BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A19 (1042 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 53 3e-07 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 48 1e-05 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 46 5e-05 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 46 7e-05 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 46 7e-05 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 45 1e-04 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 43 4e-04 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 43 5e-04 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 43 5e-04 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 42 8e-04 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 41 0.001 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 41 0.001 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 41 0.002 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 40 0.003 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 40 0.003 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 40 0.003 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 40 0.003 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 40 0.004 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 40 0.004 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 40 0.004 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 39 0.008 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 39 0.008 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 38 0.010 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 38 0.010 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 38 0.013 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 38 0.013 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 38 0.018 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 38 0.018 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 37 0.023 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 37 0.023 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 37 0.023 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 37 0.023 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 37 0.023 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 37 0.031 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 36 0.041 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 36 0.041 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 36 0.054 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 36 0.071 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 36 0.071 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 36 0.071 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 36 0.071 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.094 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 35 0.094 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 35 0.094 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 35 0.094 SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.094 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 34 0.16 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 34 0.16 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 34 0.16 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.22 SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.22 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 34 0.22 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.22 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 33 0.29 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 33 0.29 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 33 0.29 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 33 0.29 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 33 0.38 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 33 0.38 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 33 0.50 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 33 0.50 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 33 0.50 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 33 0.50 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.50 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 33 0.50 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.50 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 33 0.50 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 33 0.50 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 32 0.66 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 32 0.66 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 32 0.66 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 32 0.66 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 32 0.66 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 32 0.66 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) 32 0.66 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.88 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.88 SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) 32 0.88 SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) 32 0.88 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.88 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.88 SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.88 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.88 SB_43407| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.88 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 32 0.88 SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 1.0 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) 31 1.2 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 31 1.2 SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) 31 1.2 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 31 1.2 SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 31 1.2 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 31 1.2 SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) 31 1.5 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 31 1.5 SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) 31 1.5 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 31 1.5 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 31 1.5 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 31 1.5 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 31 2.0 SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 31 2.0 SB_24257| Best HMM Match : DUF583 (HMM E-Value=0.16) 31 2.0 SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) 30 2.7 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) 30 2.7 SB_35820| Best HMM Match : TRAP_240kDa (HMM E-Value=0.006) 30 2.7 SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_12281| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_35308| Best HMM Match : VWA (HMM E-Value=1.1e-20) 30 3.5 SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_21275| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_984| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_41600| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_33342| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_21796| Best HMM Match : COLFI (HMM E-Value=0) 30 3.5 SB_16879| Best HMM Match : Stig1 (HMM E-Value=1) 30 3.5 SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_45113| Best HMM Match : CemA (HMM E-Value=6) 29 4.7 SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_11987| Best HMM Match : OTU (HMM E-Value=1.1e-24) 29 4.7 SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) 29 4.7 SB_49263| Best HMM Match : Surp (HMM E-Value=1e-28) 29 4.7 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 4.7 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 5.8 SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) 29 6.2 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_32583| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_51094| Best HMM Match : VWA (HMM E-Value=0) 29 6.2 SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_44878| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 29 6.2 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 29 6.2 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 29 6.2 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 29 6.2 SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) 29 6.2 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 29 8.2 SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.2 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.2 SB_38491| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.2 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 29 8.2 SB_9614| Best HMM Match : GBP (HMM E-Value=1e-31) 29 8.2 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.2 SB_51494| Best HMM Match : Drf_FH1 (HMM E-Value=2.4) 29 8.2 SB_50230| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.2 SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 29 8.2 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 29 8.2 SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) 29 8.2 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 53.2 bits (122), Expect = 3e-07 Identities = 24/55 (43%), Positives = 24/55 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P P PPPPP P P PPPPPP PP P PP A PP L Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPPRL 443 Score = 50.8 bits (116), Expect = 2e-06 Identities = 19/35 (54%), Positives = 20/35 (57%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPPP P P PPPPPP PP + P PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPP 399 Score = 50.8 bits (116), Expect = 2e-06 Identities = 19/35 (54%), Positives = 20/35 (57%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPPP P P PPPPPP + PP P PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPP 400 Score = 49.6 bits (113), Expect = 4e-06 Identities = 23/57 (40%), Positives = 23/57 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPPPP P P PPPPP PP P PP A PP P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 48.8 bits (111), Expect = 7e-06 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPPP P PPPPPP PP P PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPP 401 Score = 46.4 bits (105), Expect = 4e-05 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P PPP P P P PPPP PP P PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 46.4 bits (105), Expect = 4e-05 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPPPP P PPPP P PP P PP A PP P Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 46.4 bits (105), Expect = 4e-05 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P PPPPP P P PP PPP PP P PP A PP P Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 45.6 bits (103), Expect = 7e-05 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP PP P P PP PPP PP P PP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 45.6 bits (103), Expect = 7e-05 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P P PPPPP PP P PP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXPA 707 PP P PP + PP PPP P P P PP PA Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPA 419 Score = 38.7 bits (86), Expect = 0.008 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PP PPP P A P P PP P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 37.9 bits (84), Expect = 0.013 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXPXPAA 546 PP P PPP P PPP P PPPP P PA Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP-----PPPPPPPPPPPPAP 420 Query: 547 XPXPXSXPLXP 579 P P P P Sbjct: 421 PPPPPPPPPPP 431 Score = 36.7 bits (81), Expect = 0.031 Identities = 19/68 (27%), Positives = 19/68 (27%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXPXPAA 546 PP P PPP P PP P PPPP P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 547 XPXPXSXP 570 P P P Sbjct: 425 PPPPPPPP 432 Score = 36.7 bits (81), Expect = 0.031 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PP PPP P P P PP P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 36.7 bits (81), Expect = 0.031 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PP PPP P P P PP P Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 36.7 bits (81), Expect = 0.031 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PP PPP P P P PP P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 36.7 bits (81), Expect = 0.031 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PP PPP P P P PP P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 36.3 bits (80), Expect = 0.041 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPP 698 PP P PP PP PPP A P P P PP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 35.5 bits (78), Expect = 0.071 Identities = 19/69 (27%), Positives = 20/69 (28%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXPXPAA 546 PP P PPP P PPP P P PP P P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Query: 547 XPXPXSXPL 573 P P + L Sbjct: 428 PPPPPALRL 436 Score = 33.9 bits (74), Expect = 0.22 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PP P P P P P PP P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PP PP P P P PP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PP PP P P P PP P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PP PPP P P PP P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P P PP PPP P P P PP P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PP PPP P P PP P Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP PP PP PPP P P P PP P Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P P PP PPP P P P PP P Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 32.7 bits (71), Expect = 0.50 Identities = 19/69 (27%), Positives = 20/69 (28%), Gaps = 1/69 (1%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-GPXXRPPPPXPXPA 543 PP P PPP P PPP P PPPP P P Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Query: 544 AXPXPXSXP 570 A + P Sbjct: 433 ALRLACAPP 441 Score = 31.5 bits (68), Expect = 1.2 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXPA 707 PP PPP P + P P PP P+ Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPS 388 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 570 PXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 P P PP P PPP P P P PP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 30.7 bits (66), Expect = 2.0 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = +3 Query: 864 PPRPPXPPXXTXXXXXXXXXXALXPXXXXPPPPGXXARXXXPPXAAXTRAGXPPHXLP 1037 PP PP PP P PPPP PP A PP P Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 P P PP PP PPP P P P P P Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPP 698 PP P PP PP PPP P A PP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 28.7 bits (61), Expect = 8.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 928 PXPXXXXXPXPPXRRPARXPPXLXPXRAPXXLRTXSP 1038 P P P PP P PP L AP LR SP Sbjct: 412 PPPPPPPAPPPPPPPPPPPPPALRLACAPPRLRFTSP 448 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 50.4 bits (115), Expect = 2e-06 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXN---XPPXTXRGPRPPXLXXRGXAS 142 P P PPPPP P PPPPPP N PP GP PP G S Sbjct: 368 PPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPS 416 Score = 48.8 bits (111), Expect = 7e-06 Identities = 19/37 (51%), Positives = 20/37 (54%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPPP P PPPPPP N PP + R P Sbjct: 388 PPPTNGPPPPPPPTNGPPPPPPPTNGPPSEGKCGRKP 424 Score = 46.8 bits (106), Expect = 3e-05 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXN---XPPXTXRGPRPP 115 P P PPPP P PPPPPP N PP GP PP Sbjct: 358 PPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPP 397 Score = 46.4 bits (105), Expect = 4e-05 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXN---XPPXTXRGPRPP 115 P P PP PP P PPPPPP N PP GP PP Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPP 387 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = +1 Query: 4 TXPXXPPX---PPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T P PP PPPPPP PP PP PT P PP P Sbjct: 364 TPPPPPPTNKPPPPPPPTNGPPPPPP---PTNGPPPPPPP 400 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXN--XPPXTXRGPRPP 115 PPPPP P PPPP PP T + P PP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPP 378 Score = 35.1 bits (77), Expect = 0.094 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PP P TPP PT P PP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPP 380 Score = 30.7 bits (66), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPP 72 P P PPPPPP P PP Sbjct: 72 PSTPAPPPPPPPPSSGPPLPP 92 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP + PP PPP P P PP P Sbjct: 354 PPSPP--PPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPP 397 Score = 29.9 bits (64), Expect = 3.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 35 PXPXXPXPPPPPPXNXPP 88 P P PPPPPP + PP Sbjct: 72 PSTPAPPPPPPPPSSGPP 89 Score = 29.5 bits (63), Expect = 4.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 364 GPPXPXPPPXXPXPPP 411 GPP P PP P PPP Sbjct: 383 GPPPPPPPTNGPPPPP 398 Score = 29.5 bits (63), Expect = 4.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 364 GPPXPXPPPXXPXPPP 411 GPP P PP P PPP Sbjct: 393 GPPPPPPPTNGPPPPP 408 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 48.0 bits (109), Expect = 1e-05 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPPP P P PPPPPP PP P PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 47.2 bits (107), Expect = 2e-05 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PPPPP P P PPPPPP PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 46.8 bits (106), Expect = 3e-05 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PPPPP P P PPPPPP PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 45.6 bits (103), Expect = 7e-05 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 PPPPP P P PPPPPP PP P P L Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTPL 497 Score = 45.6 bits (103), Expect = 7e-05 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PPPPPP PP PP P P PP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 44.4 bits (100), Expect = 2e-04 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXT 94 P P PPPPP P P PPPPP PP T Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPPT 495 Score = 43.2 bits (97), Expect = 4e-04 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 PP PPPPPP PP PP P P PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 40.3 bits (90), Expect = 0.003 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXT 94 P P PPPPP P P PPPP P + T Sbjct: 474 PPPPPPPPPPPPPPFPPPPPPTPLHLAAIT 503 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP-PPPPXNXP 85 P P PPPPP P P PP PPPP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP P P P PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPP 486 Score = 30.3 bits (65), Expect(2) = 0.004 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 464 PPPPPPPPPPPPPPP 478 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP P P P PP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPP 487 Score = 30.3 bits (65), Expect(2) = 0.004 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 465 PPPPPPPPPPPPPPP 479 Score = 30.3 bits (65), Expect(2) = 0.004 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 466 PPPPPPPPPPPPPPP 480 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP P P P PP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFP 489 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 467 PPPPPPPPPPPPPPP 481 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 468 PPPPPPPPPPPPPPP 482 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 469 PPPPPPPPPPPPPPP 483 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP P P P PP P Sbjct: 470 PPPPPPPPPPPPPPPPPPFPPPP 492 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 470 PPPPPPPPPPPPPPP 484 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 471 PPPPPPPPPPPPPPP 485 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP P P P PP P Sbjct: 472 PPPPPPPPPPPPPPPPFPPPPPP 494 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 472 PPPPPPPPPPPPPPP 486 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 473 PPPPPPPPPPPPPPP 487 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 477 PPPPPPPPPPPFPPP 491 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 479 PPPPPPPPPFPPPPP 493 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 480 PPPPPPPPFPPPPPP 494 Score = 29.5 bits (63), Expect = 4.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPPP P P P P P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPP 490 Score = 28.3 bits (60), Expect(2) = 0.063 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPPP P P P P P P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 28.3 bits (60), Expect(2) = 0.004 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPPP P P P P P P Sbjct: 470 PPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 28.3 bits (60), Expect(2) = 0.004 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPPP P P P P P P Sbjct: 472 PPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 28.3 bits (60), Expect(2) = 0.004 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPL 573 P PPPP P P P P PL Sbjct: 475 PPPPPPPPPPPPPFPPPPPPTPL 497 Score = 26.2 bits (55), Expect(2) = 0.063 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 364 GPPXPXPPPXXPXPPP 411 G P PPP P PPP Sbjct: 461 GQAPPPPPPPPPPPPP 476 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 46.4 bits (105), Expect = 4e-05 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXT 94 P PPPPP P P PPPPPP PP T Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPT 1185 Score = 42.3 bits (95), Expect = 6e-04 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXT 94 P P PPPPP P PPPPPP P T Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTPT 1187 Score = 42.3 bits (95), Expect = 6e-04 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXT 94 P P PPPP P P PPPPPP P T Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPPTPTT 1188 Score = 40.7 bits (91), Expect = 0.002 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PPPPP PPPPPP PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 38.7 bits (86), Expect = 0.008 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PPPPPP PP +P P P PP P Sbjct: 1157 PPPPPPPPP--PPPSSPSPPPPPPPPPPPPTP 1186 Score = 33.1 bits (72), Expect = 0.38 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP +SP P P PP P Sbjct: 1162 PPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 31.1 bits (67), Expect = 1.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP P + P P PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPP 1179 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP P P P PP P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPP 1181 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 1161 PPPPPPPPSSPSPPP 1175 Score = 29.1 bits (62), Expect = 6.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP S P P PP P Sbjct: 1161 PPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 29.1 bits (62), Expect = 6.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PP SP P P PP P Sbjct: 1164 PPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 27.9 bits (59), Expect(2) = 0.17 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 517 PPPPXPXPAAXPXPXSXPLXP 579 PPPP P P + P P P P Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPP 1180 Score = 25.0 bits (52), Expect(2) = 0.17 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 376 PXPPPXXPXPPP 411 P PPP P PPP Sbjct: 1157 PPPPPPPPPPPP 1168 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 46.0 bits (104), Expect = 5e-05 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRG 103 P P PPPPP P P PPPPP + PP G Sbjct: 688 PPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSG 720 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAG 151 PPPPP P P PPPPPP P PP S AG Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAG 727 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPPP P PPPPPP P P P Sbjct: 689 PPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 43.2 bits (97), Expect = 4e-04 Identities = 19/50 (38%), Positives = 21/50 (42%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDP 160 P PPPPP P P PPPP P PP P P + G + P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPP---PSTPPVQQSGAPGSPAGSP 729 Score = 42.3 bits (95), Expect = 6e-04 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P P PPPPPP P + P PP Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 32.7 bits (71), Expect = 0.50 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P P PPPPPP PP P+P Sbjct: 670 PIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQP 703 Score = 30.7 bits (66), Expect = 2.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPR 414 PP P PPP P PPP+ Sbjct: 687 PPPPPPPPPPPPPPPQ 702 Score = 30.7 bits (66), Expect = 2.0 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXPA 707 PP PPP P P P PP P+ Sbjct: 689 PPPPPPPPPPPPPQPSTPPPPPPS 712 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 683 PPPPPPPPPPPPPPP 697 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 684 PPPPPPPPPPPPPPP 698 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 685 PPPPPPPPPPPPPPP 699 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 686 PPPPPPPPPPPPPPP 700 Score = 29.1 bits (62), Expect = 6.2 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPPP P P P P + P P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPP 710 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 46.0 bits (104), Expect = 5e-05 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PPPPP P PPPPPP P P PP R A+ PP Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/43 (44%), Positives = 21/43 (48%), Gaps = 4/43 (9%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP----PPPPXNXPPXTXRGPRPPXL 121 P P PPPPP P P PP PPPP P + P PP + Sbjct: 209 PRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPI 251 Score = 43.2 bits (97), Expect = 4e-04 Identities = 19/48 (39%), Positives = 22/48 (45%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 PPPP P P PPPPP P R P PP +A +PP + Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPI 251 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T P PPPPPP P PP P+ P PP P Sbjct: 196 TSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPP 232 Score = 38.7 bits (86), Expect = 0.008 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP P PP P PP +PP P PP P Sbjct: 218 PPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 Score = 33.9 bits (74), Expect = 0.22 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 4/30 (13%) Frame = +2 Query: 11 PXXXPPPPPXPXXP----XPPPPPPXNXPP 88 P PPPPP P P P PPP N PP Sbjct: 227 PRPPPPPPPSPPRPLAAKLPEPPPIPNMPP 256 Score = 32.7 bits (71), Expect = 0.50 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P P PP PP P P PP P P PP L Sbjct: 220 PPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTL 258 Score = 32.3 bits (70), Expect = 0.66 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP SP P P PP P Sbjct: 215 PPPPPPPPSPSPPRPPPPPPPSP 237 Score = 31.9 bits (69), Expect = 0.88 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 630 RXPPXPPPXASPXXAXPXXPXPPXP 704 R PP PPP P P P PP P Sbjct: 210 RPPPSPPPPPPPPSPSPPRPPPPPP 234 Score = 30.3 bits (65), Expect(2) = 0.028 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 206 PPPPRPPPSPPPPPP 220 Score = 29.9 bits (64), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 32 PPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPPP PP P PP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPP 222 Score = 27.9 bits (59), Expect(2) = 0.65 Identities = 11/17 (64%), Positives = 11/17 (64%), Gaps = 1/17 (5%) Frame = +1 Query: 367 PPXPXPPPXXPXP-PPR 414 PP P PPP P P PPR Sbjct: 212 PPSPPPPPPPPSPSPPR 228 Score = 27.1 bits (57), Expect(2) = 0.65 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P P P P PPP Sbjct: 208 PPRPPPSPPPPPPPP 222 Score = 27.1 bits (57), Expect(2) = 0.85 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P P P P PPP Sbjct: 217 PPPPPPSPSPPRPPP 231 Score = 27.1 bits (57), Expect(2) = 1.1 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P P P P PPP Sbjct: 219 PPPPSPSPPRPPPPP 233 Score = 26.6 bits (56), Expect(2) = 0.23 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PP P PPP Sbjct: 205 PPPPPRPPPSPPPPP 219 Score = 25.8 bits (54), Expect(2) = 0.23 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPPP P P+ P P P Sbjct: 211 PPPSPPPPPPPPSPSPPRPPPPPPP 235 Score = 25.4 bits (53), Expect(2) = 0.028 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPPP P P+ P P P Sbjct: 213 PSPPPPPPPPSPSPPRPPPPPPPSP 237 Score = 23.8 bits (49), Expect(2) = 0.65 Identities = 11/26 (42%), Positives = 11/26 (42%), Gaps = 1/26 (3%) Frame = +1 Query: 505 PXXRPPPPXP-XPAAXPXPXSXPLXP 579 P PPPP P P P P P P Sbjct: 215 PPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 23.4 bits (48), Expect(2) = 0.85 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPL 573 P PPP P P A P P+ Sbjct: 229 PPPPPPPSPPRPLAAKLPEPPPI 251 Score = 23.0 bits (47), Expect(2) = 0.65 Identities = 10/24 (41%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Frame = +1 Query: 505 PXXRPP-PPXPXPAAXPXPXSXPL 573 P PP PP P P + P P + L Sbjct: 222 PSPSPPRPPPPPPPSPPRPLAAKL 245 Score = 23.0 bits (47), Expect(2) = 1.1 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +1 Query: 514 RPPPPXPXPAAXPXPXSXPLXP 579 RPPPP P P P P Sbjct: 228 RPPPPPPPSPPRPLAAKLPEPP 249 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 45.6 bits (103), Expect = 7e-05 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPPP P PPPPPP PP P PP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPP 334 Score = 39.1 bits (87), Expect = 0.006 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PPPPPP PP PP P G P P Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPP 333 Score = 38.7 bits (86), Expect = 0.008 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPP P PPPPPP P P PP Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPPPP 323 Score = 38.7 bits (86), Expect = 0.008 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P PPPPP PP G PP Sbjct: 296 PADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPP 332 Score = 36.7 bits (81), Expect = 0.031 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP 73 P P PPPPP PPPPPP Sbjct: 315 PPPPPPPPPPPGDGGAPPPPPPP 337 Score = 35.9 bits (79), Expect = 0.054 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 22 PXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PPPPP P PP P P PP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPP 320 Score = 35.9 bits (79), Expect = 0.054 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP 73 P P PPPPP PPPPPP Sbjct: 314 PPPPPPPPPPPPGDGGAPPPPPP 336 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 4/34 (11%) Frame = +1 Query: 19 PPXPPP----PPPXXXPPXTPPXEXPTXXPXGPP 108 PP PPP PPP PP PP + P PP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 31.9 bits (69), Expect = 0.88 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPT 87 PP PPPPPP PP PT Sbjct: 316 PPPPPPPPPPGDGGAPPPPPPPT 338 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P P PPPP PP P PP Sbjct: 306 PPPPPGGAPPPPPP-PPPPPPGDGGAPPP----PPPP 337 Score = 29.5 bits (63), Expect = 4.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 639 PXPPPXASPXXAXPXXPXPPXP 704 P PPP P A P P PP P Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPP 323 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +1 Query: 19 PPXPPPPP---PXXXPPXTPPXEXPTXXPXGPPXP 114 P PPPP PP PP P P PP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPP 324 Score = 29.1 bits (62), Expect = 6.2 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPP 698 PP PPP +P P P PP Sbjct: 305 PPPPPPGGAPPPPPPPPPPPP 325 Score = 28.7 bits (61), Expect = 8.2 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PP P P PP PP P PP A PP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 26.6 bits (56), Expect(2) = 0.24 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PP P PPP Sbjct: 304 PPPPPPPGGAPPPPP 318 Score = 26.6 bits (56), Expect(2) = 0.54 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP PPP P PPP Sbjct: 309 PPGGAPPPPPPPPPP 323 Score = 25.8 bits (54), Expect(2) = 0.24 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPPP P P P P P Sbjct: 310 PGGAPPPPPPPPPPPPGDGGAPPPP 334 Score = 24.6 bits (51), Expect(2) = 0.54 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXP 570 P PPPP P P P P Sbjct: 316 PPPPPPPPPPGDGGAPPPPPPP 337 Score = 24.2 bits (50), Expect(2) = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%), Gaps = 3/18 (16%) Frame = +1 Query: 367 PPXPXP---PPXXPXPPP 411 PP P P PP P PPP Sbjct: 305 PPPPPPGGAPPPPPPPPP 322 Score = 23.4 bits (48), Expect(2) = 5.6 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXP 570 P PPPP P P P P Sbjct: 314 PPPPPPPPPPPPGDGGAPPPPP 335 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 45.6 bits (103), Expect = 7e-05 Identities = 21/37 (56%), Positives = 21/37 (56%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GGRG GG F GGGGGG G G GG GG G G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGG 117 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG F GGGGGG G G GGGG G G Sbjct: 89 GGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGG 25 GG G GG F GGGGGG G G GGGG Sbjct: 97 GGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -2 Query: 144 ADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 A R GG G GG GGGGGG G GGGGG G G Sbjct: 78 ASVGGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGG 124 Score = 39.1 bits (87), Expect = 0.006 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GG G GG GGGGGG G G GGGGG Sbjct: 96 GGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 38.3 bits (85), Expect = 0.010 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G GG G G G GGG GG Sbjct: 89 GGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 37.9 bits (84), Expect = 0.013 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG G GG G GGGG G G GGGGG G Sbjct: 94 GGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G G G G G GGG GG Sbjct: 85 GGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGG 121 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 742 GXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 G GG GG G GG G G G GGG GG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGG 116 Score = 31.9 bits (69), Expect = 0.88 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXR 629 GG GG GG G GG G G G GGG G R Sbjct: 94 GGGGGGGFGGGGGGGFGGGGGGGGGFGG--GGGGGFGSR 130 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -2 Query: 99 RXVXGGXFXG-GGGGGXGXXGXGG-GGGXXXGXG 4 R GG G GGGGG G G GG GGG G G Sbjct: 77 RASVGGRGGGFGGGGGFGGGGGGGFGGGGGGGFG 110 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 44.8 bits (101), Expect = 1e-04 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRG 133 PPPPP P PPPPP PP + P PP RG Sbjct: 365 PPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRG 401 Score = 43.2 bits (97), Expect = 4e-04 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 3/60 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P PPPPP PPPPPP PP RG PP G PP P Sbjct: 309 PSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPP 368 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/53 (37%), Positives = 22/53 (41%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PPP P PPPPPP PP P PP + R +S PP Sbjct: 348 PPSMGMAPPPVGGAAPPPPPPPPVGGPP-----PPPPPIEGRPPSSLGNPPPP 395 Score = 37.5 bits (83), Expect = 0.018 Identities = 22/62 (35%), Positives = 25/62 (40%), Gaps = 5/62 (8%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP-----PPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P P PPPP PP PPPP PP GP PP G ++ +PP Sbjct: 339 PPPSRGAPPPPSMGMAPPPVGGAAPPPP---PPPPVGGPPPPPPPIEGRPPSSLGNPPPP 395 Query: 170 XP 175 P Sbjct: 396 PP 397 Score = 37.1 bits (82), Expect = 0.023 Identities = 18/47 (38%), Positives = 20/47 (42%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 PPPPP PPPP PP G PP + G A+ PP Sbjct: 326 PPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPV---GGAAPPPPPPP 369 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PPPPP PP PP E G P P Sbjct: 363 PPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPP 394 Score = 37.1 bits (82), Expect = 0.023 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP----PPPXNXPPXTXRGPRPPXLXXRGXA 139 P P PPPPP P PP PPP PP RG PP G A Sbjct: 368 PPPVGGPPPPPPPIEGRPPSSLGNPPP---PPPPGRGAPPPGPMIPGRA 413 Score = 35.5 bits (78), Expect = 0.071 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 PPPP PPPP PP RG PP R +A PP Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPAR-MGTAPPPPPP 331 Score = 32.3 bits (70), Expect = 0.66 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXN------XPPXTXRGPRPP 115 P P PPP P PPPPP PP + RPP Sbjct: 297 PPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPP 339 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNX---PPXTXRGPRPP 115 P P PP P PPPPP PP G PP Sbjct: 288 PPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPP 327 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 44.0 bits (99), Expect = 2e-04 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP PP PP PP E PT P PP Sbjct: 1024 PTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPP 1056 Score = 38.7 bits (86), Expect = 0.008 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P PP P PP PP E PT P PP P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTP 1050 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGP 105 P PP PPP P PP PP PT P P Sbjct: 1028 PTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP P PP PP PT P PP Sbjct: 1020 PTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPP 1052 Score = 33.1 bits (72), Expect = 0.38 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = +1 Query: 4 TXPXXPP-XPPPPPPXXXPPXTPPXEXPT 87 T P PP PP PP PP PP + PT Sbjct: 1029 TDPPTPPPTEPPTPPPTEPPTPPPTDPPT 1057 Score = 32.3 bits (70), Expect = 0.66 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P P PPP PP T P PP Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPT-EPPTPP 1051 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP--PPPPPXNXPPXTXR 100 P PPP P P P PP PP PP R Sbjct: 1027 PPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQPR 1060 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P PP PP P P PPP PP T +P Sbjct: 1027 PPTDPPTPP-PTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 29.9 bits (64), Expect = 3.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 PP P P PPP P PP P P Sbjct: 1023 PPTEPPTDPPTPPPTEPPTPPPTEPPTPPP 1052 Score = 29.1 bits (62), Expect = 6.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXE 78 P PP PP PP PP P E Sbjct: 1040 PTPPPTEPPTPPPTDPPTQPRVE 1062 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXP-PXTXRGPRPP 115 P P PP PP P P PP PPP N P P P PP Sbjct: 176 PPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPP 213 Score = 43.6 bits (98), Expect = 3e-04 Identities = 18/32 (56%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXP-PXTXRGPRPP 115 PPPPP P P PP PPP N P P P PP Sbjct: 103 PPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPP 134 Score = 43.2 bits (97), Expect = 4e-04 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P P P PPP N PP P PP Sbjct: 142 PSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPP 178 Score = 43.2 bits (97), Expect = 4e-04 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PP PP P P PPPP P PP P PP Sbjct: 173 PYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPP 207 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/53 (37%), Positives = 21/53 (39%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPPP P P P PPP PP P PP +A PP Sbjct: 155 PYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPP 207 Score = 42.3 bits (95), Expect = 6e-04 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPP-PPXNXPPXTXRGPRPP 115 P PP PP P P PPPP PP PP P PP Sbjct: 189 PPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPP 224 Score = 41.9 bits (94), Expect = 8e-04 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Frame = +2 Query: 5 PXPXXXPPP----PPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP PP P P PPPP P PP P PP Sbjct: 128 PNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPP 168 Score = 41.9 bits (94), Expect = 8e-04 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PP PP P P PPPP N PP P PP Sbjct: 181 PPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPP 215 Score = 41.5 bits (93), Expect = 0.001 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PP PP PP PP P P PP P Sbjct: 178 PYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYP 212 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/55 (38%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Frame = +2 Query: 5 PXPXXXPPPP--PXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPPP P P P PPPP PP P PP +A PP Sbjct: 98 PYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPP 152 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP--PPPPXNXPPXTXRGPRPP 115 P P PPPP P P PP P PP PP P PP Sbjct: 197 PPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPP 235 Score = 40.3 bits (90), Expect = 0.003 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXP-PXTXRGPRPP 115 P P PPP P P P PP PPP N P P P PP Sbjct: 90 PNPPYPPPPYP-PYPPPPPYPPPPNPPYPPPPNAPYPP 126 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P P P PP PPP N P P PP Sbjct: 147 PYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPP 183 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPP----PPXPXXPXPPPPPPXNXP-PXTXRGPRPP 115 P P PPP PP P P PPPP N P P P PP Sbjct: 191 PNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPP 232 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +1 Query: 19 PPXPP-PPPPXXXPPXTPPXEXPTXXPXGPP 108 PP PP PPPP PP PP P P PP Sbjct: 97 PPYPPYPPPPPYPPPPNPPYPPPPNAPYPPP 127 Score = 38.7 bits (86), Expect = 0.008 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PPPP P PP P P P PP Sbjct: 103 PPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPP 135 Score = 38.3 bits (85), Expect = 0.010 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPP-PPPPXNXPPXTXRGPRPP 115 P P PP P P PP PPPP PP P PP Sbjct: 85 PTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPP 120 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXP-PXTXRGPRP 112 P PP PP P P PP PPP N P P P P Sbjct: 205 PPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 37.5 bits (83), Expect = 0.018 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 561 LXPPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 L PP P PP PP PPP P P P PP P Sbjct: 160 LYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPP 207 Score = 37.1 bits (82), Expect = 0.023 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP--PPPPPXNXP-PXTXRGPRPP 115 P PPPP P P P P PPP N P P P PP Sbjct: 182 PPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPP 221 Score = 36.7 bits (81), Expect = 0.031 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = +1 Query: 10 PXXPPXPPPP----PPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PPPP PP PP PP P P PP P Sbjct: 190 PPNPPYPPPPNAPNPPPPNPPYPPPPNAPN--PPYPPPP 226 Score = 35.9 bits (79), Expect = 0.054 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP----PPPPXNXPPXTXRGPRPPXL 121 P P PPPP P P PP PP P P P PP L Sbjct: 118 PPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPL 160 Score = 35.1 bits (77), Expect = 0.094 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +2 Query: 5 PXPXXXPPPP----PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P PP P P P PP PPP PP P P Sbjct: 133 PPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAP 173 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PP PP P P P P PP P Sbjct: 123 PYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYP 157 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP--PPPPPXNXPPXTXRGPRPP 115 P PPPP P P P P PPP N P P PP Sbjct: 127 PPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPP 165 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PP PP P PP P P P P Sbjct: 186 PYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNP 220 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 P P PP PP PPP +P P P PP P Sbjct: 170 PNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPP 215 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +1 Query: 19 PPXPP--PPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PP PPP PP PP P PP P Sbjct: 206 PPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 33.5 bits (73), Expect = 0.29 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXN 79 P PP PP P P PP PPP N Sbjct: 214 PPNAPNPPYPPPPNAPNPPYPPPPN 238 Score = 33.1 bits (72), Expect = 0.38 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 P P PP PP PPP +P P P PP P Sbjct: 107 PYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPP 152 Score = 32.7 bits (71), Expect = 0.50 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +2 Query: 23 PPPPPXPXXPXPPPP-PPXNXPPXTXRGPRPP 115 PP P P PPPP PP PP P PP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPP 115 Score = 32.7 bits (71), Expect = 0.50 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P PPP PP PP P P PP P Sbjct: 120 PNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNP 154 Score = 32.3 bits (70), Expect = 0.66 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P P PP PPP P P P PP P Sbjct: 154 PPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPP 199 Score = 31.9 bits (69), Expect = 0.88 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PP PP P A P P PP P Sbjct: 182 PPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNA-PNPPYPPPP 226 Score = 31.5 bits (68), Expect = 1.2 Identities = 20/70 (28%), Positives = 20/70 (28%), Gaps = 2/70 (2%) Frame = +1 Query: 367 PPXPXPPPXXPXP-PPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPP-PPXPXP 540 PP P PPP P P PP P PP PP P P Sbjct: 100 PPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPP 159 Query: 541 AAXPXPXSXP 570 P P P Sbjct: 160 LYPPPPNPPP 169 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/64 (26%), Positives = 17/64 (26%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXPXPAA 546 PP PPP P PPP P PPP P P Sbjct: 163 PPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPY 222 Query: 547 XPXP 558 P P Sbjct: 223 PPPP 226 Score = 30.7 bits (66), Expect = 2.0 Identities = 27/131 (20%), Positives = 27/131 (20%), Gaps = 1/131 (0%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 815 PP PPP P P P PP P Sbjct: 106 PPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPP 165 Query: 816 XXXXXXXXXXXXXXXXPPRPPXPPXXT-XXXXXXXXXXALXPXXXXPPPPGXXARXXXPP 992 PP PP PP P PPPP PP Sbjct: 166 NPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPP 225 Query: 993 XAAXTRAGXPP 1025 A PP Sbjct: 226 PNAPNPPYPPP 236 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPP 698 PP P PP PP PP P P P PP Sbjct: 127 PPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPP 170 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +2 Query: 5 PXPXXXPPP-PPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRG 133 P P PPP P P P PPP P GPR P G Sbjct: 218 PNPPYPPPPNAPNPPYP-PPPNPQFAIALCLGHGPRSPEYRLSG 260 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP P P P PP P Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNP 114 Score = 29.9 bits (64), Expect = 3.5 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 1/59 (1%) Frame = +3 Query: 864 PPRPPXPPXXTXXXXXXXXXXALXPXXXXPPPPG-XXARXXXPPXAAXTRAGXPPHXLP 1037 PP PP PP A P PPPP PP A PP P Sbjct: 151 PPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNP 209 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 P P PP PP PPP +P P P P P Sbjct: 186 PYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNP 231 Score = 29.5 bits (63), Expect = 4.7 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P P PP PPP +P P P P P Sbjct: 141 PPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPP 186 Score = 29.1 bits (62), Expect = 6.2 Identities = 19/72 (26%), Positives = 19/72 (26%), Gaps = 4/72 (5%) Frame = +1 Query: 367 PPXPXPP----PXXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXP 534 PP P PP P P PPP P P PP P Sbjct: 164 PPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYP 223 Query: 535 XPAAXPXPXSXP 570 P P P P Sbjct: 224 PPPNAPNPPYPP 235 Score = 28.7 bits (61), Expect = 8.2 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP PP PP PPP +P P P PP P Sbjct: 197 PPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAP---NPPYPPPPNP 239 Score = 26.2 bits (55), Expect(2) = 0.54 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PP P PPP Sbjct: 97 PPYPPYPPPPPYPPP 111 Score = 25.0 bits (52), Expect(2) = 0.54 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PP P P A P P + P P Sbjct: 110 PPPNPPYPPPPNAPYPPPPNPPYPP 134 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 43.2 bits (97), Expect = 4e-04 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP 73 P P PPPPP P P PPPPPP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPP 884 Score = 42.7 bits (96), Expect = 5e-04 Identities = 18/36 (50%), Positives = 19/36 (52%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PPPP P P PPPPPP PP + G P Sbjct: 860 PRPRPRRPPPPPP--PPPPPPPPPPPPPASSTGSTP 893 Score = 42.7 bits (96), Expect = 5e-04 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPPP P P PPPPPP + T G + P Sbjct: 869 PPPPPPPPPPPPPPPPPASSTGSTPGGDKVP 899 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 867 PPPPPPPPPPPPPPP 881 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 868 PPPPPPPPPPPPPPP 882 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 869 PPPPPPPPPPPPPPP 883 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 870 PPPPPPPPPPPPPPP 884 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 871 PPPPPPPPPPPPPPP 885 Score = 27.9 bits (59), Expect(2) = 1.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 514 RPPPPXPXPAAXPXPXSXP 570 RPPPP P P P P P Sbjct: 866 RPPPPPPPPPPPPPPPPPP 884 Score = 26.6 bits (56), Expect(2) = 0.83 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXS 564 P PPPP P P P P S Sbjct: 868 PPPPPPPPPPPPPPPPPPAS 887 Score = 23.8 bits (49), Expect(2) = 0.83 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 370 PXPXPPPXXPXPPP 411 P P PP P PPP Sbjct: 862 PRPRRPPPPPPPPP 875 Score = 21.4 bits (43), Expect(2) = 1.8 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 376 PXPPPXXPXPPP 411 P P P P PPP Sbjct: 860 PRPRPRRPPPPP 871 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 43.2 bits (97), Expect = 4e-04 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 4/55 (7%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPP----PXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 PPPPP P PPPPP P PP P PP G A G P L P Sbjct: 922 PPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPP-PPGGSAPPPGGGAPPLPP 975 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXR 100 P PP PP P PPPPPP PP R Sbjct: 965 PPGGGAPPLPPPPGGSAPPPPPPPPPPPPPMR 996 Score = 37.1 bits (82), Expect = 0.023 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRG 103 PPPP P PPPPPP PP G Sbjct: 974 PPPPGGSAPPPPPPPPPPPPPMRKLG 999 Score = 36.3 bits (80), Expect = 0.041 Identities = 18/57 (31%), Positives = 20/57 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PP P PPPPPP G PP G ++ PP P Sbjct: 936 PPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 Score = 35.9 bits (79), Expect = 0.054 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXPXXXK 187 PPPP P PPPPPP P G P G A PP P K Sbjct: 945 PPPPGGNAP-PPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPPMRK 997 Score = 35.5 bits (78), Expect = 0.071 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRG 133 P P PPP P PPPP PP P PP + G Sbjct: 957 PPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPPMRKLG 999 Score = 31.1 bits (67), Expect = 1.5 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P P P P PPPPP G P L SA PP P Sbjct: 935 PPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPP 991 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 43.2 bits (97), Expect = 4e-04 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P PPPPPP PP PP Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGPP 231 Score = 32.3 bits (70), Expect = 0.66 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P PPPPPP P P PP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPP 217 Score = 25.0 bits (52), Expect(2) = 2.4 Identities = 10/17 (58%), Positives = 10/17 (58%), Gaps = 2/17 (11%) Frame = +1 Query: 367 PPXPXPPPXXP--XPPP 411 PP P PPP P PPP Sbjct: 197 PPPPPPPPGFPGGAPPP 213 Score = 24.2 bits (50), Expect(2) = 6.8 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXP 570 P PPPP P P P P Sbjct: 196 PPPPPPPPPGFPGGAPPPPPPP 217 Score = 23.8 bits (49), Expect(2) = 2.4 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXP 558 P PPPP P A P P Sbjct: 207 PGGAPPPPPPPFGAPPPP 224 Score = 23.0 bits (47), Expect(2) = 6.8 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 P PPP P PPP Sbjct: 190 PMAGMPPPPPPPPPP 204 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 43.2 bits (97), Expect = 4e-04 Identities = 19/53 (35%), Positives = 21/53 (39%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPPP P P PPPP P PP P P ++ PP Sbjct: 901 PKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPP 953 Score = 35.1 bits (77), Expect = 0.094 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP 73 P P PPPP P P PPPPPP Sbjct: 961 PIPATQVPPPPLP--PLPPPPPP 981 Score = 33.5 bits (73), Expect = 0.29 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPP-PPXNXPPXTXRGPRPPXL 121 P P PPP P PPPP PP PP + P L Sbjct: 951 PPPPTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAPTL 990 Score = 33.1 bits (72), Expect = 0.38 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPPPP P P T P PP A PP L P Sbjct: 918 PPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPP 974 Score = 31.9 bits (69), Expect = 0.88 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P P P P PPPP P P P PP + Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPI 929 Score = 29.1 bits (62), Expect = 6.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P P PPPP P PP T P PP Sbjct: 960 PPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPP 992 Score = 28.7 bits (61), Expect = 8.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 22 PXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PPPP PP P P PP P Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPLPPLPPPP 979 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 42.7 bits (96), Expect = 5e-04 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGGG G G GGGGG G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 37.1 bits (82), Expect = 0.023 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGGG G G GGG G G Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 36.7 bits (81), Expect = 0.031 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXG 638 GG GG GG G GG G G G GGG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 36.3 bits (80), Expect = 0.041 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G GG G G G GGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 42.7 bits (96), Expect = 5e-04 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGGG G G GGGGG G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 695 Score = 42.7 bits (96), Expect = 5e-04 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGGG G G GGGGG G G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 42.7 bits (96), Expect = 5e-04 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGGG G G GGGGG G G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 42.7 bits (96), Expect = 5e-04 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGGG G G GGGGG G G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 42.7 bits (96), Expect = 5e-04 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGGG G G GGGGG G G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 42.7 bits (96), Expect = 5e-04 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGGG G G GGGGG G G Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 42.7 bits (96), Expect = 5e-04 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGGG G G GGGGG G G Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 40.3 bits (90), Expect = 0.003 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G GG GGGGGG G G GGGGG G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 693 Score = 40.3 bits (90), Expect = 0.003 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGGG G G GGGGG G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 40.3 bits (90), Expect = 0.003 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGGG G G GGGG G G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 40.3 bits (90), Expect = 0.003 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGGG G G GG GG G G Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G GG G G G GGG GG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 695 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G GG G G G GGG GG Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G GG G G G GGG GG Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G GG G G G GGG GG Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G GG G G G GGG GG Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G GG G G G GGG GG Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 38.3 bits (85), Expect = 0.010 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG GG G GG GGGGGG G G G G G G G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 36.7 bits (81), Expect = 0.031 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G GG G G G GGG G Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 36.3 bits (80), Expect = 0.041 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 G GG GG G GG G G G GGG GG Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 696 Score = 35.9 bits (79), Expect = 0.054 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXG 638 GG GG GG G GG G G G A G G G Sbjct: 673 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 35.5 bits (78), Expect = 0.071 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 G GG GG G GG G G G GGG GG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 693 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXG 638 GG GG GG G GG G G G GG G Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G GG G G G GG G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 32.7 bits (71), Expect = 0.50 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGG 644 GG GG GG G GG G G G G G Sbjct: 677 GGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 31.9 bits (69), Expect = 0.88 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXG 638 GG GG GG G GG G G G G G Sbjct: 675 GGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PPPPP P PPPP PP P PP G A PP Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPP 745 Score = 37.5 bits (83), Expect = 0.018 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T P PP PPPPP P PP P PP P Sbjct: 708 TLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPP 744 Score = 37.5 bits (83), Expect = 0.018 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 PPPPP P PPPP + P P PP G A PP P Sbjct: 713 PPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVP 763 Score = 35.5 bits (78), Expect = 0.071 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 5/56 (8%) Frame = +2 Query: 23 PPPPPXPXXPX-----PPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 PPPPP P PPPPPP P + P PP AG PP P Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPP-PPPPPPGCAGLPPPPPSP 732 Score = 31.1 bits (67), Expect = 1.5 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +3 Query: 864 PPRPPXPPXXTXXXXXXXXXXALXPXXXXPPPPGXXARXXXPPXAAXTRAGXPPHXLP 1037 PP PP PP + P PPPPG PP AG PP P Sbjct: 696 PPPPPPPPLLSGTLPM--------PPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPP 745 Score = 28.7 bits (61), Expect = 8.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP S P P PP P Sbjct: 698 PPPPPPLLSGTLPMPPPPPPPPP 720 Score = 24.2 bits (50), Expect(2) = 3.1 Identities = 10/18 (55%), Positives = 10/18 (55%), Gaps = 3/18 (16%) Frame = +1 Query: 367 PPXPXPPP---XXPXPPP 411 PP P PPP P PPP Sbjct: 713 PPPPPPPPGCAGLPPPPP 730 Score = 24.2 bits (50), Expect(2) = 6.6 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 517 PPPPXPXPAAXPXPXSXP 570 PPPP P A P P P Sbjct: 715 PPPPPPGCAGLPPPPPSP 732 Score = 24.2 bits (50), Expect(2) = 3.1 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +1 Query: 517 PPPPXPXPAAXPXPXSXPLXP 579 PPPP P P P P P Sbjct: 727 PPPPSPQPGCAGLPPPPPPPP 747 Score = 23.0 bits (47), Expect(2) = 6.6 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 364 GPPXPXPPPXXPXPPP 411 G PPP P PPP Sbjct: 688 GSSLSVPPPPPPPPPP 703 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.5 bits (93), Expect = 0.001 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPP P P PPPP P PP P+PP Sbjct: 72 PAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPP 106 Score = 38.3 bits (85), Expect = 0.010 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPX--PPPPPPXNXPPXTXRGPRP 112 P P P PP P P PPPPPP PP P P Sbjct: 66 PPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAP 103 Score = 37.5 bits (83), Expect = 0.018 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PPPPP P PP + P PP Sbjct: 78 PAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 37.5 bits (83), Expect = 0.018 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXP 85 P P PPPPP P PPP PP P Sbjct: 88 PPPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 35.5 bits (78), Expect = 0.071 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PPP PP P PP P P PP P Sbjct: 50 PPPPPPSPPAAAPAAPPP---PAAAPAAPPPP 78 Score = 35.5 bits (78), Expect = 0.071 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP-PPPPPXNXPPXTXRGPRPP 115 P P PP P P P P PPPPP P P PP Sbjct: 75 PPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPP--PAPP 110 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 PPPPP P P PPP P P P PP P Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQP 101 Score = 33.9 bits (74), Expect = 0.22 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXP 96 P PP P PPPP P PP P P Sbjct: 86 PPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPP P P PP PP PP P PP Sbjct: 62 PAAPPPPAAAPAAPPPPAAPPAAPPPPPPL-PAPP 95 Score = 32.3 bits (70), Expect = 0.66 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P P P P P PPP PP P P A A PP Sbjct: 55 PSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Score = 31.9 bits (69), Expect = 0.88 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXPA 707 PP P PP P PPP A+P A P P PP PA Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAA-PAAPPPPAAPPAAPP--PPPPLPA 93 Score = 29.5 bits (63), Expect = 4.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 517 PPPPXPXPAAXPXPXSXPLXP 579 PPPP PAA P P + P P Sbjct: 65 PPPPAAAPAAPPPPAAPPAAP 85 Score = 28.7 bits (61), Expect = 8.2 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 6/64 (9%) Frame = +3 Query: 864 PPRPPXPPXXTXXXXXXXXXXALXPXXXX------PPPPGXXARXXXPPXAAXTRAGXPP 1025 PP PP PP P PPPP A P A PP Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Query: 1026 HXLP 1037 H LP Sbjct: 111 HFLP 114 Score = 28.7 bits (61), Expect(2) = 0.99 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 517 PPPPXPXPAAXPXPXSXPLXP 579 PPPP PAA P P P P Sbjct: 75 PPPPAAPPAAPPPPPPLPAPP 95 Score = 21.8 bits (44), Expect(2) = 0.99 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +1 Query: 355 AXXGPPXPXPPPXXPXPP 408 A PP P P P PP Sbjct: 61 APAAPPPPAAAPAAPPPP 78 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 41.5 bits (93), Expect = 0.001 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXP 85 PPPPP P P PPPPPP + P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSP 75 Score = 41.1 bits (92), Expect = 0.001 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPP 88 PPPPP P P PPPPPP + P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 37.9 bits (84), Expect = 0.013 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPT 87 PP PPPPPP PP PP P+ Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPS 76 Score = 35.1 bits (77), Expect = 0.094 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPP 72 P PP PPPPPP PP + P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSP 75 Score = 31.5 bits (68), Expect = 1.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTP 69 P PP PPPPPP P P Sbjct: 59 PPPPPPPPPPPPPSSSPSRP 78 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPPP P P P P S P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 54 PPPPPPPPPPPPPPP 68 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 55 PPPPPPPPPPPPPPP 69 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 56 PPPPPPPPPPPPPPP 70 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 57 PPPPPPPPPPPPPPP 71 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP 73 P P PPPPP P P P P Sbjct: 56 PPPPPPPPPPPPPPPPSSSPSRP 78 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG G GG GGGGGG G G GGGGG G Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGG 805 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GG GGGGGG G G GGGGG G G Sbjct: 840 GGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 40.3 bits (90), Expect = 0.003 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G GG GGGGGG G G GGGGG G G Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGG 874 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGG G G GGGGG G G Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGG 806 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG D GG G GG GG GGG G GGGGG G G Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGG 823 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXG-GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG D G G G G GGGGGG G G GGGGG G G Sbjct: 815 GGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGG 872 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG + G GGG G G GGGGG G G Sbjct: 795 GGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYG 831 Score = 39.1 bits (87), Expect = 0.006 Identities = 20/59 (33%), Positives = 21/59 (35%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXG 569 G GG GG G GG G G G+ GGG GG GG G G Sbjct: 783 GDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGG 841 Score = 39.1 bits (87), Expect = 0.006 Identities = 21/59 (35%), Positives = 22/59 (37%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXG 569 GG GG GG GG G G G+ GGG GG G GG G G Sbjct: 818 GGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 38.7 bits (86), Expect = 0.008 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG GG GG G GG G G+ GGG GG G G GG Sbjct: 781 GGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGG 840 Score = 37.9 bits (84), Expect = 0.013 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG GG G GG GGGGGG G G GGG G G Sbjct: 785 GGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGG 841 Score = 37.9 bits (84), Expect = 0.013 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG GG GG GG G G GGG GG GG G GG Sbjct: 789 GGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGG 848 Score = 37.1 bits (82), Expect = 0.023 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -3 Query: 107 GGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 GG G G GG GG GGGGGG GG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGG 801 Score = 36.7 bits (81), Expect = 0.031 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG GG G G GGGGGG G G GGG G G G Sbjct: 781 GGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFG 837 Score = 36.3 bits (80), Expect = 0.041 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -1 Query: 730 GGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG GG GG G G G GGG GG G GG G GG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGG 823 Score = 36.3 bits (80), Expect = 0.041 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -1 Query: 730 GGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG G G GG G G G GGG GG G GG G GG Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 35.9 bits (79), Expect = 0.054 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G G G G GG GG GGGGGG GG G Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 873 Score = 35.9 bits (79), Expect = 0.054 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -3 Query: 104 GPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXGXV 3 G G G GG GG GGGGGG GG G + Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVI 878 Score = 35.1 bits (77), Expect = 0.094 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXGXV 3 G G G GG GG GGGGGG GG G V Sbjct: 841 GYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGV 877 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G G G GGGG G G GGGGG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGG 805 Score = 33.9 bits (74), Expect = 0.22 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = -3 Query: 578 GXRGXEXGXGXAAGXGXGGGGRXXGPXXXXXXXXXXXXXXXXXXXXXXXXXGXXXRGGGX 399 G G G G G G GGGG G G GGG Sbjct: 801 GGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGG 860 Query: 398 GXXGGGXGXGG 366 G GGG G GG Sbjct: 861 GGGGGGGGGGG 871 Score = 33.1 bits (72), Expect = 0.38 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = -3 Query: 578 GXRGXEXGXGXAAGXGXGGGGRXXGPXXXXXXXXXXXXXXXXXXXXXXXXXGXXXRGGGX 399 G G G G G G GGGG G G GGG Sbjct: 805 GGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGG 864 Query: 398 GXXGGGXGXGG 366 G GGG G GG Sbjct: 865 GGGGGGGGGGG 875 Score = 32.7 bits (71), Expect = 0.50 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG D GG G GG GGG G G G G GGG G G Sbjct: 792 GGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGG-GFGDGGGYADGDG 847 Score = 32.7 bits (71), Expect = 0.50 Identities = 21/71 (29%), Positives = 21/71 (29%) Frame = -3 Query: 578 GXRGXEXGXGXAAGXGXGGGGRXXGPXXXXXXXXXXXXXXXXXXXXXXXXXGXXXRGGGX 399 G G G G G G GGGG G GGG Sbjct: 795 GGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGG 854 Query: 398 GXXGGGXGXGG 366 G GGG G GG Sbjct: 855 GGGGGGGGGGG 865 Score = 32.7 bits (71), Expect = 0.50 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = -3 Query: 578 GXRGXEXGXGXAAGXGXGGGGRXXGPXXXXXXXXXXXXXXXXXXXXXXXXXGXXXRGGGX 399 G G G G G G GGGG G G GGG Sbjct: 797 GGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGG 856 Query: 398 GXXGGGXGXGG 366 G GGG G GG Sbjct: 857 GGGGGGGGGGG 867 Score = 32.7 bits (71), Expect = 0.50 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = -3 Query: 578 GXRGXEXGXGXAAGXGXGGGGRXXGPXXXXXXXXXXXXXXXXXXXXXXXXXGXXXRGGGX 399 G G G G G G GGGG G G GGG Sbjct: 799 GGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGG 858 Query: 398 GXXGGGXGXGG 366 G GGG G GG Sbjct: 859 GGGGGGGGGGG 869 Score = 31.9 bits (69), Expect = 0.88 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 1/61 (1%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXG-GGXGGXRXXXXXXXXXXGXGGXXXGXG 569 GG GG GG G GG G G G G GG GG G GG G G Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGG---GGGGDGGGYGDGDGGGGGGGGGGGGGGDG 827 Query: 568 G 566 G Sbjct: 828 G 828 Score = 30.7 bits (66), Expect = 2.0 Identities = 20/71 (28%), Positives = 20/71 (28%) Frame = -3 Query: 578 GXRGXEXGXGXAAGXGXGGGGRXXGPXXXXXXXXXXXXXXXXXXXXXXXXXGXXXRGGGX 399 G G G G G G G GG G GGG Sbjct: 793 GGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGG 852 Query: 398 GXXGGGXGXGG 366 G GGG G GG Sbjct: 853 GGGGGGGGGGG 863 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGG G G G GGG G G Sbjct: 813 GGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGG 849 Score = 29.1 bits (62), Expect = 6.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXG 49 G GG D GG G GG GGGGGG G Sbjct: 835 GFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXT 94 P PPPPP P P PPPPPP PP T Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPP---PPIT 122 Score = 32.7 bits (71), Expect = 0.50 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PP P PPPPPP PP P PP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPP---PPPP 120 Score = 31.1 bits (67), Expect = 1.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 355 AXXGPPXPXPPPXXPXPPP 411 A PP P PPP P PPP Sbjct: 98 ACCAPPPPPPPPPPPPPPP 116 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 103 PPPPPPPPPPPPPPP 117 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 104 PPPPPPPPPPPPPPP 118 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 105 PPPPPPPPPPPPPPP 119 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 106 PPPPPPPPPPPPPPP 120 Score = 29.9 bits (64), Expect = 3.5 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 864 PPRPPXPPXXTXXXXXXXXXXALXPXXXXPPPP 962 PP PP PP T + P PPPP Sbjct: 112 PPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPP 144 Score = 29.5 bits (63), Expect = 4.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPP 60 P PP PPPPP PP Sbjct: 136 PAPPPPPPPPPAPCMPP 152 Score = 29.5 bits (63), Expect = 4.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 22 PXPPPPPPXXXPPXTPP 72 P PPPPPP P PP Sbjct: 136 PAPPPPPPPPPAPCMPP 152 Score = 26.6 bits (56), Expect(2) = 1.5 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 517 PPPPXPXPAAXPXPXSXPL 573 PPPP P P P P P+ Sbjct: 103 PPPPPPPPPPPPPPPPPPI 121 Score = 25.8 bits (54), Expect(2) = 2.6 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 517 PPPPXPXPAAXPXPXSXP 570 PPPP P P P P P Sbjct: 102 PPPPPPPPPPPPPPPPPP 119 Score = 23.0 bits (47), Expect(2) = 2.6 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP PP P PPP Sbjct: 96 PPACCAPPPPPPPPP 110 Score = 23.0 bits (47), Expect(2) = 1.5 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 P PPP P PPP Sbjct: 97 PACCAPPPPPPPPPP 111 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/44 (47%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -2 Query: 129 RXXXXGGRGPRXVXGGXFXGG--GGGGXGXXGXGGGGGXXXGXG 4 R GG G GG + GG GGGG G G GGGGG G G Sbjct: 164 RGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSG 207 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/35 (54%), Positives = 20/35 (57%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG G GG + GGGGGG G G GGGGG G Sbjct: 184 GGHGGGGYGGGGY-GGGGGGYGGSGYGGGGGYGGG 217 Score = 37.9 bits (84), Expect = 0.013 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG R GG + GGG GG G G G GGG G G Sbjct: 159 GGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGG 195 Score = 37.5 bits (83), Expect = 0.018 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 1/61 (1%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXG-EAXGGGXGGXRXXXXXXXXXXGXGGXXXGXG 569 GG GG GG G GG G G G GGG GG G GG G G Sbjct: 168 GGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGG 227 Query: 568 G 566 G Sbjct: 228 G 228 Score = 35.1 bits (77), Expect = 0.094 Identities = 23/58 (39%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGG-GGGGXGXXGXGGGGGXXXGXG 4 G + GG R G RG GG GG GGGG G G GGGG G G Sbjct: 141 GYRSGGGYRGGGGY-RGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYG 197 Score = 33.1 bits (72), Expect = 0.38 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG GG G G G G G G GGG G G GG G GG Sbjct: 146 GGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGG 205 Score = 33.1 bits (72), Expect = 0.38 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 2/62 (3%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGG--XGGXRXXXXXXXXXXGXGGXXXGX 572 GG GG G G GG G G G GGG GG G GG G Sbjct: 151 GGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGG 210 Query: 571 GG 566 GG Sbjct: 211 GG 212 Score = 33.1 bits (72), Expect = 0.38 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGG GG G G GGGG G G Sbjct: 174 GGYGGGGYGGGGHGGGGYGGGGY-GGGGGGYGGSGYG 209 Score = 32.7 bits (71), Expect = 0.50 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G R G GGGGG G GGGG G G Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGG 159 Score = 31.9 bits (69), Expect = 0.88 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 G + GG GG GG G G G GGG G G GG G GG Sbjct: 141 GYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGG 200 Score = 31.5 bits (68), Expect = 1.2 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG R G R GG GGGGG G GGGG G G Sbjct: 125 GGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYG 177 Score = 31.5 bits (68), Expect = 1.2 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 G GG GG G GG G G G GGG GG G G G GG Sbjct: 163 GRGRGGGGYGGGGYGGGGYGGGGHGGGGYG-GGGYGGGGGGYGGSGYGGGGGYGGGGYGG 221 Score = 30.7 bits (66), Expect = 2.0 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG GG GG G GG G G GG GG R G G G GG Sbjct: 125 GGRRGGG-YGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGG 183 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G GG G G G+ GGG GG Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGG 100 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGGG G G GGGG G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGG 98 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GG G GG GGGGGG G G GGGGG Sbjct: 79 GGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G G GG GG GGGGGG GG G Sbjct: 80 GGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 37.5 bits (83), Expect = 0.018 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G GG G G G GGG GG Sbjct: 72 GGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGG 108 Score = 37.1 bits (82), Expect = 0.023 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGGG G GG GG G G Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGG 100 Score = 37.1 bits (82), Expect = 0.023 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG G GGGG G G GGG G G G Sbjct: 72 GGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGG 108 Score = 37.1 bits (82), Expect = 0.023 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G G GG GGG G G GGGGG G G Sbjct: 76 GGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 37.1 bits (82), Expect = 0.023 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G G GGGGG G G GGGGG G G Sbjct: 78 GGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 36.3 bits (80), Expect = 0.041 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G GG G G GGG GG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGG 98 Score = 36.3 bits (80), Expect = 0.041 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G G G G G GGG GG Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGG 103 Score = 34.7 bits (76), Expect = 0.12 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGG--GXGXXGXGGGGGXXXGXG 4 GG G GG GGGGG G G G GGGGG G Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGG 103 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G G GGGG G G G G GGG G G Sbjct: 74 GGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 33.5 bits (73), Expect = 0.29 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G G G GG GGGGGG G G Sbjct: 71 GGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGG 105 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG G G G G G G GGG GG Sbjct: 76 GGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 33.1 bits (72), Expect = 0.38 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG G G GG G G G+ GGG GG Sbjct: 74 GGGGGGGGGGDDGDGGGGDG-GGGGGGGDGGGGGGGG 109 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXR 629 GG GG G G GG G G G GGG G R Sbjct: 77 GGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGR 115 Score = 31.1 bits (67), Expect = 1.5 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXG--GXXXGGGGGGXGGXXG 9 G GG G G GG G G GGGGGG G G Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGG 104 Score = 30.7 bits (66), Expect = 2.0 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXG 34 G GG GG G GG GGGGGG G G G Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 29.5 bits (63), Expect = 4.7 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXG 34 G GG D GG G GG GGGGGG G G Sbjct: 73 GGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 40.3 bits (90), Expect = 0.003 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPP 70 P P PPPPP P P PPPPP Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPP 83 Score = 33.1 bits (72), Expect = 0.38 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRG 103 P P P P PPPPPP PP G Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPPSG 85 Score = 31.9 bits (69), Expect = 0.88 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPP 72 T P P PPPPPP PP PP Sbjct: 60 TVPIPPTLPPPPPP-PPPPLPPP 81 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRG 103 P PP P P PPPPPP PP G Sbjct: 62 PIPPTLP--PPPPPPPPPLPPPPPSGG 86 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 69 PPPPPPPPPLPPPPP 83 Score = 26.6 bits (56), Expect(2) = 0.19 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXS 564 P PPPP P P P P S Sbjct: 65 PTLPPPPPPPPPPLPPPPPS 84 Score = 26.2 bits (55), Expect(2) = 0.19 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 364 GPPXPXPPPXXPXPPP 411 GP P PP P PPP Sbjct: 58 GPTVPIPPTLPPPPPP 73 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 40.3 bits (90), Expect = 0.003 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPP 70 P P PPPPP P P PPPPP Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPP 307 Score = 33.1 bits (72), Expect = 0.38 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRG 103 P P P P PPPPPP PP G Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPPSG 309 Score = 31.9 bits (69), Expect = 0.88 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPP 72 T P P PPPPPP PP PP Sbjct: 284 TVPIPPTLPPPPPP-PPPPLPPP 305 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRG 103 P PP P P PPPPPP PP G Sbjct: 286 PIPPTLP--PPPPPPPPPLPPPPPSGG 310 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 293 PPPPPPPPPLPPPPP 307 Score = 26.6 bits (56), Expect(2) = 0.18 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXS 564 P PPPP P P P P S Sbjct: 289 PTLPPPPPPPPPPLPPPPPS 308 Score = 26.2 bits (55), Expect(2) = 0.18 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 364 GPPXPXPPPXXPXPPP 411 GP P PP P PPP Sbjct: 282 GPTVPIPPTLPPPPPP 297 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/29 (55%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPP-PXNXPPXTXRGP 106 PPPPP P P PPPPP P P +GP Sbjct: 426 PPPPPAPLPPPPPPPPQPTTALPDPLQGP 454 Score = 37.9 bits (84), Expect = 0.013 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGP 106 PPPP P P PPPPPP P P Sbjct: 424 PPPPPPPAPLPPPPPPPPQPTTALPDP 450 Score = 35.9 bits (79), Expect = 0.054 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPP 73 PPPPP P PPPPPP Sbjct: 425 PPPPPPAPLPPPPPPPP 441 Score = 35.5 bits (78), Expect = 0.071 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 PPPPP P PPPPPP P T P P Sbjct: 424 PPPPPPPAPLPPPPPPP---PQPTTALPDP 450 Score = 31.5 bits (68), Expect = 1.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXP 85 P P PPPPP P P P P P Sbjct: 428 PPPAPLPPPPPPPPQPTTALPDPLQGP 454 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGGGG G G GGGGG G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGG 364 Score = 37.5 bits (83), Expect = 0.018 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GGGGGG G G GGGGG G G Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 35.5 bits (78), Expect = 0.071 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 108 RGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 RG GG GGGGGG G G GGGG G Sbjct: 336 RGGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 Score = 35.5 bits (78), Expect = 0.071 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G R GG GGGGGG G GGGG G G Sbjct: 337 GGSG-RGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 78 FXGGGGGGXGXXGXGGGGGXXXGXG 4 F GG G G G GGGGG G G Sbjct: 334 FPRGGSGRGGGGGGGGGGGGGGGGG 358 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PPPPP P P PPPPPP P Sbjct: 73 PPPLCAPPPPPPP--PPPPPPPPGAKKP 98 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPP P PPPPPP PP + P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 33.9 bits (74), Expect = 0.22 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 PPP P PPPPPP PP + P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXP 84 PP PPPPPP PP + P Sbjct: 80 PPPPPPPPPPPPPPGAKKPDDP 101 Score = 31.5 bits (68), Expect = 1.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTP 69 P PP PPPPPP P P Sbjct: 82 PPPPPPPPPPPPGAKKPDDP 101 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXP 84 T P PPPPPP PP P + P Sbjct: 72 TPPPLCAPPPPPPPPPPPPPPPGAKKP 98 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 79 PPPPPPPPPPPPPPP 93 Score = 28.7 bits (61), Expect = 8.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXN 79 P P PPPPP P P P N Sbjct: 80 PPPPPPPPPPPPPPGAKKPDDPVAN 104 Score = 26.2 bits (55), Expect(2) = 0.93 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP PPP P PPP Sbjct: 74 PPLCAPPPPPPPPPP 88 Score = 24.2 bits (50), Expect(2) = 0.93 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 517 PPPPXPXPAAXPXP 558 PPPP P P P P Sbjct: 80 PPPPPPPPPPPPPP 93 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PPPPP P P PPPPPP P Sbjct: 274 PPPLCAPPPPPPP--PPPPPPPPGAKKP 299 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPP P PPPPPP PP + P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 33.9 bits (74), Expect = 0.22 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 PPP P PPPPPP PP + P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXP 84 PP PPPPPP PP + P Sbjct: 281 PPPPPPPPPPPPPPGAKKPDDP 302 Score = 31.5 bits (68), Expect = 1.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTP 69 P PP PPPPPP P P Sbjct: 283 PPPPPPPPPPPPGAKKPDDP 302 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXP 84 T P PPPPPP PP P + P Sbjct: 273 TPPPLCAPPPPPPPPPPPPPPPGAKKP 299 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 280 PPPPPPPPPPPPPPP 294 Score = 28.7 bits (61), Expect = 8.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXN 79 P P PPPPP P P P N Sbjct: 281 PPPPPPPPPPPPPPGAKKPDDPVAN 305 Score = 26.2 bits (55), Expect(2) = 0.89 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP PPP P PPP Sbjct: 275 PPLCAPPPPPPPPPP 289 Score = 24.2 bits (50), Expect(2) = 0.89 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 517 PPPPXPXPAAXPXP 558 PPPP P P P P Sbjct: 281 PPPPPPPPPPPPPP 294 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P PPPPP PPPPP P T P P + G PP P Sbjct: 146 PATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPP 202 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPP P PPPPPP PP PP Sbjct: 182 PLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPP 218 Score = 38.7 bits (86), Expect = 0.008 Identities = 23/54 (42%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = +2 Query: 5 PXPXXXPPPPP-XPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PPPPP P PPPPPP P T P PP + A A G PP Sbjct: 120 PSQAPSPPPPPTSPATRAPPPPPP--IAPATGGPPPPPPI-----APATGGPPP 166 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPP P P PPPPPP P P PP Sbjct: 189 PPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 36.3 bits (80), Expect = 0.041 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +2 Query: 5 PXPXXXPPPPP-XPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P PPPPP P PPPPPP P T P PP + Sbjct: 133 PATRAPPPPPPIAPATGGPPPPPP--IAPATGGPPPPPPI 170 Score = 35.9 bits (79), Expect = 0.054 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +2 Query: 23 PPPPPXPXXPXPPP-PPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 PPPP P P P PPP P T P PP + A A G PP Sbjct: 111 PPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPI-----APATGGPPP 153 Score = 35.1 bits (77), Expect = 0.094 Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPR-PPXLXXRGXASAAGXDPPXLXP 175 P PPP P P P P PP T R PP A+ PP + P Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAP 159 Score = 33.5 bits (73), Expect = 0.29 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP 73 P P PPPPP P PPPP Sbjct: 197 PPPPPPPPPPPPPILELAAPPPP 219 Score = 32.7 bits (71), Expect = 0.50 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 364 GPPXPXPPPXXPXPPP 411 GPP P PPP P PPP Sbjct: 194 GPPPPPPPPPPPPPPP 209 Score = 31.9 bits (69), Expect = 0.88 Identities = 16/50 (32%), Positives = 19/50 (38%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P P PPPP P + P PP A+ A PP + P Sbjct: 98 PTPMVAQSVAPTPPPPPRAPETPSQAPSPPP-PPTSPATRAPPPPPPIAP 146 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 4 TXPXXPPXPPPP--PPXXXPPXTPPXEXPTXXPXGPP 108 T P PPPP P PP PP T P PP Sbjct: 119 TPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPP 155 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 28 PPPPPPXXXPPXTPPXEXPTXXPXG 102 PPPPPP PP P E P G Sbjct: 196 PPPPPPPPPPPPPPILELAAPPPPG 220 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P P PPPP PP P PP Sbjct: 172 PAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPP 206 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +1 Query: 4 TXPXXPPXPPPP---PPXXXPPXTPPXEXPTXXPXGPP 108 T P PPPP P PP PP T P PP Sbjct: 131 TSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPP 168 Score = 29.1 bits (62), Expect = 6.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 364 GPPXPXPPPXXPXPPP 411 G P P PPP P PPP Sbjct: 193 GGPPPPPPPPPPPPPP 208 Score = 28.7 bits (61), Expect = 8.2 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +3 Query: 864 PPRPPXPPXXTXXXXXXXXXXALXPXXXXPPPPGXXARXXXPPXAAXTRAGXPP 1025 PP PP P T A P PPP PP A PP Sbjct: 165 PPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPP 218 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +2 Query: 26 PPPPXPXXPXPP--PPPPXNXPPXTXRGPRPP 115 PPPP P P PPPP PP RGP PP Sbjct: 469 PPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPP 500 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPP P P PPPP PP P PP Sbjct: 471 PPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPP 507 Score = 33.1 bits (72), Expect = 0.38 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +2 Query: 5 PXPXXXPPPP--PXPXXPXPPPPPPXNXPPXTXRGP 106 P P PPPP P P PPPP PP R P Sbjct: 477 PPPRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQRMP 512 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP-PPPPPXNXPPXTXRGPRPP 115 P P PPP P P PPPP P RG PP Sbjct: 469 PPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPP 506 Score = 30.3 bits (65), Expect = 2.7 Identities = 21/64 (32%), Positives = 23/64 (35%), Gaps = 7/64 (10%) Frame = +2 Query: 5 PXPXXXPPPP----PXPXXPXPPPP---PPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPPP P P PPPP P PP + P A G +PP Sbjct: 483 PPPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQGPPQVHYPSQDPQRLGAVKAMEKG-EPP 541 Query: 164 XLXP 175 P Sbjct: 542 KAPP 545 Score = 29.5 bits (63), Expect = 4.7 Identities = 21/63 (33%), Positives = 22/63 (34%), Gaps = 6/63 (9%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP----PP--PPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPX 166 P P PP P P P PP PP PP RG PP + G PP Sbjct: 429 PPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGM--YPPPRGFPPPP 486 Query: 167 LXP 175 P Sbjct: 487 FGP 489 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 39.1 bits (87), Expect = 0.006 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG AAGG G G GG G G GGG GG G GG G GG Sbjct: 1783 GGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGG 1842 Score = 35.1 bits (77), Expect = 0.094 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG G + GG GGGGG G G GGG G Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGG 1794 Score = 34.7 bits (76), Expect = 0.12 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXG-GXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXG 569 GG GG GG G G G G G A GGG G G GG G G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGG 1815 Query: 568 G 566 G Sbjct: 1816 G 1816 Score = 34.7 bits (76), Expect = 0.12 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG A G GG GGGG G G GGGGG G G Sbjct: 1765 GGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGG 1821 Score = 34.7 bits (76), Expect = 0.12 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 1/58 (1%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXG-GGGGXXXGXG 4 G GG AA G G GG GGGGGG G G G G G G G Sbjct: 1777 GGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAG 1834 Score = 33.9 bits (74), Expect = 0.22 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGGGG G G GGG G G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGG 1783 Score = 33.5 bits (73), Expect = 0.29 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG G GG G GGG G G GGG G G Sbjct: 1811 GGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGG 1845 Score = 32.7 bits (71), Expect = 0.50 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGGG G G GGGG G G Sbjct: 1763 GGGGMGGGGGMAGGGGGMGGGGMAAGGG 1790 Score = 32.7 bits (71), Expect = 0.50 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 G GG G +G + GG+ G GG GGG GG Sbjct: 1816 GMGG-GGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 32.3 bits (70), Expect = 0.66 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGG G G G G GG G Sbjct: 1799 GGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGG 1835 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 Query: 95 GXXVGXSXGGVXGGXXXGGGGGGXGG 18 G G GG+ GG GGGGG GG Sbjct: 1757 GFGGGGGGGGMGGGGGMAGGGGGMGG 1782 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGG G GGG G G Sbjct: 1761 GGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEG 1797 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXX--GEAXGGGXGG 635 GG GG GG G G G G GE G G GG Sbjct: 1806 GGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGG 1844 Score = 30.3 bits (65), Expect = 2.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 G GG A GG G G GG G G G GGGGG Sbjct: 1795 GEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGG 1845 Score = 29.5 bits (63), Expect = 4.7 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = -3 Query: 551 GXAAGXGXGGGGRXXGPXXXXXXXXXXXXXXXXXXXXXXXXXGXXXRGGGXGXXGGGXGX 372 G G G GGGG G G GGG G GGG G Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGG 1819 Query: 371 GG 366 GG Sbjct: 1820 GG 1821 Score = 29.5 bits (63), Expect = 4.7 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG G A GG G G G GGG GG Sbjct: 1813 GGGGMGGGGEGMGAAGGGMGAGGE---GGGAGGGGGG 1846 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 38.7 bits (86), Expect = 0.008 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXP 85 P PPPPP P PPPPPP P Sbjct: 82 PPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 29.5 bits (63), Expect = 4.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 22 PXPPPPPPXXXPPXTPPXEXPTXXP 96 P PPPPPP PP P P Sbjct: 82 PPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 29.5 bits (63), Expect = 4.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPPP PPPP P PP Sbjct: 584 PPPPPQMNNTSAPPPPNKEKQTAKPPAPLPP 614 Score = 29.1 bits (62), Expect = 6.2 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P PPP P PPP N T + P P Sbjct: 582 PIPPPPPQMNNTSAPPPPNKEKQTAKPPAP 611 Score = 25.4 bits (53), Expect(2) = 2.9 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +1 Query: 517 PPPPXPXPAAXPXPXSXPLXP 579 PPPP P P A P P P Sbjct: 82 PPPPPPPPPASNVPAPPPPPP 102 Score = 23.0 bits (47), Expect(2) = 2.9 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 364 GPPXPXPPPXXPXPP 408 GP PPP P PP Sbjct: 76 GPAAVIPPPPPPPPP 90 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 38.7 bits (86), Expect = 0.008 Identities = 23/59 (38%), Positives = 25/59 (42%), Gaps = 2/59 (3%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXG--GGGGGXGXXGXGGGGGXXXGXG 4 G GG+ + GG G R V G G GGGG G G GGGGG G G Sbjct: 193 GSNFGGAYGPGGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGGG 251 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 G G GG + GGG G GGGGG Sbjct: 236 GNGGGGGGGGGYSGGGSGNPHYYACGGGGG 265 Score = 29.5 bits (63), Expect = 4.7 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGG----XGXXGXGGGGGXXXGXG 4 GG D G GP G F GG GG G G GGGG G G Sbjct: 182 GGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNG 238 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 38.7 bits (86), Expect = 0.008 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXP 85 P PPPPP P PPPPPP P Sbjct: 227 PPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 38.3 bits (85), Expect = 0.010 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P PP P P PPPPP PP P PP Sbjct: 216 PEPDYLEPTPPPPAAPAPPPPPAAAPPPPP---PPPP 249 Score = 37.1 bits (82), Expect = 0.023 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PPPP P PPPPPP P Sbjct: 226 PPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 32.7 bits (71), Expect = 0.50 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PP P P PPPP PP P PP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPP 244 Score = 31.5 bits (68), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXP 96 P P P PPPP P PP P P Sbjct: 225 PPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 38.7 bits (86), Expect = 0.008 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GGR V G F GGGG G G GGGGG G Sbjct: 477 GGRSIWNVVPGGFGGGGGASGGGGGGGGGGGFSGG 511 Score = 34.3 bits (75), Expect = 0.16 Identities = 20/58 (34%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXG-GGGGGXGXXGXGGGGGXXXGXG 4 G GG+ + GG G R + G GGGGG G GGGGG G Sbjct: 454 GSNFGGAYGPGGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGGGGGGGGGFSGG 511 Score = 29.9 bits (64), Expect = 3.5 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 5/58 (8%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXG-----XXGXGGGGGXXXGXG 4 GG D G GP G F GG GG G GGGGG G G Sbjct: 443 GGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGG 500 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 38.7 bits (86), Expect = 0.008 Identities = 22/49 (44%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGP--RXVXGGXFXGGGGGGXGXXGXGGGGG 22 G S A R GGRG R GG + GG GGG G G GGGG Sbjct: 297 GRSMKVNQARSREQRGGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGG 345 Score = 32.3 bits (70), Expect = 0.66 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 730 GGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G G G GGG GG Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGG 343 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGG--GGGXXXGXG 4 GG GG GGG G G GG GGG G G Sbjct: 109 GGSSRGGYGGGRGGGGYGGGRGGGGSYGGG 138 Score = 31.1 bits (67), Expect = 1.5 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 G + GG GG GG GG GGG G G GGG G Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGRRDYG 143 Score = 30.3 bits (65), Expect = 2.7 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -2 Query: 138 AXPRXXXXGGRGPRXVXGGXFXGGGG-GGXGXXGXGGG-GGXXXGXG 4 A PR GG GG GGGG GG G GGG GG G G Sbjct: 85 AQPRGERGGGGSQ---GGGYRSGGGGYGGSSRGGYGGGRGGGGYGGG 128 Score = 29.1 bits (62), Expect = 6.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 71 GGVXGGXXXGGGGGGXGGXXG 9 GG GG GGGGG GG G Sbjct: 312 GGGRGGGYRSGGGGGYGGGRG 332 Score = 28.7 bits (61), Expect = 8.2 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGG-XGGXR 629 G + GG GG G G G G G GGG GG R Sbjct: 100 GYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGR 139 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 38.3 bits (85), Expect = 0.010 Identities = 19/53 (35%), Positives = 21/53 (39%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP PPPPP + PP + R PP R G PP Sbjct: 323 PSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPP-PGRAPQPLGGPPPP 374 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGP 106 P PPP P P PPP N PP RGP Sbjct: 224 PSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGP 257 Score = 36.3 bits (80), Expect = 0.041 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRG-PRPPXLXXRGXAS 142 P PPPP PPPP N PP RG PP RG S Sbjct: 244 PPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPS 290 Score = 36.3 bits (80), Expect = 0.041 Identities = 20/55 (36%), Positives = 21/55 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P P PPPP PPPPP P + PP R A A PP L Sbjct: 263 PPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPA---PPPPL 314 Score = 36.3 bits (80), Expect = 0.041 Identities = 20/60 (33%), Positives = 24/60 (40%), Gaps = 7/60 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXN----XPPXTXRG---PRPPXLXXRGXASAAGXDPP 163 P P PP P PPPPPP PP RG P PP + ++ + PP Sbjct: 301 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPP 360 Score = 35.9 bits (79), Expect = 0.054 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +2 Query: 23 PPPPPXPXXPXPP---PPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 PPPPP P PPPP P GP PP R + PP Sbjct: 341 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPP 390 Score = 35.9 bits (79), Expect = 0.054 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXP----XPPPPPPXNXPPXTXRGPRPP 115 P PPPP P PPPPPP PP P PP Sbjct: 350 PTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPP 390 Score = 33.1 bits (72), Expect = 0.38 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +2 Query: 23 PPPP---PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPP P P PPPPP P P PP Sbjct: 358 PPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPP 391 Score = 32.3 bits (70), Expect = 0.66 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPP--PXNXPP 88 PPPPP P P PP P P PP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 32.3 bits (70), Expect = 0.66 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXN 79 P P PPPP P P PPP N Sbjct: 5 PPPPGPPPPPSAPSGPVKPPPSSKN 29 Score = 31.9 bits (69), Expect = 0.88 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 7/41 (17%) Frame = +2 Query: 5 PXPXXXPPPPPX-------PXXPXPPPPPPXNXPPXTXRGP 106 P P PPPPP P PPPPP + P T GP Sbjct: 365 PQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKPSFT-NGP 404 Score = 31.5 bits (68), Expect = 1.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 PPP PPPPPP P P P Sbjct: 206 PPPPERSSGPPPPPPGRGPSQRSLAPPP 233 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXN---XPPXTXRGP 106 PPPPP PPPP + PP RGP Sbjct: 194 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGP 224 Score = 30.7 bits (66), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPP 72 P PP PPPPP P PP Sbjct: 4 PPPPPGPPPPPSAPSGPVKPP 24 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGG 31 GG F GGGGG G G GG Sbjct: 78 GGGFSGGGGGSMGGGGLGG 96 Score = 29.9 bits (64), Expect = 3.5 Identities = 12/23 (52%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +2 Query: 50 PXPPPPPPXNXPPXTXRGP-RPP 115 P PPPPP PP GP +PP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPP 24 Score = 29.9 bits (64), Expect = 3.5 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 5/66 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXP-----XPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P PPPPP P PPP P G P RG S PP Sbjct: 209 PERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKN 268 Query: 170 XPXXXK 187 P K Sbjct: 269 APPPPK 274 Score = 29.9 bits (64), Expect = 3.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 29 PPPXPXXPXPPPPPP 73 PPP P PPPPPP Sbjct: 464 PPPVPPSRGPPPPPP 478 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +2 Query: 23 PPPPPXPXXPXPPPP---PPXNXPPXTXRGPRPP 115 P PP P PPPP P PP + P PP Sbjct: 299 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPP 332 Score = 29.1 bits (62), Expect = 6.2 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 6/53 (11%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXP------PXPPPXASPXXAXPXXPXPPXPA 707 PP P PP R P P PPP P P PP PA Sbjct: 342 PPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPA 394 Score = 28.7 bits (61), Expect = 8.2 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 PPPP PPPP + PP G P Sbjct: 195 PPPPHSRHGSAPPPPERSSGPPPPPPGRGP 224 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 38.3 bits (85), Expect = 0.010 Identities = 19/53 (35%), Positives = 21/53 (39%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP PPPPP + PP + R PP R G PP Sbjct: 235 PSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPP-PGRAPQPLGGPPPP 286 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGP 106 P PPP P P PPP N PP RGP Sbjct: 136 PSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGP 169 Score = 36.3 bits (80), Expect = 0.041 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRG-PRPPXLXXRGXAS 142 P PPPP PPPP N PP RG PP RG S Sbjct: 156 PPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPS 202 Score = 36.3 bits (80), Expect = 0.041 Identities = 20/55 (36%), Positives = 21/55 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P P PPPP PPPPP P + PP R A A PP L Sbjct: 175 PPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPA---PPPPL 226 Score = 36.3 bits (80), Expect = 0.041 Identities = 20/60 (33%), Positives = 24/60 (40%), Gaps = 7/60 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXN----XPPXTXRG---PRPPXLXXRGXASAAGXDPP 163 P P PP P PPPPPP PP RG P PP + ++ + PP Sbjct: 213 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPP 272 Score = 35.9 bits (79), Expect = 0.054 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +2 Query: 23 PPPPPXPXXPXPP---PPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 PPPPP P PPPP P GP PP R + PP Sbjct: 253 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPP 302 Score = 35.9 bits (79), Expect = 0.054 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXP----XPPPPPPXNXPPXTXRGPRPP 115 P PPPP P PPPPPP PP P PP Sbjct: 262 PTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPP 302 Score = 33.1 bits (72), Expect = 0.38 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +2 Query: 23 PPPP---PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPP P P PPPPP P P PP Sbjct: 270 PPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPP 303 Score = 31.9 bits (69), Expect = 0.88 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 7/41 (17%) Frame = +2 Query: 5 PXPXXXPPPPPX-------PXXPXPPPPPPXNXPPXTXRGP 106 P P PPPPP P PPPPP + P T GP Sbjct: 277 PQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKPSFT-NGP 316 Score = 31.5 bits (68), Expect = 1.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 PPP PPPPPP P P P Sbjct: 118 PPPPERSSGPPPPPPGRGPSQRSLAPPP 145 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXN---XPPXTXRGP 106 PPPPP PPPP + PP RGP Sbjct: 106 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGP 136 Score = 29.9 bits (64), Expect = 3.5 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 5/66 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXP-----XPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P PPPPP P PPP P G P RG S PP Sbjct: 121 PERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKN 180 Query: 170 XPXXXK 187 P K Sbjct: 181 APPPPK 186 Score = 29.9 bits (64), Expect = 3.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 29 PPPXPXXPXPPPPPP 73 PPP P PPPPPP Sbjct: 376 PPPVPPSRGPPPPPP 390 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +2 Query: 23 PPPPPXPXXPXPPPP---PPXNXPPXTXRGPRPP 115 P PP P PPPP P PP + P PP Sbjct: 211 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPP 244 Score = 29.1 bits (62), Expect = 6.2 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 6/53 (11%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXP------PXPPPXASPXXAXPXXPXPPXPA 707 PP P PP R P P PPP P P PP PA Sbjct: 254 PPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPA 306 Score = 28.7 bits (61), Expect = 8.2 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 PPPP PPPP + PP G P Sbjct: 107 PPPPHSRHGSAPPPPERSSGPPPPPPGRGP 136 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 37.9 bits (84), Expect = 0.013 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG GGGGGG G G GGGGG G Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGGGG 105 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 G G GG GGGGGG G GGGGG Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGG 103 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = -2 Query: 87 GGXFXGGGG---GGXGXXGXGGGGGXXXGXG 4 GG GGGG GG G G GGGGG G G Sbjct: 75 GGDTDGGGGCGGGGGGGGGVGGGGGGGGGGG 105 Score = 33.1 bits (72), Expect = 0.38 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 107 GGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 GG G GG GG GGGGGG GG Sbjct: 75 GGDTDGGGGCGGGGGGGGGVGGGGGGGGGG 104 Score = 31.9 bits (69), Expect = 0.88 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 107 GGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 GG G GG GG GGGGGG GG Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGG 103 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 G G G GG GG GGGGGG GG Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGG 105 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGG GG G G GGG G G Sbjct: 86 GGGGGGGGVGGGGGGGGGGGDDCEDGGG 113 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGG G G GGG G G G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGG 101 Score = 29.5 bits (63), Expect = 4.7 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG G GG GGGGGG GG G G Sbjct: 86 GGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGG 120 Score = 28.7 bits (61), Expect = 8.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 730 GGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG G GG G G G GGG GG Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGG 105 Score = 28.7 bits (61), Expect = 8.2 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG GG G G GGG G Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 Score = 28.7 bits (61), Expect = 8.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG G GG GGGGGG G GG G Sbjct: 82 GGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 37.9 bits (84), Expect = 0.013 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG GGGGGG G G GGGGG G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 37.5 bits (83), Expect = 0.018 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 84 GXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GGGGGG G G GGGGG G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGG 22 GG GGGGGG G G GGGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGG 74 Score = 32.3 bits (70), Expect = 0.66 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG GGGGGG G G GG G G Sbjct: 59 GGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXG 34 GG G GG GGGGGG G G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 29.5 bits (63), Expect = 4.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 95 GXXVGXSXGGVXGGXXXGGGGGGXG 21 G G GG GG GGGGGG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 29.5 bits (63), Expect = 4.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 95 GXXVGXSXGGVXGGXXXGGGGGGXG 21 G G GG GG GGGGGG G Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 29.1 bits (62), Expect = 6.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 95 GXXVGXSXGGVXGGXXXGGGGGGXGG 18 G G GG GG GGGGGG G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 28.7 bits (61), Expect = 8.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGG 25 GG G GG GGGGGG G G G Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 37.9 bits (84), Expect = 0.013 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G V GG GGGG G G GGGG G G Sbjct: 305 GGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGG 341 Score = 35.9 bits (79), Expect = 0.054 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGX--GGGGGXXXGXG 4 GG G GG GGGGG G G GGGGG G G Sbjct: 248 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 286 Score = 35.9 bits (79), Expect = 0.054 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGX--GGGGGXXXGXG 4 GG G GG GGGGG G G GGGGG G G Sbjct: 255 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 293 Score = 35.9 bits (79), Expect = 0.054 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGX--GGGGGXXXGXG 4 GG G GG GGGGG G G GGGGG G G Sbjct: 262 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 300 Score = 35.9 bits (79), Expect = 0.054 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGX--GGGGGXXXGXG 4 GG G GG GGGGG G G GGGGG G G Sbjct: 269 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 307 Score = 35.1 bits (77), Expect = 0.094 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGG G G GGGG G G Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 278 Score = 35.1 bits (77), Expect = 0.094 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGG G G GGGG G G Sbjct: 277 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVG 313 Score = 34.3 bits (75), Expect = 0.16 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXG-GGGGXXXGXG 4 GG G GG GGGGG G G GGGG G G Sbjct: 290 GGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGG 327 Score = 33.5 bits (73), Expect = 0.29 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 4/39 (10%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVX----GGXXXGGGGGGXGGXXG 9 G GG G VG + GG GG GGGGG GG G Sbjct: 319 GGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGG 357 Score = 32.7 bits (71), Expect = 0.50 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXG--XGGGGG 22 GG G GG GGGGG G G GGGGG Sbjct: 276 GGGGGATGGGGGATGGGGGATGGGGGATGGGGG 308 Score = 32.7 bits (71), Expect = 0.50 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GG G GG GGGGG G G G GG Sbjct: 332 GGGGGATGGGGGVTGGGGGATGGGGGPGSGG 362 Score = 32.3 bits (70), Expect = 0.66 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGX--GGGGGXXXGXG 4 GG G GG GGGGG G G G GGG G G Sbjct: 283 GGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGG 321 Score = 32.3 bits (70), Expect = 0.66 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGX--GGGGGXXXGXG 4 GG G G GGGGG G G GGGGG G G Sbjct: 318 GGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGG 356 Score = 31.9 bits (69), Expect = 0.88 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 5/65 (7%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXX--GEAXGGG---XGGXRXXXXXXXXXXGXGGXX 581 GG A GG G G G G G A G A GGG GG G GG Sbjct: 285 GGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGV 344 Query: 580 XGXGG 566 G GG Sbjct: 345 TGGGG 349 Score = 31.5 bits (68), Expect = 1.2 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 2/62 (3%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGG--XGGXRXXXXXXXXXXGXGGXXXGX 572 G GGA GG GG G G GGG GG G GG G Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGG 298 Query: 571 GG 566 GG Sbjct: 299 GG 300 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGE--AXGGGXG 638 GG A GG G G G G G A G A GGG G Sbjct: 264 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 301 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGE--AXGGGXG 638 GG A GG G G G G G A G A GGG G Sbjct: 271 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 308 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G R G GGG G G GGGGG G G Sbjct: 229 GSRLSNDRSNGRLGGGGATGGGGGATGGGGGATGGGG 265 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGG G G GGGG G Sbjct: 326 GGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGG 362 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAX--GGGXG 638 GG A GG G G G G G A G GGG G Sbjct: 313 GGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGG 350 Score = 29.5 bits (63), Expect = 4.7 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 5/62 (8%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGG--GGGXGXXGXGG---GGGXXXG 10 G GG A GG G GGG GGG G G GG GGG G Sbjct: 300 GGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPG 359 Query: 9 XG 4 G Sbjct: 360 SG 361 Score = 29.5 bits (63), Expect = 4.7 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -3 Query: 107 GGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 GG G G + GGV GG GG GG G Sbjct: 314 GGATGGGGGATGGGVGATGGGGGATGGGGGVTG 346 Score = 29.1 bits (62), Expect = 6.2 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG A GG G GGG G G GGG G G G Sbjct: 279 GGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGG 335 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP--PPPPPXNXPPXTXRGPRPP 115 P P P PPP P P P PPP PP + P PP Sbjct: 1049 PPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPP 1087 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP---PPPPXNXPPXTXRGPRPP 115 P P P PP P PP P PP + P R P PP Sbjct: 1040 PLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPP 1079 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P PPP P P PP Sbjct: 1069 PAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPP 1105 Score = 32.3 bits (70), Expect = 0.66 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXP--PPPPPXNXPPXTXRGPRP 112 P P PPP P P PPPP + P R P P Sbjct: 1058 PPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDP 1093 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPR 414 P P PPP P PPPR Sbjct: 1059 PRKPSPPPSEPAPPPR 1074 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 37.5 bits (83), Expect = 0.018 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 PP PP P PP PP + PT P PP Sbjct: 26 PPTDPPTDPPTDPPTDPPTDPPTDPPTDPP 55 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXP 96 P PP PP P PP PP + PT P Sbjct: 27 PTDPPTDPPTDPPTDPPTDPPTDPPTDPP 55 Score = 32.7 bits (71), Expect = 0.50 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPT 87 P PP PP P PP PP + PT Sbjct: 31 PTDPPTDPPTDPPTDPPTDPPTDPPT 56 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 37.5 bits (83), Expect = 0.018 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAA 148 PP PP P P PP PP PP P PP G S A Sbjct: 178 PPAPPPPGAPAAPPAPPFGGPPSAP--PPPPAPPVGGGGSLA 217 Score = 36.7 bits (81), Expect = 0.031 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PPPP PP PP P P PP P Sbjct: 175 PAAPPAPPPPGAPAAPP-APPFGGPPSAPPPPPAP 208 Score = 32.7 bits (71), Expect = 0.50 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 19 PPXPPPPPPXXX-PPXTPPXEXPTXXPXGPPXP 114 PP PP PP P PP P P PP P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAP 193 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P PP PP P PP P PP P Sbjct: 171 PFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPP 205 Score = 30.3 bits (65), Expect = 2.7 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = +3 Query: 864 PPRPPXPPXXTXXXXXXXXXXALXPXXXXPPPPGXXARXXXPPXAAXTRAGXPPHXLP 1037 PP+PP PP A P PPPPG A PP A PP P Sbjct: 161 PPQPPAPPAAPFMAP------AAPPA---PPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP 73 P PP PP P PPPPP Sbjct: 184 PGAPAAPPAPPFGGPPSAPPPPP 206 Score = 29.5 bits (63), Expect = 4.7 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP-PPPPXNXPP 88 P P P PP P PP PPP PP Sbjct: 181 PPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 37.5 bits (83), Expect = 0.018 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PPPPP P PPPP P P PP + A AA P Sbjct: 785 PPEYPPPPPGLARPNPPPPNPPLQVTSIPGEPAPPFVKLIASAMAAAFPFP 835 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/54 (29%), Positives = 18/54 (33%) Frame = +3 Query: 864 PPRPPXPPXXTXXXXXXXXXXALXPXXXXPPPPGXXARXXXPPXAAXTRAGXPP 1025 PP PP PP ++ P PPPP A P T PP Sbjct: 859 PPCPPDPPQRLPLVEACPGSPSVKPAIDWPPPPPPPATSNGDPSLLLTTNVPPP 912 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +1 Query: 10 PXXPPXP-PPPPPXXXPPXTPPXEXP---TXXPXGPPXP 114 P PP PPPPP P PP P T P P P Sbjct: 781 PTTPPPEYPPPPPGLARPNPPPPNPPLQVTSIPGEPAPP 819 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 37.5 bits (83), Expect = 0.018 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPR 109 P PPPPP P PPPPP PP GP+ Sbjct: 299 PAAAPPPPPLPAGVPAPPPPP---PPPMLGGPK 328 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 37.5 bits (83), Expect = 0.018 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPP 72 P PP PPPPPP PP PP Sbjct: 1308 PESPPPPPPPPPPPPPPPLPP 1328 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPP 88 P PPPPP P P PPPPPP P Sbjct: 1307 PPESPPPPPPP--PPPPPPPPLPPTP 1330 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXN 79 P PPPPP P P PP PP N Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTPN 1331 Score = 33.9 bits (74), Expect = 0.22 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXE 78 P PP PPPPPP P TP E Sbjct: 1311 PPPPPPPPPPPPPPPLPPTPNVE 1333 Score = 31.5 bits (68), Expect = 1.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXT 94 PP P P PPPPPP P T Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPT 1329 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 1311 PPPPPPPPPPPPPPP 1325 Score = 28.7 bits (61), Expect = 8.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 41 PXXPXPPPPPPXNXPPXTXRGPRP 112 P PPPPPP PP P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 28.7 bits (61), Expect = 8.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 28 PPPPPPXXXPPXTPPXEXPT 87 PPPPPP PP PP PT Sbjct: 1312 PPPPPP--PPPPPPPPLPPT 1329 Score = 27.1 bits (57), Expect(2) = 0.22 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP PPP P PPP Sbjct: 1307 PPESPPPPPPPPPPP 1321 Score = 25.4 bits (53), Expect(2) = 0.22 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXP 558 P PPPP P P P P Sbjct: 1313 PPPPPPPPPPPPPLPPTP 1330 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 37.5 bits (83), Expect = 0.018 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 PPP P PP PPP PP T P+P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 35.9 bits (79), Expect = 0.054 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +1 Query: 10 PXXPPXPPP-PPPXXXPPXTPPXEXPT 87 P PP PPP PPP PP T P PT Sbjct: 432 PTPPPTPPPTPPPTTLPPTTQPPPQPT 458 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXG 102 T P PP PPP P PP P P G Sbjct: 427 TATPPPTPPPTPPPTPPPTTLPPTTQPPPQPTG 459 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +1 Query: 31 PPPPPXXXPPXTPPXE--XPTXXPXGPPXP 114 PPP P PP TPP PT P PP P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQP--PPQP 457 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPPP P PPP PP P GP+ P Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGP 59 Score = 36.3 bits (80), Expect = 0.041 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGP 106 P P PPPPP P P PP P P +GP Sbjct: 32 PPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGP 65 Score = 33.1 bits (72), Expect = 0.38 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 4 TXPXXPPXP-PPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T P PP PPPPP P PP P GP P Sbjct: 28 TPPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGP 65 Score = 32.7 bits (71), Expect = 0.50 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAG 151 P PP P P PP PP P GP P L G + AG Sbjct: 625 PGPPGPASPPSPPGPPGPPGPKGPPGPNGP-LGPPGESGPAG 665 Score = 32.7 bits (71), Expect = 0.50 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP--XLXXRGXASAAG 151 PP P P P PP PP P +GP P L G A AG Sbjct: 876 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGCLGPPGDAGPAG 920 Score = 32.3 bits (70), Expect = 0.66 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAG 151 P PP P P PP PP P GP P L G AG Sbjct: 710 PGPPGPASPPSPPGPPGPPGPNGPPGPNGP-LGPPGECGPAG 750 Score = 32.3 bits (70), Expect = 0.66 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAG 151 P PP P P PP PP P GP P L G AG Sbjct: 795 PGPPGPASPPSPPGPPGPPGPKGPPGPNGP-LGPPGECGPAG 835 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGP 106 PP PP P P PP PP P GP Sbjct: 111 PPGPPGPPGPQMPPGPPGLPGPPGPAGP 138 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAG 151 P PP P P P PP PP P GP P G A AG Sbjct: 621 PAGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP-GESGPAGNAG 668 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PP P P P PP PP P +GP P Sbjct: 791 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGP 821 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P P PP PP PP P + P P GPP Sbjct: 181 PNGPLGPPGPPGDMGPPGLPGPQGP-QMPPGPP 212 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PP P P P PP PP P GP P Sbjct: 706 PPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGP 742 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PP P P P PP PP P GP P Sbjct: 791 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGP 827 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPR-PPXL 121 P P PPP P P P PP P GP+ PP L Sbjct: 30 PPPPPYEAPPPPPGPPGPDGPPGFPGPQG-PNGPKGPPGL 68 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P PP P P P PP N P PP Sbjct: 288 PGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPP 324 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P PP P P P PP N P PP Sbjct: 373 PGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPP 409 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXP--PXTXRGP 106 P P P PP P P P PP N P P GP Sbjct: 458 PGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGP 493 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXP--PXTXRGP 106 P P P PP P P P PP N P P GP Sbjct: 543 PGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGP 578 Score = 29.1 bits (62), Expect = 6.2 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P P PP P P P PP P GP P G AG P P Sbjct: 883 PGPASPPSPPGPPGPPGPKGPP----GPNGCLGP-PGDAGPAGNTGGAGCQPAPPCP 934 Score = 28.7 bits (61), Expect = 8.2 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P P P P P PP PP T PP Sbjct: 112 PGPPGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPP 148 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXGXG 4 GGGGGG G G GGGGG G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDG 63 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXGXG 4 GGGGGG G G GGGGG G G Sbjct: 43 GGGGGGGGGGGGGGGGGDGDGDG 65 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 84 GXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GGGGGG G G GGG G G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDG 67 Score = 32.7 bits (71), Expect = 0.50 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G G G A GGG GG Sbjct: 44 GGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGG 80 Score = 32.3 bits (70), Expect = 0.66 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G G G A GGG GG Sbjct: 45 GGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGG 81 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G G G GGGGGG G G Sbjct: 53 GGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDG 87 Score = 29.1 bits (62), Expect = 6.2 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G G + GGG GG Sbjct: 46 GGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGG 82 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G G A GGG GG Sbjct: 47 GGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGG 83 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G G A G GGG G Sbjct: 49 GGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDG 85 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGGGG G G G GGG G G Sbjct: 309 GGGGDGGGGGGGGGGGGGDGGGDGDGDG 336 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGGGG G G GGG G G G Sbjct: 311 GGDGGGGGGGGGGGGGDGGGDGDGDGDG 338 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 84 GXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GGGGG G G GGGGG G G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGG 330 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 84 GXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GGG GG G G GGGGG G G Sbjct: 306 GDGGGGGDGGGGGGGGGGGGGDGGGDG 332 Score = 31.9 bits (69), Expect = 0.88 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 84 GXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GGGGGG G G G G G G G Sbjct: 314 GGGGGGGGGGGGGDGGGDGDGDGDGDG 340 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGGGG G G G G G G Sbjct: 315 GGGGGGGGGGGGDGGGDGDGDGDGDGDG 342 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 37.1 bits (82), Expect = 0.023 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GG GGG G G GGGG G G Sbjct: 204 GGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGG 240 Score = 33.5 bits (73), Expect = 0.29 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG G GGGG G GGG G G G Sbjct: 191 GGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGG 227 Score = 33.1 bits (72), Expect = 0.38 Identities = 20/44 (45%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -2 Query: 129 RXXXXGGRGPRXVXGGXFXGGG-GGGXGXXGXGGG-GGXXXGXG 4 R G G + GG GGG GGG G G GGG GG G G Sbjct: 189 RSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGG 232 Score = 32.3 bits (70), Expect = 0.66 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = -2 Query: 141 DAXPRXXXXGG--RGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 +A PR GG +G GG GG GG G GGG G G G Sbjct: 171 EAKPRGDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGG 218 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 G + GG GG G GG G G G GGG GG Sbjct: 187 GYRSGGGGYGGSKGGYGG-GSGGGGYGGGRGGGGYGG 222 Score = 31.1 bits (67), Expect = 1.5 Identities = 20/56 (35%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = -2 Query: 168 KXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGG-GGXXXGXG 4 K + P D+ GG G GG GGG G G GGG GG G G Sbjct: 168 KVNEAKPRGDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGG 223 Score = 30.3 bits (65), Expect = 2.7 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG GG G G G G G GGG GG G GG GG Sbjct: 181 GGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGG 240 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G G G G + GG GG Sbjct: 208 GGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGG 244 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGG-GGGGXGXXGXGGGGG 22 GGRG GG GG GGGG G G GG Sbjct: 213 GGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGG 244 Score = 29.1 bits (62), Expect = 6.2 Identities = 19/60 (31%), Positives = 21/60 (35%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 G GG+ GG GG G + G G G GG G GG G GG Sbjct: 176 GDSGGGGSQGGGYRSGGGG--YGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGG 233 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 PPPP P PPPPPP P + P P L Sbjct: 654 PPPPGGGMFPPPPPPPPGGGVPGPPKPPPPGNL 686 Score = 33.1 bits (72), Expect = 0.38 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPPP PPPPPP P PP Sbjct: 653 PPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P PPPPP PP P PP Sbjct: 645 PNPFFGGIPPPPPGGGMFPPPPP---PPPGGGVPGPP 678 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 37.1 bits (82), Expect = 0.023 Identities = 21/51 (41%), Positives = 22/51 (43%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG R GG G R GG + GGGG G G G GGGG G Sbjct: 733 GGGGYGGGYNDRRMQQGGYGNRS--GGGYRGGGGYGGGGGGYRGGGGYGGG 781 Score = 31.9 bits (69), Expect = 0.88 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGG--GGGXXXG 10 G G GG + GGGG G G G GG GGG G Sbjct: 761 GGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGG 796 Score = 31.5 bits (68), Expect = 1.2 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG GG GG G GG G G GG G R G GG G GG Sbjct: 770 GGYRGGGGYGGGHRGGGGYGGGGHR------GGSYSGYRGSYKSGGYGQGSGGYGQGSGG 823 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG G GG GGG GG G G GGG G Sbjct: 761 GGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRG 795 Score = 28.7 bits (61), Expect = 8.2 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGG--GGGGXGXXGXGGG 28 GG G GG + GG GGGG G G GG Sbjct: 766 GGGGGGYRGGGGYGGGHRGGGGYGGGGHRGG 796 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 37.1 bits (82), Expect = 0.023 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 28 PPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PPPPPP P PP E + P PP P Sbjct: 301 PPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 36.7 bits (81), Expect = 0.031 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP 73 P PPPPP P PPPPPP Sbjct: 306 PTDFAPPPPPPEPTSELPPPPPP 328 Score = 33.9 bits (74), Expect = 0.22 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPP P PPPPPP P + P PP Sbjct: 301 PPPPPPTDFAPPPPPP---EPTSELPPPPP 327 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 6/37 (16%) Frame = +1 Query: 22 PXPPPPPPXXXPPX------TPPXEXPTXXPXGPPXP 114 P PPPPPP P PP PT PP P Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPP 316 Score = 23.8 bits (49), Expect(2) = 9.5 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P P P PPP Sbjct: 301 PPPPPPTDFAPPPPP 315 Score = 23.0 bits (47), Expect(2) = 9.5 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +1 Query: 517 PPPPXPXPAAXPXPXSXP 570 PPPP P P + P P Sbjct: 311 PPPPPPEPTSELPPPPPP 328 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 36.7 bits (81), Expect = 0.031 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPPP P PPP PP P P PP Sbjct: 550 PSEEPPPPP-PGVDIPPPLPPSEDPKPPPPPPEPP 583 Score = 35.5 bits (78), Expect = 0.071 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PPP P P PPPP PP P P Sbjct: 556 PPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXE 78 PP PPP PP PP P E Sbjct: 575 PPPPPPEPPEECPPPPPGDE 594 Score = 29.1 bits (62), Expect = 6.2 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 6/37 (16%) Frame = +2 Query: 23 PPPPPXPXXPXP------PPPPPXNXPPXTXRGPRPP 115 PPPPP P P P PPP P P PP Sbjct: 555 PPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 24.2 bits (50), Expect(2) = 8.9 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 370 PXPXPPPXXPXPPP 411 P P PP P PPP Sbjct: 564 PPPLPPSEDPKPPP 577 Score = 22.6 bits (46), Expect(2) = 8.9 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXP 558 P PPPP P P P Sbjct: 573 PKPPPPPPEPPEECPPPP 590 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 36.3 bits (80), Expect = 0.041 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 2/59 (3%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGG--GGXXXGXG 4 G GG R GG G R GG GG GGG G GGG GG G G Sbjct: 140 GNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRG 198 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GGRG GG G GGG G G G GG G G Sbjct: 127 GGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWG 163 Score = 31.1 bits (67), Expect = 1.5 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGX---GGGGGXXXGXG 4 GGRG G GGGG G G G GGG G G G Sbjct: 163 GGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRGRG 202 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 129 RXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 R GGRG GG G GGG G G G G G Sbjct: 165 RGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRG 200 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 36.3 bits (80), Expect = 0.041 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXX-PXPPPPPPXNXPPXTXRGPRPP 115 P PP PP P P PP PP PP P PP Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPP 207 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 PP PP P P PP P PP P PP L Sbjct: 271 PPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNL 303 Score = 33.1 bits (72), Expect = 0.38 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T P P PP P P TPP P PP P Sbjct: 170 TKPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTP 206 Score = 33.1 bits (72), Expect = 0.38 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PP PP P P PP P PP + P P Sbjct: 188 PPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAP 224 Score = 32.3 bits (70), Expect = 0.66 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPP--PPXNXPPXTXRGPRPPXL 121 P P P PP P P PP P PP P T P P + Sbjct: 180 PAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHI 220 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P PP P P PP PP P P PP Sbjct: 212 PLPPGSPHIPPAPLHPHIPPAPP--NPSKAIATPNPP 246 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T P PP P P PP P PT P PP P Sbjct: 174 TKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPT-PPMP 209 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-XNXPPXTXRGPRPP 115 P PP PP P P PP P PP P PP Sbjct: 309 PPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPP 346 Score = 29.5 bits (63), Expect = 4.7 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P P PP P PP + PP Sbjct: 236 PSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPP 272 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P P PP P PP P PP P PP L Sbjct: 319 PNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPPNL 357 Score = 28.7 bits (61), Expect = 8.2 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +2 Query: 23 PPPP---PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PP P P P P PP PP P T P P Sbjct: 179 PPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETP 212 Score = 28.7 bits (61), Expect = 8.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 19 PPXPPPP-PPXXXPPXTPPXEXPTXXPXGPPXP 114 PP P P PP P PP P PP P Sbjct: 245 PPMPETPLPPATPNPFIPPASPNPSIPPAPPNP 277 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 36.3 bits (80), Expect = 0.041 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGG G G GGGGG G G Sbjct: 44 GGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHG 80 Score = 34.7 bits (76), Expect = 0.12 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGG-GXGXXGXGGGGGXXXGXG 4 GG G GG GGGG G G GGGGG G G Sbjct: 71 GGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGG 108 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G G GGGGG G GGGGG G G Sbjct: 38 GHGGATGGHGGATGGGGGATGGGATGGGGGATGGGG 73 Score = 32.7 bits (71), Expect = 0.50 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -1 Query: 730 GGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GGA GG G GG G GG GG G GG G GG Sbjct: 54 GGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGG 108 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G GG GGGG G G GGGG G G Sbjct: 58 GGGATGGGGGATGGGGGATGGHGGATGGGGGATGDG 93 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G G + GGV GG GG GG G Sbjct: 106 GGGGATGGHGGATGGGVGATGGHGGATGGHGGATG 140 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG G GG G G GGGG G G Sbjct: 120 GGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGG 156 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXG--XGGGGGXXXG 10 GG G G GGGGG G G GGGGG G Sbjct: 133 GGHGGATGGHGGATGGGGGATGGGGGATGGGGGATGG 169 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXG 638 GG A GG G G G G G A GGG G Sbjct: 53 GGGATGGGATGGGGGATGGGGGATGGHGGATGGGGG 88 Score = 31.1 bits (67), Expect = 1.5 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXG-GGGGXXXGXG 4 GG G GG GGGGG G G GG G G G Sbjct: 84 GGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGG 121 Score = 30.3 bits (65), Expect = 2.7 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = -1 Query: 730 GGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GGA GG GG G GG GG G GG G GG Sbjct: 47 GGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGG 101 Score = 30.3 bits (65), Expect = 2.7 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGX--GGGGGXXXGXG 4 GG G GG G GGG G G GGGGG G G Sbjct: 77 GGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHG 115 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGX--GGGGGXXXGXG 4 GG G G GG GG G G GGGGG G G Sbjct: 126 GGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGG 164 Score = 29.5 bits (63), Expect = 4.7 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = -1 Query: 730 GGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GGA GG GG G GG GG G GG G GG Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGG 94 Score = 29.5 bits (63), Expect = 4.7 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGE--AXGGGXG 638 GG A G G G G G G A G A GGG G Sbjct: 86 GGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVG 123 Score = 29.5 bits (63), Expect = 4.7 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGX--GGGGGXXXGXG 4 G G GG GGGGG G G GGG G G G Sbjct: 91 GDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHG 129 Score = 29.5 bits (63), Expect = 4.7 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGG--GXGXXGXGGGGGXXXGXG 4 GG G GG GG GG G G GG GG G G Sbjct: 98 GGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHG 136 Score = 29.1 bits (62), Expect = 6.2 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 4/61 (6%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXG----GGGGXXXGX 7 G GG A G G G G GGG G G G GGGG G Sbjct: 47 GGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGG 106 Query: 6 G 4 G Sbjct: 107 G 107 Score = 29.1 bits (62), Expect = 6.2 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = -1 Query: 745 GGXAAGGAXG--GXXAGXGGXGXXGXAXXGEAXGGGXG 638 GG A GG G G G G G G A GGG G Sbjct: 65 GGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGG 102 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 36.3 bits (80), Expect = 0.041 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP P PPP PP PP + P P GP P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPA--PPGPDTP 124 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P P PPPP P P PP Sbjct: 95 PPPPATPPPPTMP----PTPPPPQTPAPPGPDTPAPP 127 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/52 (32%), Positives = 19/52 (36%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDP 160 P P PP PP P P PP P P G +P G + G P Sbjct: 101 PPPPTMPPTPPPPQTPAPPGPDTPAPPAPGGCGAKPHTRIVGGTKAPPGAWP 152 Score = 31.9 bits (69), Expect = 0.88 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +1 Query: 10 PXXPPXPPPP--PPXXXPPXTPPXEXP-TXXPXGP 105 P P PPPP PP PP TP P T P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 31.1 bits (67), Expect = 1.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP +P P P PP P Sbjct: 107 PPTPPPPQTPAPPGPDTPAPPAP 129 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P PPPP PPP P P T P P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 35.9 bits (79), Expect = 0.054 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPPP PPPPP P P PP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPP 694 Score = 33.5 bits (73), Expect = 0.29 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T PP PPPPPP PP P P P Sbjct: 655 TPEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPP 691 Score = 33.1 bits (72), Expect = 0.38 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP 73 P P PPPP P PPPPP Sbjct: 682 PLPGGAAPPPPPPIGGGAPPPPP 704 Score = 32.3 bits (70), Expect = 0.66 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 12/52 (23%) Frame = +2 Query: 23 PPPPPXP------XXPXPPPPP------PXNXPPXTXRGPRPPXLXXRGXAS 142 PPPPP P P PPPPP P PP P PP G A+ Sbjct: 661 PPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPGFGGFAN 712 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 PP PPPP P P PP P PP Sbjct: 676 PPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 29.9 bits (64), Expect = 3.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 28 PPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PPPPPP PP P PP P Sbjct: 676 PPPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 28.7 bits (61), Expect = 8.2 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +2 Query: 41 PXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P PPPPPP PP G PP AA PP + Sbjct: 656 PEAGPPPPPPP---PPGGQAGGAPPPPPPPLPGGAAPPPPPPI 695 Score = 25.0 bits (52), Expect(2) = 1.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 502 GPXXRPPPPXPXPAAXPXP 558 G PPPP P AA P P Sbjct: 674 GAPPPPPPPLPGGAAPPPP 692 Score = 24.2 bits (50), Expect(2) = 1.9 Identities = 11/22 (50%), Positives = 11/22 (50%), Gaps = 6/22 (27%) Frame = +1 Query: 364 GPPXPXPPP------XXPXPPP 411 GPP P PPP P PPP Sbjct: 659 GPPPPPPPPPGGQAGGAPPPPP 680 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 35.9 bits (79), Expect = 0.054 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P P P P P P N PP T PP Sbjct: 68 PIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPP 104 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P P P P P P + PP T PP Sbjct: 58 PIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPP 94 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXT-XRGPRPPXLXXRG 133 P P PP P P P P P P + PP T G PP +G Sbjct: 78 PIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIQG 121 Score = 33.1 bits (72), Expect = 0.38 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P P P P P P + PP T PP Sbjct: 48 PIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPP 84 Score = 32.7 bits (71), Expect = 0.50 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PP P P P P P P N PP T PP Sbjct: 40 PGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPP 74 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 35.5 bits (78), Expect = 0.071 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPR 109 P PPPPP PPPPPP + P R R Sbjct: 421 PGYIPPPPPGFPQFQPPPPPPPSDAPWIERPKR 453 Score = 33.1 bits (72), Expect = 0.38 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PPPP P PP P+ PP Sbjct: 320 PAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPP 352 Score = 32.3 bits (70), Expect = 0.66 Identities = 22/67 (32%), Positives = 26/67 (38%), Gaps = 14/67 (20%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP--XNXPP---XTXRGP---------RPPXLXXRGXAS 142 P P PPPP PPPP P + PP + GP RPP + G + Sbjct: 322 PPPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMSTPVQRPPGMRPPGAGN 381 Query: 143 AAGXDPP 163 G PP Sbjct: 382 GPGGPPP 388 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 35.5 bits (78), Expect = 0.071 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -1 Query: 730 GGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG G GG G G G+ GGG GG Sbjct: 73 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGG 104 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXG-XAXXGEAXGGGXGG 635 GG GG GG G GG G G G+ GGG GG Sbjct: 73 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGG 110 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GG G GG GGGGG G G GGGG Sbjct: 82 GGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 112 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -2 Query: 87 GGXFXGGGGG-GXGXXGXGGGGGXXXGXG 4 GG GGGGG G G G GGGG G G Sbjct: 84 GGDGDGGGGGDGDGGGGGDGGGGGDGGGG 112 Score = 32.7 bits (71), Expect = 0.50 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG GGGGG G G GGGG G Sbjct: 92 GGDGDGGGGGDGGGGGDGGGGNDDDG 117 Score = 32.3 bits (70), Expect = 0.66 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GG G GGGG G GGG G G G Sbjct: 73 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDG 109 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 35.5 bits (78), Expect = 0.071 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G + G A GG GG GG GGG G G GGG G G G Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGG 140 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXG 575 G + GG GG G G G G G GGG GG R GG G Sbjct: 95 GYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGSKGG 151 Score = 33.5 bits (73), Expect = 0.29 Identities = 22/57 (38%), Positives = 24/57 (42%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G + GG + R GGRG GG GGGG G G G GGG G G Sbjct: 95 GYRSGGGGYGGSS--RGGYGGGRGGGGYGGGR--GGGGYGGGRGGGYGGGRRDYGGG 147 Score = 29.1 bits (62), Expect = 6.2 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GGRG GG + GG GGG G GGG G Sbjct: 122 GGRG-----GGGYGGGRGGGYGGGRRDYGGGSKGG 151 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 35.5 bits (78), Expect = 0.071 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PP PP PP PP + P P PP P Sbjct: 182 PPIPPIDPPRTQPPPIPPIDPPRTQP--PPIP 211 Score = 33.1 bits (72), Expect = 0.38 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 PP PP PP PP PP + P P PP Sbjct: 195 PPIPPIDPPRTQPPPIPPIDPPRTQP--PP 222 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +2 Query: 11 PXXXPPP-PPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPP PP PPP P PP T P PP Sbjct: 177 PRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPP 212 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP P PP PP PP + P P PP P Sbjct: 169 PPIFPIDPPRTQPPPIPPIDPPRTQP--PPIP 198 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 10 PXXPPXPPPPP-PXXXPPXT-PPXEXPTXXPXGPPXP 114 P PP PPP P PP T PP P P P P Sbjct: 186 PIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPP 222 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 6/40 (15%) Frame = +2 Query: 5 PXPXXXPP---PPPXPXXPXP---PPPPPXNXPPXTXRGP 106 P P PP PPP P P PPP P PP T P Sbjct: 183 PIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPP 222 Score = 28.7 bits (61), Expect = 8.2 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Frame = +1 Query: 10 PXXPPXPPP---PPPXXXPPXTPP-XEXPTXXPXGPP 108 P PP PP PPP PP PP + P P PP Sbjct: 182 PPIPPIDPPRTQPPPI--PPIDPPRTQPPPIPPIDPP 216 Score = 28.7 bits (61), Expect = 8.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P PP PP PP P P Sbjct: 194 PPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFPQPTTP 230 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 35.5 bits (78), Expect = 0.071 Identities = 22/57 (38%), Positives = 23/57 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPP P P PPPPP PP P PP L + G PP P Sbjct: 450 PLPSDEPPPLP-PDEEKPPPPPAPALPPL----PLPPEL-----PGSPGDSPPATSP 496 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PPP P PPPPP P P P + + PP Sbjct: 450 PLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPP 500 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 35.5 bits (78), Expect = 0.071 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -1 Query: 730 GGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG G GG G G G+ GGG GG Sbjct: 88 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGG 119 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXG-XAXXGEAXGGGXGG 635 GG GG GG G GG G G G+ GGG GG Sbjct: 88 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGG 125 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GG G GG GGGGG G G GGGG Sbjct: 97 GGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 127 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -2 Query: 87 GGXFXGGGGG-GXGXXGXGGGGGXXXGXG 4 GG GGGGG G G G GGGG G G Sbjct: 99 GGDGDGGGGGDGDGGGGGDGGGGGDGGGG 127 Score = 32.7 bits (71), Expect = 0.50 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG GGGGG G G GGGG G Sbjct: 107 GGDGDGGGGGDGGGGGDGGGGNDDDG 132 Score = 32.3 bits (70), Expect = 0.66 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GG G GGGG G GGG G G G Sbjct: 88 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDG 124 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 35.1 bits (77), Expect = 0.094 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P PP PP P P P PP P PP PRP Sbjct: 1358 PRPRPPTPPRPPTPRPRPPTPRPGPPT----PRP 1387 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T P P P PP P TP PT P GPP P Sbjct: 1350 TTSPIPSTPRPRPPTPPRPPTPRPRPPTPRP-GPPTP 1385 Score = 32.7 bits (71), Expect = 0.50 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXP 96 T P PP P P PP PP P T P Sbjct: 1573 TLPITPPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXG 102 PP PP PP P TP PT P G Sbjct: 1362 PPTPPRPPTPRPRPPTPRPGPPTPRPSG 1389 Score = 29.5 bits (63), Expect = 4.7 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +2 Query: 5 PXPXXXP-PPPPXPXXPXPPPPPPXNXP 85 P P P PP P P P P P PP P Sbjct: 1360 PRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 29.5 bits (63), Expect = 4.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 41 PXXPXPPPPPPXNXPPXTXRGPRP 112 P P PP P P PP PRP Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPPRP 1598 Score = 29.5 bits (63), Expect = 4.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 34 PPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PPPP PP TPP P P P P Sbjct: 1578 PPPPTPSPPQTPP---PVNTPPRPETP 1601 Score = 28.7 bits (61), Expect = 8.2 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 1/22 (4%) Frame = +2 Query: 26 PPPPXPXXPXPP-PPPPXNXPP 88 P P P P PP PPP N PP Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPP 1596 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 35.1 bits (77), Expect = 0.094 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 108 RGPRXVXGGXFXGGGGGGXGXXGXGGGG 25 R PR GG GGGGGG G G GG G Sbjct: 507 RRPRRRRGGGGGGGGGGGGGGGGRGGRG 534 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXGXG 4 GGGGGG G G GGGG G G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRG 536 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 108 RGPRXVXGGXFXGGGGGGXGXXGXGGG 28 R R GG GGGGGG G G G G Sbjct: 510 RRRRGGGGGGGGGGGGGGGGRGGRGRG 536 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 35.1 bits (77), Expect = 0.094 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -2 Query: 114 GGRG-PRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GGRG PR G GGGGG G G GGG G G Sbjct: 46 GGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGGRG 83 Score = 31.9 bits (69), Expect = 0.88 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 742 GXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXR 629 G GG GG G G G G GGG GG R Sbjct: 41 GAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGR 78 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 G PR G GG GG G GGGGG Sbjct: 36 GFSPRGAGRGGGRGGPRGGGRGGGRGGGGG 65 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 35.1 bits (77), Expect = 0.094 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +2 Query: 26 PPPPXPXXPXPP-PPPPXNXPPXTXRGPRP 112 PPPP P P PP P N PP GP P Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLPAGPPP 540 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 3/29 (10%) Frame = +1 Query: 31 PPPPPXXXPPXTPPXE---XPTXXPXGPP 108 PPPPP PP P E P P GPP Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLPAGPP 539 Score = 30.3 bits (65), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PPPP PPP P PP Sbjct: 513 PPPPASPPPPLPAEEDNSPPPLPAGPPP 540 >SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.1 bits (77), Expect = 0.094 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = -2 Query: 78 FXGGGGGGXGXXGXGGGGGXXXGXG 4 + GGGG G G G GGGGG G G Sbjct: 3 YDGGGGDGDGGDGDGGGGGDGGGDG 27 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GGR + G F GGGG G GGGGG G Sbjct: 458 GGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGG 492 Score = 33.9 bits (74), Expect = 0.22 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXG-GGGGGXGXXGXGGGGGXXXGXG 4 GGS + GG G R G GGGGG G GGGGG G Sbjct: 439 GGSRGTGGEGGKSFLAGGAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGG 492 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGG--GGGXG--XXGXGGGGG 22 GG GP GG GGG GG G GGGGG Sbjct: 472 GGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGG 506 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P PP P P PPP PP P PP Sbjct: 752 PLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPP 788 Score = 31.9 bits (69), Expect = 0.88 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PP PP P PP P P P P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPP 779 Score = 29.1 bits (62), Expect = 6.2 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P P PP P P PP P PP P L SA PP Sbjct: 762 PAPPQFAPVPP-PCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPPPP 813 Score = 29.1 bits (62), Expect = 6.2 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P P PP P P P PP + P PP Sbjct: 781 PCSAPLPPAPAPFSAAPHLPPAPNISAEPPPPP 813 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 34.3 bits (75), Expect = 0.16 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXT 94 P PPP P P PP PPP P T Sbjct: 461 PIPPPPPMSPPPPTPPPPATSPVT 484 Score = 29.5 bits (63), Expect = 4.7 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 2/20 (10%) Frame = +1 Query: 19 PPXPP--PPPPXXXPPXTPP 72 PP PP PPPP PP T P Sbjct: 463 PPPPPMSPPPPTPPPPATSP 482 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G VG G GG G GGGG G G Sbjct: 44 GNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGG 78 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G GG G GGGG G G GGG G G Sbjct: 54 GAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAG 89 Score = 32.3 bits (70), Expect = 0.66 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGG-GXGXXGXGGGGGXXXGXG 4 G G V GG GGG G G G G G GGG G G Sbjct: 33 GVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNG 69 Score = 32.3 bits (70), Expect = 0.66 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGG---GGGGXGXXGXGGGGGXXXGXG 4 GG G GG GG GG G G G GGGGG G Sbjct: 47 GGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGG 86 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG GG GGGGGG G G G G G Sbjct: 62 GGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAG 96 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG + G GG GGG GG GG G Sbjct: 78 GGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGG 112 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 95 GXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G VG GGV GG GGG G G G Sbjct: 29 GVGVGVGGGGVGGGGGNGGGAGNGVGAGG 57 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G G G GG G G GG GG G G Sbjct: 40 GGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNG 76 Score = 30.3 bits (65), Expect = 2.7 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGX-GXXGXAXXGEAXG---GGXGG 635 GG AG GG AG GG G G G G GG GG Sbjct: 69 GGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGG 109 Score = 29.5 bits (63), Expect = 4.7 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGG 25 GG G GG GGG GG G G GG Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGG 57 Score = 29.1 bits (62), Expect = 6.2 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 8/68 (11%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXG--------GXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXG 590 GG GG G AG G G G G G A GG GG Sbjct: 36 GGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGA 95 Query: 589 GXXXGXGG 566 G G GG Sbjct: 96 GGNVGGGG 103 Score = 28.7 bits (61), Expect = 8.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG G G G G G GG GG Sbjct: 35 GGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGG 71 Score = 28.7 bits (61), Expect = 8.2 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG G G G G GG GG G Sbjct: 76 GGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGG 112 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 34.3 bits (75), Expect = 0.16 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG P V G GGGGGG G GGGG G G Sbjct: 346 GGPSPGAVGG---FGGGGGGSEDNGASGGGGGYSGGG 379 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -2 Query: 108 RGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 R PR GG GGGGGG G GG GG Sbjct: 996 RRPRRRRGGGGGGGGGGGGGGGRRGGRGG 1024 Score = 33.1 bits (72), Expect = 0.38 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = -2 Query: 156 SXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 S P + + P G V GGGGG G G GGGGG G G Sbjct: 974 STPGSPSIPTPSEPSSSGSSIVRRPRRRRGGGGG-GGGGGGGGGGRRGGRG 1023 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP P PPP PP T P P PP Sbjct: 429 PSHPPPLPQPPPSIIPPPTTPLPQTVPTPPRPP 461 Score = 31.1 bits (67), Expect = 1.5 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTX-RGPRPPXLXXRGXASAAGXDPPXLXP 175 PPP P P PPP P T PRPP + A PP P Sbjct: 432 PPPLPQPPPSIIPPPTTPLPQTVPTPPRPPTTMTTILTTIATSGPPGGAP 481 Score = 24.2 bits (50), Expect(2) = 4.1 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P +PPP P P P + P P Sbjct: 434 PLPQPPPSIIPPPTTPLPQTVPTPP 458 Score = 23.8 bits (49), Expect(2) = 4.1 Identities = 11/22 (50%), Positives = 11/22 (50%), Gaps = 3/22 (13%) Frame = +1 Query: 355 AXXGPPX---PXPPPXXPXPPP 411 A GPP P PP P PPP Sbjct: 419 AKGGPPGGGVPSHPPPLPQPPP 440 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 34.3 bits (75), Expect = 0.16 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG P V G GGGGGG G GGGG G G Sbjct: 216 GGPAPGAVGG---FGGGGGGSEDNGASGGGGGYSGGG 249 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 33.9 bits (74), Expect = 0.22 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPP--XNXPPXTXRGPRPP 115 PPPPP P P P PP + PP P PP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPP 809 Score = 28.7 bits (61), Expect = 8.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PP P P P P P PP P Sbjct: 779 PPPPPTKPATPRVPPNIPSRPPGARPTPPPPP 810 >SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 33.9 bits (74), Expect = 0.22 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXN 79 PPPPP PPPPPP N Sbjct: 93 PPPPPQLENDFPPPPPPMN 111 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 33.9 bits (74), Expect = 0.22 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGG 22 GGGGGG G G GGGGG Sbjct: 320 GGGGGGGGGGGGGGGGG 336 Score = 33.9 bits (74), Expect = 0.22 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGG 22 GGGGGG G G GGGGG Sbjct: 321 GGGGGGGGGGGGGGGGG 337 Score = 33.9 bits (74), Expect = 0.22 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGG 22 GGGGGG G G GGGGG Sbjct: 322 GGGGGGGGGGGGGGGGG 338 Score = 33.9 bits (74), Expect = 0.22 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGG 22 GGGGGG G G GGGGG Sbjct: 323 GGGGGGGGGGGGGGGGG 339 Score = 32.7 bits (71), Expect = 0.50 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 69 GGGGGXGXXGXGGGGGXXXG 10 GGGGG G G GGGGG G Sbjct: 320 GGGGGGGGGGGGGGGGGGGG 339 Score = 29.9 bits (64), Expect = 3.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 63 GGGXGXXGXGGGGGXXXGXG 4 GGG G G GGGGG G G Sbjct: 320 GGGGGGGGGGGGGGGGGGGG 339 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GGR R GG GGGGG G G GGG G Sbjct: 94 GGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGG 128 Score = 33.1 bits (72), Expect = 0.38 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G R GG GGGGG G G GGGG G G Sbjct: 92 GGGGRRERGGR--GGGGGYGGGGGYGGGGRSYGGGG 125 Score = 32.7 bits (71), Expect = 0.50 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG GG G G GGG GG Sbjct: 106 GGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 30.7 bits (66), Expect = 2.0 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXG----XXGXGGGGG 22 G G GG GGGGGG G G GGGGG Sbjct: 109 GGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 33.5 bits (73), Expect = 0.29 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXPA 707 PP PPP A+ A P P PP PA Sbjct: 8 PPPPPPIAAEFTAPPAPPPPPNPA 31 Score = 31.9 bits (69), Expect = 0.88 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PPPPPP PP P P P P Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPPNP-APDVP 35 Score = 30.3 bits (65), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PPP P PPPP N P Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPPNPAP 32 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXP-XXPXPPPPPPXNXPPXTXRG 103 P PPPPP P P PPPP PP G Sbjct: 190 PWTSVPPPPPPGPGGIPPPPPPIRGGVPPPPPMG 223 Score = 28.7 bits (61), Expect = 8.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 28 PPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PPPPPP P PP P PP P Sbjct: 195 PPPPPP--GPGGIPPPPPPIRGGVPPPPP 221 Score = 24.6 bits (51), Expect(2) = 6.6 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +1 Query: 502 GPXXRPPPPXPXPAAXPXP 558 GP PPPP P P P Sbjct: 201 GPGGIPPPPPPIRGGVPPP 219 Score = 22.6 bits (46), Expect(2) = 6.6 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P P P PPP Sbjct: 195 PPPPPPGPGGIPPPP 209 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 33.5 bits (73), Expect = 0.29 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Frame = +2 Query: 23 PPPPPX---PXXPXPPPP-PPXNXPPXTXRGPRPP 115 PPPPP P P PPP P PP T P PP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPP 156 Score = 33.1 bits (72), Expect = 0.38 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXP-PXTXRGPRPPXLXXRG 133 P P PPPP P P PPP + P P PP G Sbjct: 124 PPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTG 167 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PPP PP P P P PP P Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTP-APPVP 155 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GG GGG G G GGG G G G Sbjct: 200 GGSSRGGYGGGRGGGGYGGGRGGGGGYG 227 Score = 33.1 bits (72), Expect = 0.38 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG G G + GG GGG G GGGGG G Sbjct: 195 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGG 229 Score = 33.1 bits (72), Expect = 0.38 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXR 629 GG G + GG G GG G G G GGG GG R Sbjct: 196 GGGYGGSSRGGYGGGRGGGGYGG----GRGGGGGYGGGR 230 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GG GG GGG G G GGG G G Sbjct: 200 GGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGG 236 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGG 644 GG GG GG G GG G G + GGG Sbjct: 208 GGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGGG 241 Score = 29.5 bits (63), Expect = 4.7 Identities = 19/39 (48%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGG-GGXGXXGXGGG-GGXXXGXG 4 GG G + GG GGGG GG G GGG GG G G Sbjct: 183 GGGGSQG--GGYRSGGGGYGGSSRGGYGGGRGGGGYGGG 219 Score = 29.1 bits (62), Expect = 6.2 Identities = 20/55 (36%), Positives = 22/55 (40%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 G + GG + R GGRG GG GGGGG G GGG G Sbjct: 191 GYRSGGGGYGGSS--RGGYGGGRGGGGYGGGR--GGGGGYGGGRRDYGGGSKGGG 241 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 33.5 bits (73), Expect = 0.29 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPP 88 PP PP P P PPPP PP Sbjct: 298 PPAPPLPNFTSPSPPPPPPLPP 319 Score = 31.9 bits (69), Expect = 0.88 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXPXXXXAXXXXXXXXXXXXLGPXP 180 PP PPP PP PP T P PP P A L P P Sbjct: 285 PPMTPPPAVVTAPPPAPPLPNFT-SPSPPPPPPLPPAMPAMDDLLPPEVLSPPP 337 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 33.5 bits (73), Expect = 0.29 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTP 69 P PP PPPPPP P TP Sbjct: 375 PFAPPPPPPPPPPPAPGSTP 394 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXP 85 P PPPPP P PPPP P + P Sbjct: 372 PCAPFAPPPPP----PPPPPPAPGSTP 394 Score = 30.3 bits (65), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P P P P PPPPPP P Sbjct: 363 PTPAPLSSTPCAPFAPPPPPPPPPPPAP 390 Score = 25.4 bits (53), Expect(2) = 3.2 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +1 Query: 520 PPPXPXPAAXPXPXSXPL 573 PPP P P P P S P+ Sbjct: 378 PPPPPPPPPPPAPGSTPV 395 Score = 23.0 bits (47), Expect(2) = 3.2 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 P P PP P PPP Sbjct: 372 PCAPFAPPPPPPPPP 386 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 33.1 bits (72), Expect = 0.38 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPP P PP PP PP + P PP Sbjct: 1253 PPPPPGMRPMPPQPPFMPPPPRMQPPGPP 1281 Score = 32.7 bits (71), Expect = 0.50 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-XNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PP P PPPPP PP P PP + G G P Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGP 1289 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P PP PP PP P P P GPP P Sbjct: 1257 PGMRPMPPQPPFMPPPPRMQPPGPP--GPPGPPGP 1289 Score = 29.1 bits (62), Expect = 6.2 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +2 Query: 5 PXPXXXPPPP-PXPXXPXPPPPPPXNXP 85 P P PPPP P P PP PP P Sbjct: 1264 PQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 33.1 bits (72), Expect = 0.38 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PPPP P PPP P N PP PRP Sbjct: 210 PLPPTAAPPPP-PTTGAPPPTPVTNKPPP----PRP 240 Score = 31.9 bits (69), Expect = 0.88 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P PPPPP PP T +PP Sbjct: 206 PRSGPLPPTAAPPPPPTTGAPPPTPVTNKPP 236 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASA 145 P PPPPP P P P PP PP G A Sbjct: 213 PTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAPGSCKA 257 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP--XNXPPXT 94 P P PPP P PPPP P PP T Sbjct: 218 PPPPTTGAPPPTPVTNKPPPPRPATTQAPPPT 249 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 33.1 bits (72), Expect = 0.38 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 G A A PR G R GG G GGGG G G GGG G G Sbjct: 178 GKMVEAKKATPRDRNSPADGGRGGYGGR--GRGGGGRGGYGGGGGYGGYGG 226 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 33.1 bits (72), Expect = 0.38 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGG 25 GG G GG GGGGGG G G GGGG Sbjct: 27 GGHGGGHGYGGGPNGGGGGGGG--GGGGGG 54 Score = 31.9 bits (69), Expect = 0.88 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 107 GGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 GG G G GG GG GGGGGG GG Sbjct: 26 GGGHGGGHGYG-GGPNGGGGGGGGGGGGGG 54 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 G GG G G GG G GGGGGG GG Sbjct: 25 GGGGHGG---GHGYGGGPNGGGGGGGGGGGGG 53 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGG 22 GG GGG G G G GGGGG Sbjct: 31 GGHGYGGGPNGGGGGGGGGGGG 52 Score = 30.7 bits (66), Expect = 2.0 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 129 RXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 R G G GG GGGGGG G GGGGG G Sbjct: 23 RDGGGGHGGGHGYGGGPNGGGGGGG----GGGGGGGDEDDSG 60 Score = 29.9 bits (64), Expect = 3.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 68 GVXGGXXXGGGGGGXGGXXG 9 G GG GGGGGG GG G Sbjct: 34 GYGGGPNGGGGGGGGGGGGG 53 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 33.1 bits (72), Expect = 0.38 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPP 73 PPP P P PPPPPP Sbjct: 162 PPPQPPPPPLPPPPPP 177 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 23 PPPPPXPXXPXPPPP 67 PP PP P P PPPP Sbjct: 163 PPQPPPPPLPPPPPP 177 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 163 PPQPPPPPLPPPPPP 177 Score = 29.5 bits (63), Expect = 4.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPP 70 P PPPPP P PPPPP Sbjct: 162 PPPQPPPPPLP----PPPPP 177 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 32.3 bits (70), Expect = 0.66 Identities = 13/21 (61%), Positives = 13/21 (61%), Gaps = 4/21 (19%) Frame = +2 Query: 23 PPPPPXPXXPX----PPPPPP 73 PPPPP P P PPPPPP Sbjct: 755 PPPPPPPAVPGEGARPPPPPP 775 Score = 30.3 bits (65), Expect = 2.7 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXPA 707 PP PPP A P P PP PA Sbjct: 755 PPPPPPPAVPGEGARPPPPPPPPA 778 Score = 28.7 bits (61), Expect(2) = 0.39 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 56 PPPPPPXNXPPXTXRGPRPP 115 PPPPPP P R P PP Sbjct: 755 PPPPPPPAVPGEGARPPPPP 774 Score = 28.7 bits (61), Expect = 8.2 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 4/21 (19%) Frame = +2 Query: 23 PPPPPX----PXXPXPPPPPP 73 PPPPP P PPPPPP Sbjct: 757 PPPPPAVPGEGARPPPPPPPP 777 Score = 23.0 bits (47), Expect(2) = 0.39 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPP 73 P PP P P PPPP Sbjct: 708 PLSAPPLSSTLGPPPPAPPPP 728 >SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) Length = 519 Score = 32.7 bits (71), Expect = 0.50 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 6/63 (9%) Frame = +2 Query: 5 PXPXXXPPPPPX--PXXPXPPPPPPXNXPPXTXRGPRPPXL----XXRGXASAAGXDPPX 166 P P P PP P P P PPP P PRP R S G PP Sbjct: 36 PIPHGPRPLPPLREPPTPAPTPPPALPSTPTLPLAPRPRPTASQPTTRTQYSGGGAIPPP 95 Query: 167 LXP 175 L P Sbjct: 96 LIP 98 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 32.7 bits (71), Expect = 0.50 Identities = 18/58 (31%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGP---RPPXLXXRGXASAAGXDPPXLXP 175 P PP P PPPP + PP P PP G G PP + P Sbjct: 224 PPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPP 281 Score = 32.3 bits (70), Expect = 0.66 Identities = 22/65 (33%), Positives = 25/65 (38%), Gaps = 10/65 (15%) Frame = +2 Query: 5 PXPXXXPPP--PPX--------PXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGX 154 P P PPP PP P PPP PP PP + P PP S +G Sbjct: 253 PPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPP---PSSGVSNSGM 309 Query: 155 DPPXL 169 PP + Sbjct: 310 MPPHM 314 Score = 29.5 bits (63), Expect = 4.7 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PPPP P PPP PP G P + G G PP Sbjct: 236 PPMGAPPPPHSMPPPGMPPPGMMPPP----GFPPMGMPGMGGMPPPGMPPP 282 >SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) Length = 188 Score = 32.7 bits (71), Expect = 0.50 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXT 94 PPPP P PPP PP + P T Sbjct: 31 PPPPSPPPSPPPPSPPLDCPCLT 53 Score = 32.7 bits (71), Expect = 0.50 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXT 94 PPPP P PPP PP + P T Sbjct: 154 PPPPSPPPSPPPPSPPLDCPCLT 176 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXP--TXXPXG 102 PP P PPP PP +PP + P T P G Sbjct: 31 PPPPSPPP--SPPPPSPPLDCPCLTAYPTG 58 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXP--TXXPXG 102 PP P PPP PP +PP + P T P G Sbjct: 154 PPPPSPPP--SPPPPSPPLDCPCLTAYPTG 181 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 32.7 bits (71), Expect = 0.50 Identities = 17/34 (50%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -3 Query: 107 GGPXGXXVGXSXGG-VXGGXXXGGGGGGXGGXXG 9 GG G G S GG + GG GG GGG GG G Sbjct: 129 GGEGGMGGGMSMGGGMGGGMSMGGMGGGMGGMMG 162 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGG-GGGXGXXGXGGGGGXXXGXG 4 GG G + GG GGG GGG G GGG G G G Sbjct: 129 GGEG--GMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGG 164 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G G G + + GG+ GG G GGG GG G Sbjct: 162 GGGSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMGG 196 Score = 29.1 bits (62), Expect = 6.2 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 5/38 (13%) Frame = -3 Query: 107 GGPXGXXVGXSXGGVXGGXXXGGG-----GGGXGGXXG 9 GG +G GG+ GG GGG GGG GG G Sbjct: 146 GGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMG 183 Score = 29.1 bits (62), Expect = 6.2 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G + GG GGG G G G GGG G G Sbjct: 159 GMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMG 195 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 32.7 bits (71), Expect = 0.50 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PP P P P P P P PP PP G P + P Sbjct: 507 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPP 563 Score = 32.3 bits (70), Expect = 0.66 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PP P P P P P P PP PP G P + P Sbjct: 427 PHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 483 Score = 32.3 bits (70), Expect = 0.66 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PP P P P P P P PP PP G P + P Sbjct: 437 PHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 493 Score = 32.3 bits (70), Expect = 0.66 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PP P P P P P P PP PP G P + P Sbjct: 457 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPP 513 Score = 32.3 bits (70), Expect = 0.66 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PP P P P P P P PP PP G P + P Sbjct: 467 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPP 523 Score = 32.3 bits (70), Expect = 0.66 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PP P P P P P P PP PP G P + P Sbjct: 517 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPP 573 Score = 32.3 bits (70), Expect = 0.66 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PP P P P P P P PP PP G P + P Sbjct: 527 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPP 583 Score = 32.3 bits (70), Expect = 0.66 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PP P P P P P P PP PP +G P L P Sbjct: 567 PHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPP 623 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PP P P P P P P PP T PP Sbjct: 559 PRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPP 593 Score = 29.1 bits (62), Expect = 6.2 Identities = 16/57 (28%), Positives = 17/57 (29%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PP P P P P P PP PP G P + P Sbjct: 487 PHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 543 Score = 29.1 bits (62), Expect = 6.2 Identities = 16/57 (28%), Positives = 17/57 (29%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P PP P P P P P P PP PP G P + P Sbjct: 497 PHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 553 Score = 29.1 bits (62), Expect = 6.2 Identities = 16/57 (28%), Positives = 17/57 (29%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PP P P P P P PP PP G P + P Sbjct: 537 PHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPP 593 Score = 29.1 bits (62), Expect = 6.2 Identities = 16/57 (28%), Positives = 17/57 (29%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PP P P P P P PP PP G P + P Sbjct: 547 PHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPP 603 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P P P PPP PP PP L + A PP P Sbjct: 244 PHPPSVKPSVPIPPPTKPPPRVASRRPPPPLPPPDSSEAQAQQPPLSPP 292 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 32.7 bits (71), Expect = 0.50 Identities = 17/55 (30%), Positives = 19/55 (34%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 G GG+ + P GG G GGGGG G G GG G Sbjct: 270 GNAGGGAGEGSTGGPGGINAGGGGGDSTTDSDDGAGGGGGGGHFSGGAGGAAATG 324 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T PP PP PPP PP PP P PP P Sbjct: 1254 TVEELPPLPPLPPPDAQPPSLPP------QPPQPPQP 1284 Score = 32.7 bits (71), Expect = 0.50 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP A P P P PP P Sbjct: 1262 PPLPPPDAQPPSLPPQPPQPPQP 1284 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP--PPPPXNXPPXTXRGPRP 112 P PPPPP P P PPPP PP G P Sbjct: 75 PMMMPFPPPPPIYMPPPPVYMPPPPVYMPPPMPMGDVP 112 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP---PPPPPXNXPPXTXR 100 P P PPPP P P PPP P P T R Sbjct: 82 PPPPIYMPPPPVYMPPPPVYMPPPMPMGDVPATKR 116 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 22 PXPPPPPPXXXPPXTPP 72 P PPPPPP PP PP Sbjct: 142 PPPPPPPPSPPPPCHPP 158 Score = 31.5 bits (68), Expect = 1.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTP 69 P PP PP PPP PP P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 Score = 29.1 bits (62), Expect = 6.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXR 100 PPP P P PPPP P T R Sbjct: 142 PPPPPPPPSPPPPCHPPALPSTYR 165 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 32.3 bits (70), Expect = 0.66 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 107 GGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 GG G G S GG G GGGGG GG Sbjct: 181 GGDGGDDGGGSGGGGDDGGSDGGGGGNDGG 210 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 G G GG GG GGG G GGGG G Sbjct: 176 GGGDDGGDGGDDGGGSGGGGDDGGSDGGGGGNDG 209 Score = 29.5 bits (63), Expect = 4.7 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXG 638 G +GG G G G G G G + GGG G Sbjct: 171 GSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGG 206 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 32.3 bits (70), Expect = 0.66 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP P P PP P P P GPP P Sbjct: 1662 PPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGP 1696 Score = 31.9 bits (69), Expect = 0.88 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 22 PXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PPPPPP P P P GP P Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGPDGP 1690 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRG-PRPPXL 121 P P PPP P P P P P P +G P PP L Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGL 1699 Score = 28.7 bits (61), Expect = 8.2 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P P P PP P P GP+ P Sbjct: 1655 PVFHYPAPPPPPPPAPGPPGPDG--PMGLPGPQGP 1687 Score = 24.2 bits (50), Expect(2) = 4.9 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 367 PPXPXPPPXXPXPP 408 P P PPP P PP Sbjct: 1660 PAPPPPPPPAPGPP 1673 Score = 23.4 bits (48), Expect(2) = 4.9 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +1 Query: 517 PPPPXPXPAAXPXPXSXP 570 PPPP P P P P Sbjct: 1665 PPPPAPGPPGPDGPMGLP 1682 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 32.3 bits (70), Expect = 0.66 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP 73 P P PPP P PPPPPP Sbjct: 209 PPPMGGPPPMGGPPGGYPPPPPP 231 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPP 73 P PPPPP P P PPP Sbjct: 222 PGGYPPPPPPPGAGDPAYPPP 242 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 32.3 bits (70), Expect = 0.66 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG GG G G GGG GG Sbjct: 447 GGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGG 483 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 G G + GG G GGG G G G GGG Sbjct: 454 GDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 30.3 bits (65), Expect = 2.7 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGG-GGGXXXGXG 4 GG D G R GG GGGG G G GG GGG G G Sbjct: 421 GGGRDDGDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDG 474 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGG G G G G GGG G G Sbjct: 451 GGGGDGGGDGIDGGDGGGDGGGDGGGDG 478 Score = 29.5 bits (63), Expect = 4.7 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG G G G GGG G G G GGG G Sbjct: 450 GGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 32.3 bits (70), Expect = 0.66 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXT 94 P P PP P P P PPP PP T Sbjct: 28 PKPDTPPPGTNIPTPPSPNTPPPVTQPPVT 57 Score = 32.3 bits (70), Expect = 0.66 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXT 94 P P P PP P P P PP PP T Sbjct: 33 PPPGTNIPTPPSPNTPPPVTQPPVTQPPVT 62 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P PP P P P PPP P PP + PP P Sbjct: 20 PKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQP 69 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 6/41 (14%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXP----PPPPPXNXPPXTXRGP--RPP 115 P P PP P P P P PP N PP + P +PP Sbjct: 20 PKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPP 60 Score = 29.9 bits (64), Expect = 3.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXT 94 P P P P P P PP P PP T Sbjct: 23 PQPTPPKPDTPPPGTNIPTPPSPNTPPPVT 52 Score = 29.1 bits (62), Expect = 6.2 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPP---PPXNXPPXTXRGPRPP 115 P P PPP P PP PP PP T P PP Sbjct: 40 PTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQ--PPPP 77 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 32.3 bits (70), Expect = 0.66 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXAS 142 P PP P P P P PP PP P P + +G S Sbjct: 524 PQPPSPPAPPPKPAPPPRSPPAA--APCNPAMAPQGCNS 560 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +1 Query: 19 PPXPPPPPP-XXXPPXTPPXEXPTXXPXGP 105 PP PP PPP PP +PP P P Sbjct: 526 PPSPPAPPPKPAPPPRSPPAAAPCNPAMAP 555 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGP 105 P PP PPPPPP + P P P Sbjct: 454 PQGPPPPPPPPPQMYQQPLMMPQAPMMMPQAP 485 Score = 29.1 bits (62), Expect = 6.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPR 414 PP P PP P PPPR Sbjct: 526 PPSPPAPPPKPAPPPR 541 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 35 PXPXXPXPPPPPPXNXPP 88 P P P PP PPP PP Sbjct: 522 PAPQPPSPPAPPPKPAPP 539 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPP 64 P PPPPP P P PPP Sbjct: 355 PQLGPPPPPPPPPPTPPP 372 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P P P PPPPPP PP Sbjct: 345 PPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXE 78 T P P PPPP PP TPP + Sbjct: 349 TTPKTHPQLGPPPPPPPPPPTPPPD 373 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXE 78 T P PPPPP PP PP E Sbjct: 350 TPKTHPQLGPPPPPPPPPPTPPPDE 374 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 T P P P P P P PP P P PP Sbjct: 338 TTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 28.7 bits (61), Expect = 8.2 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 364 GPPXPXPPPXXPXPPP 411 GPP P PPP P PPP Sbjct: 358 GPPPPPPPP-PPTPPP 372 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 32.3 bits (70), Expect = 0.66 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -1 Query: 742 GXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXR 629 G GG+ GG G G G ++ GGG GG R Sbjct: 427 GGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGGGSR 464 Score = 29.5 bits (63), Expect = 4.7 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 4/33 (12%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXG----GGGGG 27 G GG G G S GG GG G GGGGG Sbjct: 429 GFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGG 461 >SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) Length = 1440 Score = 32.3 bits (70), Expect = 0.66 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXR 100 P PPP P PPPP N PP R Sbjct: 1145 PNPPPDMQLPDPPPPITINVPPMYDR 1170 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 32.3 bits (70), Expect = 0.66 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 5/39 (12%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPP-----PPPXNXPPXTXRGPRP 112 P PP P P P PP PPP PP GP P Sbjct: 401 PGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGP 439 Score = 29.1 bits (62), Expect = 6.2 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 35 PXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P P PP + PP RGP P RG PP Sbjct: 401 PGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGPGMPP 443 >SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 31.9 bits (69), Expect = 0.88 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 129 RXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 R GGRG R GG G GG G G GG G G Sbjct: 337 RGGGRGGRGGRPGRGGRGGRGASGGRGRGGGRGGFGGGAG 376 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GGRG R GG GGG GG G G G Sbjct: 351 GGRGGRGASGGRGRGGGRGGFGGGAGPQGEG 381 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GGR R GG GG G G G GGG G G Sbjct: 345 GGRPGRGGRGGRGASGGRGRGGGRGGFGGGAGPQGEG 381 Score = 29.9 bits (64), Expect = 3.5 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXG-GXFXGGGGGGXGXXGXG 34 G GG P GGRG G G GG GGG G G G Sbjct: 334 GDSRGGGRGGRGGRPGRGGRGGRGASGGRGRGGGRGGFGGGAGPQGEG 381 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -1 Query: 742 GXAAGGAXGGXXA--GXGGXGXXGXAXXGEAXGGGXGG 635 G + GG GG G GG G G A G GGG GG Sbjct: 334 GDSRGGGRGGRGGRPGRGGRGGRG-ASGGRGRGGGRGG 370 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 31.9 bits (69), Expect = 0.88 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GGS A GG G G G G G G GG GG G Sbjct: 417 GGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTG 467 Score = 31.5 bits (68), Expect = 1.2 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 4/52 (7%) Frame = -2 Query: 147 AADAXPRXXXXGGRGPRXVXGGXFXGGGGG----GXGXXGXGGGGGXXXGXG 4 A+ A G G + GG GGG G G G G GG GG G G Sbjct: 413 ASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGG 464 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -1 Query: 736 AAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 A GG+ G G G G G A G A GGG GG Sbjct: 431 AGGGSAAGGGTGSGSTGN-GNAGNGGAGGGGAGG 463 >SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) Length = 619 Score = 31.9 bits (69), Expect = 0.88 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGP 105 P PP PPPPP P E P P P Sbjct: 77 PEAPPQLPPPPPFIVDDTESPQEQPPTTPVSP 108 >SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) Length = 506 Score = 31.9 bits (69), Expect = 0.88 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXR-GPRPPXLXXRGXASA 145 P PPPP P P PP PP T G +P G A Sbjct: 221 PDAPTPPPPVKTTAAPTPSPPQTPPPPTGSCGSKPSGTRIVGGTEA 266 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 31.9 bits (69), Expect = 0.88 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PPPPP P PPP + P Sbjct: 197 PPPSGAPPPPPIGAPPPPPPDDDVSMTP 224 Score = 30.7 bits (66), Expect = 2.0 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXP 96 P PPPPP PP PP + + P Sbjct: 199 PSGAPPPPPIGAPPPPPPDDDVSMTP 224 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 31.9 bits (69), Expect = 0.88 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXP---XXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPPP P PPPPPP P PP Sbjct: 44 PRDRERPPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPP 83 >SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 775 Score = 31.9 bits (69), Expect = 0.88 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGP 105 P PP PPPPP P E P P P Sbjct: 736 PEAPPQLPPPPPFIVDDTESPQEQPPTTPVSP 767 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 31.9 bits (69), Expect = 0.88 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PP P P P PPP PP GP P Sbjct: 2164 PSPLGAPPSVPPPMGAPPSGPPPMGAPP---SGPPP 2196 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PP P P P PPP PP Sbjct: 2174 PPPMGAPPSGPPPMGAPPSGPPPMGTPP 2201 Score = 29.5 bits (63), Expect = 4.7 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 5/41 (12%) Frame = +2 Query: 5 PXPXXXPP--PPPXPXXPXPPPP---PPXNXPPXTXRGPRP 112 P P PP PPP P PP PP PP P P Sbjct: 2184 PPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPPSGSHSPAP 2224 >SB_43407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 31.9 bits (69), Expect = 0.88 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXP 85 PPPPP P PPPP + P Sbjct: 237 PPPPPYTSLPPDDPPPPYDEP 257 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 31.9 bits (69), Expect = 0.88 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPP 70 PPPPP P P PPPPP Sbjct: 211 PPPPPPP--PPPPPPP 224 Score = 31.9 bits (69), Expect = 0.88 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPP 73 PPPP P P PPPPPP Sbjct: 211 PPPPPP--PPPPPPPP 224 Score = 30.7 bits (66), Expect = 2.0 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 19 PPXPPPPPPXXXPP 60 PP PPPPPP PP Sbjct: 211 PPPPPPPPPPPPPP 224 >SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2462 Score = 25.4 bits (53), Expect(2) = 1.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 10 PXXPPXPPPPP 42 P PP PPPPP Sbjct: 2318 PSVPPPPPPPP 2328 Score = 24.6 bits (51), Expect(2) = 1.0 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +1 Query: 28 PPPPPPXXXPPXTPPXEXPTXXPXG 102 PPPPPP P E P G Sbjct: 2322 PPPPPPPEQPGDAMDIEDEEGQPSG 2346 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -1 Query: 742 GXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 G ++GGA GG GG + G A GG GG Sbjct: 806 GGSSGGASGGAGGSSGGASGGAGSSSGGASGGADGG 841 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -1 Query: 733 AGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 AGG+ GG G GG G + GG GG Sbjct: 805 AGGSSGGASGGAGGSSGGASGGAGSSSGGASGG 837 Score = 30.3 bits (65), Expect = 2.7 Identities = 20/63 (31%), Positives = 24/63 (38%), Gaps = 2/63 (3%) Frame = -1 Query: 742 GXAAGGAXGGXXAGXGG-XGXXGXAXXGEAXG-GGXGGXRXXXXXXXXXXGXGGXXXGXG 569 G ++GGA GG GG G G + G + G GG G GG G Sbjct: 773 GSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSG 832 Query: 568 GXS 560 G S Sbjct: 833 GAS 835 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP-----PPPPXNXPPXTXRGPRPP 115 P P PPP P PP PPP PP G RPP Sbjct: 217 PPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPPGAGGMRPP 258 Score = 29.1 bits (62), Expect = 6.2 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = +1 Query: 10 PXXPPX--PPP---PPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PPP PPP PP P + P GP P Sbjct: 209 PNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPP 248 >SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) Length = 1230 Score = 31.5 bits (68), Expect = 1.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPP 88 PP P PPPPPP PP Sbjct: 445 PPVSPTTATPPPPPPSQPPP 464 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/30 (56%), Positives = 18/30 (60%) Frame = -2 Query: 93 VXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 V GG + GGGGGG G GGGGG G G Sbjct: 3696 VEGGGY-GGGGGGYG----GGGGGYGDGTG 3720 >SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) Length = 287 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -2 Query: 114 GGRGPRXVXGGXFXG--GGGGGXGXXGXG-GGGGXXXGXG 4 GG G R + G GGGG G G G GGGG G G Sbjct: 246 GGVGGRQFSSNSYGGFGGGGGACGCNGGGAGGGGGYSGGG 285 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXGXG 4 GGGGG G G GGG G G G Sbjct: 86 GGGGGDGGGGGDGGGDGDGDGDG 108 Score = 28.7 bits (61), Expect = 8.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXGXG 4 G GGGG G G GGG G G Sbjct: 84 GDGGGGGDGGGGGDGGGDGDGDG 106 >SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/51 (31%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRP-PXLXXRGXASAAGXDPPXLXP 175 PPPP P PPPP P P P P L P + P Sbjct: 137 PPPPAKEAPLPPPPAQQEAVPDIPTSPPPVPPLPTEPLQQTTTSAPSLISP 187 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPP P PPP PP PP P PP Sbjct: 174 PGILAPPPAPPGVLAPPPAPPGVLPPP----PAPP 204 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPP P P PP PP PP P PP Sbjct: 183 PPGVLAPPPAPPGVLPPPPAPPGALIPPP----PAPP 215 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 3/36 (8%) Frame = +1 Query: 10 PXXPPX---PPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PPP PP PP P P PP Sbjct: 180 PPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 28.7 bits (61), Expect = 8.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXN 79 P PP PP P PP PP N Sbjct: 194 PGVLPPPPAPPGALIPPPPAPPTFN 218 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 31.5 bits (68), Expect = 1.2 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG P P GG P GG GGG G G G G GG G G Sbjct: 337 GGDPGGGDPGG-GDPGGGDPGGGDP----GGGDHGGGDHGGGDHGDGDHGGGDHGGG 388 >SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) Length = 801 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 78 FXGGGGGGXGXXGXGGG 28 F GGGGGG G G GGG Sbjct: 344 FLGGGGGGGGSSGGGGG 360 Score = 29.1 bits (62), Expect = 6.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXGXG 4 G G G G G GGGGG G G Sbjct: 336 GDGSGDRGFLGGGGGGGGSSGGG 358 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGP 106 P P P P PPPP PP GP Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTPGP 254 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTP 69 P PP PPPP PP TP Sbjct: 233 PTAPPNTPPPPVTPPPPNTP 252 Score = 29.1 bits (62), Expect = 6.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PP P P P PPPP PP Sbjct: 230 PKPPTAPPNTPPP--PVTPPPPNTPGPP 255 Score = 28.7 bits (61), Expect = 8.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P P P PP PP TPP P P GPP Sbjct: 227 PASPKPPTAPPNTPPPPVTPP---PPNTP-GPP 255 >SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) Length = 483 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P P P P P P PP PP N T R PP + Sbjct: 167 PAPHSSPSPTPPPPPIIPPCPPVINLLIPTARPCMPPPI 205 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 31.1 bits (67), Expect = 1.5 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 129 RXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 R GGRG GG GGGG G G GG G G Sbjct: 192 RGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGG 231 Score = 29.1 bits (62), Expect = 6.2 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GGRG R G GG G G G GGGG G G Sbjct: 187 GGRGGR----GGRGGGRGAPRGRGGPRGGGGGSGGYG 219 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PP P P PP PP N P P+P Sbjct: 228 PTKAPTDPPVP--PTNPPVPPTNPPAPPTNPPKP 259 Score = 30.3 bits (65), Expect = 2.7 Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +2 Query: 11 PXXXPPPP----PXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXR-GXASAAG 151 P P PP P P PP PP N P P PP + G A+G Sbjct: 215 PTQAPRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPPKPGTCKASG 266 Score = 29.5 bits (63), Expect = 4.7 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T P P PP PP P PP P P PP P Sbjct: 226 TPPTKAPTDPPVPPTNPP--VPPTNPPAP-PTNPPKP 259 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 31.1 bits (67), Expect = 1.5 Identities = 24/69 (34%), Positives = 25/69 (36%), Gaps = 7/69 (10%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXG-------XXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGG 587 GG AGG GG G G G G A G GGG GG + GG Sbjct: 109 GGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQ--AGGSTSGSSSGG 166 Query: 586 XXXGXGGXS 560 G GG S Sbjct: 167 ATSGGGGVS 175 Score = 29.5 bits (63), Expect = 4.7 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -1 Query: 745 GGXAAGGAX-GGXXAG-XGGXGXXGXAXXGEAXGGGXGG 635 GG A GG GG G GG G G +A GG GG Sbjct: 104 GGTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGG 142 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRG 133 P PPP P P P PP PP GP PP +G Sbjct: 2623 PMLPLPPPGLPMQPEAPVQPPPLPPPG---GPFPPVAADQG 2660 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 30.7 bits (66), Expect = 2.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPP 70 P P PPPP P P P PP Sbjct: 304 PPPPQTPPPPQTPAPPQTPAPP 325 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPP 88 PPPP P P P PP PP Sbjct: 304 PPPPQTPPPPQTPAPPQTPAPP 325 Score = 28.7 bits (61), Expect = 8.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 32 PPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P PPPP PP T P PP Sbjct: 301 PQTPPPPQTPPPPQTPAPPQT---PAPP 325 Score = 23.4 bits (48), Expect(2) = 8.6 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 364 GPPXPXPPPXXPXPP 408 G P PPP P PP Sbjct: 299 GTPQTPPPPQTPPPP 313 Score = 23.4 bits (48), Expect(2) = 8.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXS 564 P PPP P P P P S Sbjct: 307 PQTPPPPQTPAPPQTPAPPS 326 >SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 30.7 bits (66), Expect = 2.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPP 88 PP P P P PPP PP P Sbjct: 139 PPQPSPPQPPQPPPQPPDQQGP 160 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXP 84 PP P PP P PP P + P Sbjct: 139 PPQPSPPQPPQPPPQPPDQQGP 160 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 30.7 bits (66), Expect = 2.0 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 23 PPPPPXPXXPXPPP 64 PPPPP P P PPP Sbjct: 1455 PPPPPPPAPPCPPP 1468 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPP P P PPP P P+ P Sbjct: 942 PTPPPSPPPKEPTPPPSSKPSPVKEIKPKKP 972 Score = 29.1 bits (62), Expect = 6.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPP 64 P PPP P P P PPP Sbjct: 940 PTPTPPPSPPPKEPTPPP 957 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 32 PPXPXXPXPPPPPPXNXP 85 P P P PPPPPP P Sbjct: 1915 PTPPREPTPPPPPPTPLP 1932 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPP P P P PP PRPP Sbjct: 138 PPPPTPPQSTPKPRRVLPTPPPKPPTPRPP 167 >SB_24257| Best HMM Match : DUF583 (HMM E-Value=0.16) Length = 3999 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 G G P G G GG G GGG GG GG Sbjct: 2934 GLGNPGG--TGPGAGGTLGSRGTGGGYGGKGG 2963 >SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 30.7 bits (66), Expect = 2.0 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -2 Query: 159 GSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 G A + R G RG GGG GG G G GGG G Sbjct: 391 GRETAREYLARAVREGLRGEEGSPSVFLGGGGRGGGGGDGGGGGEG 436 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG GGG GG G G G GGG G Sbjct: 160 GGRDRGGGYGGGGEGGYGMGGGDYSG 185 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 G RG R GG + GGG GG G G GG G Sbjct: 157 GYRGGRD-RGGGYGGGGEGGYGMGGGDYSGGCGYG 190 Score = 29.1 bits (62), Expect = 6.2 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 7/42 (16%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGG-------GGGGXGXXGXGGGGGXXXG 10 GG G + GG + GG GGGG G G GGG G Sbjct: 171 GGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGYG 212 >SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 30.7 bits (66), Expect = 2.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPP 88 PP P P P PPP PP P Sbjct: 157 PPQPSPPQPPQPPPQPPDQQGP 178 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXP 84 PP P PP P PP P + P Sbjct: 157 PPQPSPPQPPQPPPQPPDQQGP 178 >SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) Length = 246 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP 73 P PPP P PPPPPP Sbjct: 152 PSSSLLPPPSSSPPLSSPPPPPP 174 Score = 23.8 bits (49), Expect(2) = 9.8 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 517 PPPPXPXPAAXPXPXSXPL 573 PPP P + P P S PL Sbjct: 172 PPPSTPSSSLLPPPSSSPL 190 Score = 23.0 bits (47), Expect(2) = 9.8 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP PP P PPP Sbjct: 159 PPSSSPPLSSPPPPP 173 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 30.3 bits (65), Expect = 2.7 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +1 Query: 4 TXPXXPPXPP--PPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T P PP P PP P PP T P PT P PP P Sbjct: 175 TQPFYPPTQPFYPPTPSSYPP-TQPSYPPTA-PSYPPTP 211 Score = 29.5 bits (63), Expect = 4.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T P PP P PP P TP PT P P Sbjct: 526 TQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPPTAP 562 >SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) Length = 924 Score = 30.3 bits (65), Expect = 2.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P P PPPP P R P P Sbjct: 282 PSPQPTEAKPHTPPPPTSTPPTTAPRQPSP 311 >SB_35820| Best HMM Match : TRAP_240kDa (HMM E-Value=0.006) Length = 1382 Score = 30.3 bits (65), Expect = 2.7 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGG 22 GGGG G G G GGGGG Sbjct: 772 GGGGMGLGMGGSGGGGG 788 >SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG P V G GG GGG G GGGG G G Sbjct: 265 GGPPPGAVGG---FGGWGGGSEDNGASGGGGGYSGGG 298 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 G GG G GG+ G GGGGGG GG Sbjct: 64 GAGGGAGGD-DDDGGGISGCGDGGGGGGGAGG 94 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRG 103 PPPPP P PPPPP P RG Sbjct: 794 PPPPP----PPPPPPPEDLIIPLPRRG 816 >SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1929 Score = 30.3 bits (65), Expect = 2.7 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P PPP P PP PPP R +P Sbjct: 1167 PQPPPVPSVQAPPAPPPAPPTMGLKRNQQP 1196 Score = 29.1 bits (62), Expect = 6.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPP 72 T PP PPP P PP PP Sbjct: 1161 TTQAKPPQPPPVPSVQAPPAPPP 1183 >SB_12281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 30.3 bits (65), Expect = 2.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXP 84 P PP PPPPPP P E P Sbjct: 248 PYLPPAPPPPPPGTNLLSNPRFESP 272 >SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1143 Score = 29.9 bits (64), Expect = 3.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPP 73 PPPP PPPPPP Sbjct: 740 PPPPATAAKAPPPPPP 755 >SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPP 73 P PP PP P P PPPP Sbjct: 29 PPEAPPLPPFAPLPPPVPPPP 49 >SB_35308| Best HMM Match : VWA (HMM E-Value=1.1e-20) Length = 381 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG GG GG G G GGGG G Sbjct: 291 GGISASGGAGGSGGAGGVGGGGGGTG 316 >SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1128 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +2 Query: 32 PPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 PP P PPPP PP T PP +AA PP P Sbjct: 104 PPPPATTSAPPPPTTTAPPAT---TSPPTTTDSPPTTAAETLPPTDAP 148 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 6/42 (14%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP------PPPPPXNXPPXTXRGPRP 112 P PPPPP P PPPP P T R P P Sbjct: 526 PVRPTGPPPPPVPKPQFDDTPTRAPPPPDMQTNPDTERRPPP 567 >SB_21275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPP 72 PP PPPPPP P T P Sbjct: 187 PPPPPPPPPRFVPFTTGP 204 >SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPP 88 P PP P P PPPPPP PP Sbjct: 122 PSGPRAPPGGPGAP-PPPPPPAVVPP 146 Score = 23.4 bits (48), Expect(3) = 4.1 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +1 Query: 355 AXXGPPXPXPPPXXPXPPP 411 A GPP P P P PP Sbjct: 111 AVQGPPAPTSVPSGPRAPP 129 Score = 21.4 bits (43), Expect(3) = 4.1 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 502 GPXXRPPPPXP 534 GP PPPP P Sbjct: 131 GPGAPPPPPPP 141 Score = 21.4 bits (43), Expect(3) = 4.1 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 520 PPPXPXPAAXP 552 PPP P PA P Sbjct: 135 PPPPPPPAVVP 145 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 29.9 bits (64), Expect = 3.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPP 73 P PP P PPPPPP Sbjct: 171 PSPPPSGAPPPPPPPP 186 Score = 29.5 bits (63), Expect = 4.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPP 70 P PPP P PPPPP Sbjct: 171 PSPPPSGAPPPPPPPP 186 Score = 29.1 bits (62), Expect = 6.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPP 73 P P P P PPPPPP Sbjct: 169 PNPSPPPSGAPPPPPPP 185 >SB_984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 29.9 bits (64), Expect = 3.5 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 56 PPPPPPXNXPPXTXRGPRPP 115 PP PPP PP +GP P Sbjct: 162 PPQPPPYQQPPGVYQGPHQP 181 >SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 29.9 bits (64), Expect = 3.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPP 73 PP P P P PP PPP Sbjct: 74 PPQPTPPPPRPPTPPP 89 >SB_41600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 416 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 28 PPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP P P TPP PT P P P Sbjct: 340 PLPPIPRTRPAMTPPPISPTTGPPKSPAP 368 >SB_33342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1189 Score = 29.9 bits (64), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXT 94 P P PPP P PP PP N T Sbjct: 494 PTTTPTPPPTTTEPQRPPDPPRNVQART 521 >SB_21796| Best HMM Match : COLFI (HMM E-Value=0) Length = 1239 Score = 29.9 bits (64), Expect = 3.5 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Frame = +2 Query: 11 PXXXPP-PPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PP PPP P P P N +G RP RG +AG D P Sbjct: 89 PPIPPPTPPPQRRGPPGDPGPKGNKGQPGAQG-RPGAPGDRGERGSAGSDGP 139 >SB_16879| Best HMM Match : Stig1 (HMM E-Value=1) Length = 232 Score = 29.9 bits (64), Expect = 3.5 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 56 PPPPPPXNXPPXTXRGPRPP 115 PP PPP PP +GP P Sbjct: 162 PPQPPPYQQPPGVYQGPHQP 181 >SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 29.5 bits (63), Expect = 4.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 G GG G G GG+ GG GGG G Sbjct: 707 GAGGAGGAGAGGMPGGMPGGRPTPGGGDAESG 738 >SB_45113| Best HMM Match : CemA (HMM E-Value=6) Length = 363 Score = 29.5 bits (63), Expect = 4.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 69 GGGGGXGXXGXGGGGGXXXG 10 GGGG G G GGGGG G Sbjct: 154 GGGGRRGGRGRGGGGGGGEG 173 Score = 28.7 bits (61), Expect = 8.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 95 GXXVGXSXGGVXGGXXXGGGGGGXGG 18 G G GG GG GGGGGG G Sbjct: 148 GPMRGRGGGGRRGGRGRGGGGGGGEG 173 >SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1442 Score = 29.5 bits (63), Expect = 4.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 32 PPXPXXPXPPPPPPXNXP 85 P P P PPPPPP P Sbjct: 721 PSYPTLPPPPPPPPQTTP 738 Score = 28.7 bits (61), Expect = 8.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPP 72 P P PPPPPP PP T P Sbjct: 721 PSYPTLPPPPPP---PPQTTP 738 >SB_11987| Best HMM Match : OTU (HMM E-Value=1.1e-24) Length = 1142 Score = 29.5 bits (63), Expect = 4.7 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGP 106 P PPPP P PP P P P P Sbjct: 443 PVPQPPPPAADSIPTPPQPQPPATSPEVEEVP 474 >SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) Length = 370 Score = 29.5 bits (63), Expect = 4.7 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G G GGGGGG G G G G G G Sbjct: 248 GDGDGDGDGDGDGGGGGGGGDGDGDGDGDGDGDGDG 283 >SB_49263| Best HMM Match : Surp (HMM E-Value=1e-28) Length = 641 Score = 29.5 bits (63), Expect = 4.7 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 28 PPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PPPPPP P PP + P G P P Sbjct: 353 PPPPPP---PGEGPPEDTQVAVPLGVPYP 378 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 29.5 bits (63), Expect = 4.7 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPP-PPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P PPPPPP + PP Sbjct: 194 PEPTRPPPPLDDLDDLPPPPPPPPEDDSIHNHEDLPPP 231 >SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 7381 Score = 29.5 bits (63), Expect = 4.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXG 10 GGGGGG G G G G G G Sbjct: 3643 GGGGGGGGDDGDGDGDGDSDG 3663 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 29.5 bits (63), Expect = 4.7 Identities = 21/64 (32%), Positives = 23/64 (35%), Gaps = 9/64 (14%) Frame = +2 Query: 11 PXXXPPPP--PXPXXPXPPP------PPPXNXPPXTXRGPRPPXLXXRGXA-SAAGXDPP 163 P PPPP P P PPP PPP PP RP L +G + P Sbjct: 389 PVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPPPIGVPNRPSVLYPNNNPFQRSGYNGP 448 Query: 164 XLXP 175 P Sbjct: 449 GFMP 452 Score = 29.5 bits (63), Expect = 4.7 Identities = 18/52 (34%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Frame = -2 Query: 162 GGSXPAA-DAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG+ P + + GG G G G GGGG GGGGG G Sbjct: 2294 GGASPGDFETGGKSFLNGGEGGES-RAGPVGGFGGGGSSRIRPGGGGGYSGG 2344 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 29.5 bits (63), Expect = 4.7 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPP---PPXNXPPXTXRGPRP 112 P P PPP P P P PP P + PP G P Sbjct: 587 PQPGTYPPPHPSGGYPQPSPPHGGHPHHPPPTGYPGGYP 625 >SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4529 Score = 25.4 bits (53), Expect(2) = 5.8 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 10 PXXPPXPPPPP 42 P PP PPPPP Sbjct: 2121 PGPPPAPPPPP 2131 Score = 21.8 bits (44), Expect(2) = 5.8 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 22 PXPPPPPPXXXP 57 P P PPPP P Sbjct: 2123 PPPAPPPPPVQP 2134 >SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) Length = 491 Score = 29.1 bits (62), Expect = 6.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -3 Query: 95 GXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G G GG+ G GGGGGG G G Sbjct: 397 GGMAGMQFGGMQGFPSLGGGGGGAGMMAG 425 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 29.1 bits (62), Expect = 6.2 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 5/26 (19%) Frame = +2 Query: 11 PXXXPPPPPXPXX-----PXPPPPPP 73 P PPP P P P PPPPPP Sbjct: 682 PLTPPPPLPTPIASSEPLPLPPPPPP 707 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 29.1 bits (62), Expect = 6.2 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 102 PRXVXGGXFXGGGGGGXG-XXGXGGGGGXXXGXG 4 PR GG G GGG G G GG GG G G Sbjct: 364 PRTEGGGRGGGRGGGRGGFRGGRGGRGGGGRGAG 397 >SB_32583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 526 Score = 29.1 bits (62), Expect = 6.2 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 PP P P PPPP + P G P L A PP Sbjct: 2 PPVPHPLLRHHPPPPASSSSPTPCYGITPHPLHRHHLPPPATASPP 47 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 29.1 bits (62), Expect = 6.2 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = -2 Query: 111 GRGPRXVXGGX---FXGGGGGGXGXXGXGGGGGXXXG 10 GR PR GG + GGGGG G G GGG G Sbjct: 787 GRDPREGWGGNRDNYSRGGGGGYNR-GYGSGGGYGGG 822 >SB_51094| Best HMM Match : VWA (HMM E-Value=0) Length = 3544 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -3 Query: 107 GGPXGXXVGXSXGGVX-GGXXXGGGGGGXGG 18 GG G + + G+ GG GGGGGG GG Sbjct: 3202 GGGGGESLAMTVTGLEAGGYSAGGGGGGAGG 3232 >SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2749 Score = 29.1 bits (62), Expect = 6.2 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P PPP PP + P + P P PP P Sbjct: 357 PEPPQSPPPSPPESY--NSEPEDSPLVGPSKPPTP 389 >SB_44878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1338 Score = 29.1 bits (62), Expect = 6.2 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +1 Query: 10 PXXPPXPPPP---PPXXXPPXTPPXE 78 P PP P PP P PP TPP E Sbjct: 642 PTGPPPPKPPRTLPQGVPPPVTPPEE 667 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 29.1 bits (62), Expect = 6.2 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G+GP G G G G G G G GGG G G Sbjct: 2 GQGPGGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPG 37 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXP-PXTPPXEXPTXXPXGPPXP 114 P PP P PP P P T P + P PP P Sbjct: 857 PPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRP 892 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 29.1 bits (62), Expect = 6.2 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 5/40 (12%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPP-----PPXNXPPXTXRGPRPP 115 P PPP P P PP P N PP P PP Sbjct: 913 PTPSPPPRRRRKSPSPSPPRRRRRSPSNSPPPMRSSPLPP 952 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 29.1 bits (62), Expect = 6.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PP P P PP P PP R P P Sbjct: 259 PSPPRYPPSPLRYPPIPPRYPPSLIRYPTLP 289 Score = 29.1 bits (62), Expect = 6.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PP P P PP P PP R P+ P Sbjct: 289 PPRYPPSPPRYPPSPPRYPPSLHRYPQSP 317 Score = 28.7 bits (61), Expect = 8.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PP PP T P P P PP P Sbjct: 272 PPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSP 303 Score = 28.7 bits (61), Expect = 8.2 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP-PPPPXNXPPXTXRGP 106 P P PP PP P PP P PP R P Sbjct: 329 PLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYP 363 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 29.1 bits (62), Expect = 6.2 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPP P PP P P P P+PP Sbjct: 142 PTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPP 178 >SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) Length = 592 Score = 29.1 bits (62), Expect = 6.2 Identities = 20/61 (32%), Positives = 23/61 (37%), Gaps = 6/61 (9%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPP-PXNXPPXTXRGPRPPXLXXRGXASAAGXDPPX 166 P P PPP P P PPP P P +GP P L +G S G P Sbjct: 75 PVPNNMGPPPHVNQGPPPNSANQAPPPNPGPSPSFNSQGP-PQRLPLQGFPSGPGQAQPL 133 Query: 167 L 169 + Sbjct: 134 M 134 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 28.7 bits (61), Expect = 8.2 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GRG GG + G GGG G GGG G G G Sbjct: 273 GRGMGRGPGGGWGRGSGGGWGRM-QGGGMGRGPGGG 307 >SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1414 Score = 28.7 bits (61), Expect = 8.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +2 Query: 23 PPPPPXPXXPXPPPP-PPXNXPPXTXRGPRPP 115 P P P P PP PP N P RG PP Sbjct: 698 PQGPDYHRRPSPSPPGPPRNAPYGPPRGRSPP 729 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 28.7 bits (61), Expect = 8.2 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPP-PPXNXPPXTXRGPRPP 115 P P PP P P P PP PP R P PP Sbjct: 1330 PWELPLPPSGLPLPLPRLPLPPLRLPPPHSRLPLPP 1365 >SB_38491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 28.7 bits (61), Expect = 8.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXGXG 4 GGGGGG G G G G G G Sbjct: 13 GGGGGGGDGDGDGDGDGDGDGDG 35 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 28.7 bits (61), Expect = 8.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXN 79 P PPPP P P PPP P N Sbjct: 813 PHEDSPPPPPP--PPPPPEEPSN 833 >SB_9614| Best HMM Match : GBP (HMM E-Value=1e-31) Length = 708 Score = 28.7 bits (61), Expect = 8.2 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 G G +A P GG G G GG G G GG GG Sbjct: 595 GAAAGAEGLRREADPGTGRKGGHGGSQAEAGGMWGGARGYPGTGRKGGHGG 645 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 28.7 bits (61), Expect = 8.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG AGG G AG G G G GGG GG Sbjct: 292 GGITAGGTAEGGNAGGNGGNAGG---NGGMTGGGAGG 325 >SB_51494| Best HMM Match : Drf_FH1 (HMM E-Value=2.4) Length = 157 Score = 28.7 bits (61), Expect = 8.2 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PPPP P P P P + P PRP R A D P Sbjct: 83 PGASRAAPPPPVP-EPEPEPDLDLDLPVPPLETPRPKKTGKRQPMRKAKADRP 134 >SB_50230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.7 bits (61), Expect = 8.2 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PPPP P P P P + P PRP R A D P Sbjct: 43 PGASRAAPPPPVP-EPEPEPDLDLDLPVPPHETPRPKKTGKRQPMRKAKADRP 94 >SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 406 Score = 28.7 bits (61), Expect = 8.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXT 94 P P PP P P PP P P P T Sbjct: 247 PTPHTSIPPTPTPHTSIPPTPTPHTSIPPT 276 Score = 28.7 bits (61), Expect = 8.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXT 94 P P PP P P PP P P P T Sbjct: 257 PTPHTSIPPTPTPHTSIPPTPTPHTSIPPT 286 Score = 28.7 bits (61), Expect = 8.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXT 94 P P PP P P PP P P P T Sbjct: 267 PTPHTSIPPTPTPHTSIPPTPTPHTSIPPT 296 >SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) Length = 398 Score = 28.7 bits (61), Expect = 8.2 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = -2 Query: 84 GXFXGGGG-GGXGXXGXGGGGG 22 G F G G GG G G GGGGG Sbjct: 375 GAFGSGSGFGGGGSSGGGGGGG 396 >SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) Length = 872 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPP 73 PPPPP PP PPP Sbjct: 794 PPPPPRVMNGLPPSPPP 810 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.309 0.147 0.529 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,804,779 Number of Sequences: 59808 Number of extensions: 344312 Number of successful extensions: 13631 Number of sequences better than 10.0: 215 Number of HSP's better than 10.0 without gapping: 1100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6260 length of database: 16,821,457 effective HSP length: 83 effective length of database: 11,857,393 effective search space used: 3118494359 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (21.9 bits)
- SilkBase 1999-2023 -