGG-GGGXXXGXG 4 GRG R G GG GG G GG GGG G G Sbjct: 136 GRGGRGGFRGG-RGGSRGGFGGNSRGGFGGGSRGGFG 171 >SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1841 Score = 28.3 bits (60), Expect = 1.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 10 PXXPPXPPPPPP 45 P PP PPPPPP Sbjct: 942 PAFPPPPPPPPP 953 >SPBC902.04 |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 589 Score = 27.5 bits (58), Expect = 3.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPR 109 P PP P P P P PP RG R Sbjct: 166 PAMPPIPFLPFNPAAQPPFPPPFKMRGKR 194 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 26.6 bits (56), Expect = 5.8 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXP-PPPPPXNXPPXTXRGPRP 112 P PPPP P PPPP + P P P Sbjct: 203 PGEHMPPPPMHHKPGEHMPPPPMHHEPGEHMPPPP 237 Score = 26.6 bits (56), Expect = 5.8 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXP-PPPPPXNXPPXTXRGPRP 112 P PPPP P PPPP + P P P Sbjct: 216 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 250 Score = 26.6 bits (56), Expect = 5.8 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXP-PPPPPXNXPPXTXRGPRP 112 P PPPP P PPPP + P P P Sbjct: 229 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 263 Score = 26.6 bits (56), Expect = 5.8 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXP-PPPPPXNXPPXTXRGPRP 112 P PPPP P PPPP + P P P Sbjct: 242 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 276 Score = 26.6 bits (56), Expect = 5.8 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPP-PPPPXNXPPXTXRGPRP 112 P PPPP P PPPP + P P P Sbjct: 255 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 289 Score = 26.6 bits (56), Expect = 5.8 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPP-PPPPXNXPPXTXRGPRP 112 P PPPP P PPPP + P P P Sbjct: 268 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 302 Score = 26.6 bits (56), Expect = 5.8 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXP-PPPPPXNXPPXTXRGPRP 112 P PPPP P PPPP + P P P Sbjct: 281 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 315 Score = 26.6 bits (56), Expect = 5.8 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPP-PPPPXNXPPXTXRGPRP 112 P PPPP P PPPP + P P P Sbjct: 294 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 328 Score = 26.6 bits (56), Expect = 5.8 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXP-PPPPPXNXPPXTXRGPRP 112 P PPPP P PPPP + P P P Sbjct: 307 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 341 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 26.6 bits (56), Expect = 5.8 Identities = 16/51 (31%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXAS-AAGXDPPXLXP 175 PP P PPP P + RPP G +S AA P P Sbjct: 1062 PPVSATRPQIPQPPPVSTALPSSSAVSRPPIATSAGRSSTAASTSAPLTYP 1112 >SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|Schizosaccharomyces pombe|chr 3|||Manual Length = 551 Score = 26.2 bits (55), Expect = 7.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 19 PPXPPPPPP 45 PP PPPPPP Sbjct: 306 PPPPPPPPP 314 >SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccharomyces pombe|chr 2|||Manual Length = 884 Score = 26.2 bits (55), Expect = 7.6 Identities = 11/30 (36%), Positives = 11/30 (36%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P P PPPPP P P Sbjct: 732 PTPAPTPAVKHHPPPPPVRSSISPSMPPAP 761 >SPAC26A3.09c |rga2||GTPase activating protein Rga2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1275 Score = 26.2 bits (55), Expect = 7.6 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXP-PPPPPXNXPPXTXRGPRPPXLXXRG 133 P P P P PPPPP + T R P L RG Sbjct: 402 PTSNVPAYSTPARPTESPPPPPISSSSTTPRPDDKPSLPPRG 443 >SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 857 Score = 26.2 bits (55), Expect = 7.6 Identities = 12/37 (32%), Positives = 13/37 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P P P P PP P P + P P Sbjct: 575 PQPPVAPVAPEVPSVPQPPVAPVVPEAPSVPQPPVAP 611 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.309 0.147 0.529 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,440,126 Number of Sequences: 5004 Number of extensions: 24609 Number of successful extensions: 613 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 57 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 386 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 545231778 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (21.9 bits)
- SilkBase 1999-2023 -