BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A19 (1042 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 53 3e-07 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 51 1e-06 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 48 1e-05 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 47 2e-05 At1g61080.1 68414.m06877 proline-rich family protein 47 2e-05 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 46 4e-05 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 45 7e-05 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 45 7e-05 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 44 1e-04 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 44 2e-04 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 44 2e-04 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 43 3e-04 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 43 3e-04 At2g30560.1 68415.m03722 glycine-rich protein 43 4e-04 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 43 4e-04 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 42 5e-04 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 42 5e-04 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 42 9e-04 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 41 0.002 At2g05440.2 68415.m00575 glycine-rich protein 41 0.002 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 41 0.002 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 41 0.002 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 40 0.002 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 40 0.002 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 40 0.002 At4g30460.1 68417.m04325 glycine-rich protein 40 0.002 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 40 0.002 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 40 0.002 At1g75550.1 68414.m08780 glycine-rich protein 40 0.002 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 40 0.003 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 40 0.003 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 40 0.003 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 40 0.003 At5g38560.1 68418.m04662 protein kinase family protein contains ... 40 0.004 At4g18570.1 68417.m02749 proline-rich family protein common fami... 40 0.004 At4g01985.1 68417.m00265 expressed protein 40 0.004 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 40 0.004 At5g46730.1 68418.m05757 glycine-rich protein 39 0.005 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 39 0.005 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 39 0.005 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 39 0.005 At2g05440.1 68415.m00574 glycine-rich protein 39 0.005 At1g29380.1 68414.m03592 hypothetical protein 39 0.005 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 39 0.006 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 39 0.006 At3g50180.1 68416.m05486 hypothetical protein 39 0.006 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 39 0.006 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 39 0.006 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 38 0.008 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 38 0.008 At1g70990.1 68414.m08190 proline-rich family protein 38 0.008 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 38 0.008 At1g10620.1 68414.m01204 protein kinase family protein contains ... 38 0.008 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 38 0.011 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 38 0.011 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 38 0.011 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 38 0.011 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 38 0.011 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 38 0.011 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 38 0.011 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 38 0.011 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 29 0.014 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 38 0.014 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 38 0.014 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 38 0.014 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 38 0.014 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 38 0.014 At1g27710.1 68414.m03387 glycine-rich protein 38 0.014 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 38 0.014 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 37 0.019 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 37 0.019 At4g08230.1 68417.m01358 glycine-rich protein 37 0.019 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 37 0.019 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 37 0.019 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 37 0.019 At1g02710.1 68414.m00222 glycine-rich protein 37 0.019 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 37 0.025 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 37 0.025 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 37 0.025 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 36 0.033 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 36 0.033 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 36 0.033 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 36 0.033 At1g62240.1 68414.m07021 expressed protein 36 0.033 At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly id... 36 0.044 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 36 0.044 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 36 0.044 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 36 0.044 At3g18810.1 68416.m02389 protein kinase family protein contains ... 36 0.044 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 36 0.058 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 36 0.058 At4g21720.1 68417.m03145 expressed protein 36 0.058 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 36 0.058 At3g43583.1 68416.m04636 hypothetical protein 36 0.058 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 36 0.058 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 36 0.058 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 36 0.058 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 36 0.058 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 36 0.058 At1g26150.1 68414.m03192 protein kinase family protein similar t... 36 0.058 At1g23540.1 68414.m02960 protein kinase family protein contains ... 36 0.058 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 36 0.058 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 35 0.077 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 35 0.077 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 35 0.077 At1g74720.1 68414.m08658 C2 domain-containing protein contains I... 35 0.077 At1g53625.1 68414.m06096 expressed protein 35 0.077 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 35 0.077 At3g26400.1 68416.m03292 eukaryotic translation initiation facto... 35 0.10 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 35 0.10 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 35 0.10 At2g05510.1 68415.m00583 glycine-rich protein 35 0.10 At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical ... 35 0.10 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 35 0.10 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 35 0.10 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 35 0.10 At1g63550.1 68414.m07184 hypothetical protein low similarity to ... 35 0.10 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 35 0.10 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 34 0.13 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 34 0.13 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 34 0.13 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 34 0.18 At4g33660.1 68417.m04781 expressed protein 34 0.18 At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibri... 34 0.18 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 34 0.18 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 34 0.18 At3g55790.1 68416.m06199 expressed protein predicted protein, Ar... 34 0.18 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 34 0.18 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 34 0.18 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 34 0.18 At1g15830.1 68414.m01900 expressed protein 34 0.18 At1g04660.1 68414.m00463 glycine-rich protein 34 0.18 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 33 0.24 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 33 0.24 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 33 0.24 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 33 0.24 At2g04190.1 68415.m00404 meprin and TRAF homology domain-contain... 33 0.24 At1g15840.1 68414.m01901 expressed protein 33 0.24 At1g35830.1 68414.m04452 VQ motif-containing protein contains PF... 31 0.26 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 33 0.31 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 33 0.31 At5g07540.2 68418.m00864 glycine-rich protein (GRP16) oleosin; g... 33 0.31 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 33 0.31 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 33 0.31 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 33 0.31 At4g15460.1 68417.m02363 glycine-rich protein 33 0.31 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 33 0.31 At3g07540.1 68416.m00900 formin homology 2 domain-containing pro... 33 0.31 At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi do... 33 0.31 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 33 0.31 At1g26110.1 68414.m03186 expressed protein 33 0.31 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 33 0.31 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 33 0.31 At1g04800.1 68414.m00476 glycine-rich protein 33 0.31 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 33 0.41 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 33 0.41 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 33 0.41 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 33 0.41 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 33 0.41 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 33 0.41 At4g16240.1 68417.m02464 hypothetical protein 33 0.41 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 33 0.41 At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-conta... 33 0.41 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 33 0.41 At3g24550.1 68416.m03083 protein kinase family protein contains ... 33 0.41 At3g08640.1 68416.m01003 alphavirus core protein family contains... 33 0.41 At2g34670.1 68415.m04259 proline-rich family protein contains pr... 33 0.41 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 33 0.41 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 33 0.41 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 33 0.41 At1g65440.1 68414.m07424 glycine-rich protein 33 0.41 At1g21310.1 68414.m02662 proline-rich extensin-like family prote... 33 0.41 At1g11850.2 68414.m01364 expressed protein 33 0.41 At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein si... 32 0.54 At4g23140.2 68417.m03338 receptor-like protein kinase 5 (RLK5) i... 32 0.54 At4g23140.1 68417.m03337 receptor-like protein kinase 5 (RLK5) i... 32 0.54 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 32 0.54 At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1... 32 0.54 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 32 0.54 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 32 0.54 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 32 0.54 At1g55540.1 68414.m06356 proline-rich family protein contains pr... 32 0.54 At5g24316.1 68418.m02864 proline-rich family protein contains pr... 32 0.72 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 32 0.72 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 32 0.72 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 32 0.72 At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid t... 32 0.72 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 32 0.72 At3g51290.1 68416.m05614 proline-rich family protein 32 0.72 At3g11402.1 68416.m01388 DC1 domain-containing protein contains ... 32 0.72 At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) fa... 32 0.72 At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) fa... 32 0.72 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 32 0.72 At1g35617.1 68414.m04424 hypothetical protein 32 0.72 At1g27090.1 68414.m03302 glycine-rich protein 32 0.72 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 32 0.72 At5g66960.1 68418.m08442 prolyl oligopeptidase family protein si... 31 0.95 At5g56140.1 68418.m07003 KH domain-containing protein 31 0.95 At5g53060.1 68418.m06592 KH domain-containing protein 31 0.95 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 31 0.95 At5g22790.1 68418.m02664 expressed protein 31 0.95 At5g02600.2 68418.m00195 heavy-metal-associated domain-containin... 31 0.95 At5g02600.1 68418.m00196 heavy-metal-associated domain-containin... 31 0.95 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 31 0.95 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 31 0.95 At4g03390.1 68417.m00461 leucine-rich repeat transmembrane prote... 31 0.95 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 31 0.95 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 31 0.95 At2g28500.1 68415.m03463 LOB domain protein 11 / lateral organ b... 31 0.95 At2g18470.1 68415.m02151 protein kinase family protein contains ... 31 0.95 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 31 0.95 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 31 0.95 At1g17790.1 68414.m02202 DNA-binding bromodomain-containing prot... 31 0.95 At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family... 31 0.95 At3g50190.1 68416.m05488 expressed protein contains Pfam profile... 26 1.2 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 31 1.3 At5g58540.1 68418.m07330 protein kinase family protein contains ... 31 1.3 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 31 1.3 At5g25550.1 68418.m03040 leucine-rich repeat family protein / ex... 31 1.3 At5g12470.1 68418.m01465 expressed protein 31 1.3 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 31 1.3 At3g56990.1 68416.m06344 glycine-rich protein conserved hypothet... 31 1.3 At3g56140.1 68416.m06240 expressed protein At2g40400 - Arabidops... 31 1.3 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 31 1.3 At3g24650.1 68416.m03095 abscisic acid-insensitive protein 3 (AB... 31 1.3 At3g16350.1 68416.m02068 myb family transcription factor ; conta... 31 1.3 At3g08630.1 68416.m01002 expressed protein 31 1.3 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 31 1.3 At2g28670.1 68415.m03485 disease resistance-responsive family pr... 31 1.3 At2g11005.1 68415.m01177 glycine-rich protein 31 1.3 At1g19960.1 68414.m02501 expressed protein 31 1.3 At1g12810.1 68414.m01488 proline-rich family protein contains pr... 31 1.3 At2g46300.1 68415.m05759 expressed protein 25 1.3 At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family... 27 1.6 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 31 1.7 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 31 1.7 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 31 1.7 At4g32340.1 68417.m04603 expressed protein 31 1.7 At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi... 31 1.7 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 31 1.7 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 31 1.7 At3g55950.1 68416.m06217 protein kinase family protein contains ... 31 1.7 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 31 1.7 At3g49300.1 68416.m05388 proline-rich family protein contains pr... 31 1.7 At3g46740.1 68416.m05074 chloroplast outer envelope protein, put... 31 1.7 At3g45540.1 68416.m04918 zinc finger (C3HC4-type RING finger) fa... 31 1.7 At3g24540.1 68416.m03082 protein kinase family protein contains ... 31 1.7 At3g07195.1 68416.m00858 proline-rich family protein 31 1.7 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 31 1.7 At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family... 31 1.7 At2g43800.1 68415.m05445 formin homology 2 domain-containing pro... 31 1.7 At2g30505.1 68415.m03716 Expressed protein 31 1.7 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 31 1.7 At1g77030.1 68414.m08970 glycine-rich protein 31 1.7 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 31 1.7 At1g12380.1 68414.m01431 expressed protein 31 1.7 At3g25500.1 68416.m03171 formin homology 2 domain-containing pro... 26 1.9 At5g35190.1 68418.m04170 proline-rich extensin-like family prote... 30 2.2 At5g17760.2 68418.m02083 AAA-type ATPase family protein contains... 30 2.2 At5g17760.1 68418.m02082 AAA-type ATPase family protein contains... 30 2.2 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 30 2.2 At4g34440.1 68417.m04894 protein kinase family protein contains ... 30 2.2 At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identic... 30 2.2 At3g62680.1 68416.m07041 proline-rich family protein contains pr... 30 2.2 At3g29390.1 68416.m03693 hydroxyproline-rich glycoprotein family... 30 2.2 At3g18360.1 68416.m02335 VQ motif-containing protein contains PF... 30 2.2 At1g32360.1 68414.m03989 zinc finger (CCCH-type) family protein ... 30 2.2 At1g11850.1 68414.m01363 expressed protein 30 2.2 At1g11130.1 68414.m01274 leucine-rich repeat family protein / pr... 30 2.2 At5g64430.1 68418.m08093 octicosapeptide/Phox/Bem1p (PB1) domain... 30 2.9 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 30 2.9 At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family prot... 30 2.9 At5g13910.1 68418.m01627 AP2/EREBP-like transcription factor LEA... 30 2.9 At4g15150.1 68417.m02326 glycine-rich protein 30 2.9 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 30 2.9 At4g08410.1 68417.m01390 proline-rich extensin-like family prote... 30 2.9 At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (... 30 2.9 At3g21215.1 68416.m02681 RNA-binding protein, putative contains ... 30 2.9 At3g04160.1 68416.m00440 expressed protein ; expression supporte... 30 2.9 At2g27660.1 68415.m03352 DC1 domain-containing protein contains ... 30 2.9 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 30 2.9 At2g05530.1 68415.m00585 glycine-rich protein 30 2.9 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 30 2.9 At1g54060.1 68414.m06160 expressed protein similar to 6b-interac... 30 2.9 At1g49270.1 68414.m05524 protein kinase family protein contains ... 30 2.9 At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family p... 30 2.9 At1g18170.1 68414.m02258 immunophilin / FKBP-type peptidyl-proly... 30 2.9 At2g16440.1 68415.m01883 DNA replication licensing factor, putat... 25 3.3 At5g51300.2 68418.m06360 splicing factor-related contains simila... 29 3.8 At5g51300.1 68418.m06359 splicing factor-related contains simila... 29 3.8 At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear... 29 3.8 At5g28480.1 68418.m03462 hypothetical protein 29 3.8 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 29 3.8 At4g19920.1 68417.m02918 disease resistance protein (TIR class),... 29 3.8 At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid t... 29 3.8 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 29 3.8 At3g43520.1 68416.m04614 expressed protein contains Pfam profile... 29 3.8 At2g39250.1 68415.m04820 AP2 domain-containing transcription fac... 29 3.8 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 29 3.8 At2g23770.1 68415.m02839 protein kinase family protein / peptido... 29 3.8 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 29 3.8 At2g12100.1 68415.m01300 Ulp1 protease family protein contains P... 29 3.8 At1g79480.1 68414.m09263 hypothetical protein low similarity to ... 29 3.8 At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family... 29 3.8 At1g70250.1 68414.m08082 receptor serine/threonine kinase, putat... 29 3.8 At1g53640.1 68414.m06100 hypothetical protein ; expression suppo... 29 3.8 At1g45090.1 68414.m05169 Ulp1 protease family protein similar to... 29 3.8 At5g07190.1 68418.m00819 embryo-specific protein 3, putative sim... 29 5.1 At5g06640.1 68418.m00750 proline-rich extensin-like family prote... 29 5.1 At4g39680.1 68417.m05614 SAP domain-containing protein contains ... 29 5.1 At4g36260.1 68417.m05157 zinc finger protein-related similar to ... 29 5.1 At4g35230.1 68417.m05007 protein kinase family protein contains ... 29 5.1 At4g08400.1 68417.m01388 proline-rich extensin-like family prote... 29 5.1 At3g51350.1 68416.m05622 aspartyl protease family protein contai... 29 5.1 At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s... 29 5.1 At1g47660.1 68414.m05295 hypothetical protein 29 5.1 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 29 5.1 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 29 5.1 At1g22420.1 68414.m02803 hydroxyproline-rich glycoprotein family... 29 5.1 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 29 5.1 At1g08520.1 68414.m00943 magnesium-chelatase subunit chlD, chlor... 29 5.1 At5g66400.1 68418.m08374 dehydrin (RAB18) nearly identical to SP... 29 6.7 At5g52440.1 68418.m06507 HCF106 protein identical to HCF106 [Ara... 29 6.7 At5g22560.1 68418.m02635 hypothetical protein contains Pfam prof... 29 6.7 At5g07650.1 68418.m00876 formin homology 2 domain-containing pro... 29 6.7 At5g06630.1 68418.m00749 proline-rich extensin-like family prote... 29 6.7 At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 29 6.7 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 29 6.7 At4g29240.1 68417.m04182 leucine-rich repeat family protein / ex... 29 6.7 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 29 6.7 At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family... 29 6.7 At3g32400.1 68416.m04142 formin homology 2 domain-containing pro... 29 6.7 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 29 6.7 At3g11390.1 68416.m01387 DC1 domain-containing protein contains ... 29 6.7 At3g06780.1 68416.m00805 glycine-rich protein 29 6.7 At3g01650.1 68416.m00096 copine-related low similarity to SP|Q99... 29 6.7 At2g33580.1 68415.m04115 protein kinase family protein / peptido... 29 6.7 At2g24980.1 68415.m02987 proline-rich extensin-like family prote... 29 6.7 At1g68390.1 68414.m07813 expressed protein contains Pfam profile... 29 6.7 At1g63600.1 68414.m07189 protein kinase-related low similarity t... 29 6.7 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 29 6.7 At1g07135.1 68414.m00759 glycine-rich protein 29 6.7 At1g02460.1 68414.m00195 glycoside hydrolase family 28 protein /... 29 6.7 At4g37180.2 68417.m05264 myb family transcription factor contain... 24 7.7 At4g37180.1 68417.m05263 myb family transcription factor contain... 24 7.7 At5g51680.1 68418.m06407 hydroxyproline-rich glycoprotein family... 25 7.8 At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) 28 8.9 At5g63120.2 68418.m07924 ethylene-responsive DEAD box RNA helica... 28 8.9 At5g63120.1 68418.m07925 ethylene-responsive DEAD box RNA helica... 28 8.9 At5g60050.1 68418.m07530 PRLI-interacting factor-related contain... 28 8.9 At5g07150.1 68418.m00815 leucine-rich repeat family protein cont... 28 8.9 At5g03160.1 68418.m00264 DNAJ heat shock N-terminal domain-conta... 28 8.9 At4g17940.1 68417.m02672 expressed protein 28 8.9 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 28 8.9 At3g46240.1 68416.m05005 protein kinase-related similar to light... 28 8.9 At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar... 28 8.9 At3g07100.1 68416.m00845 protein transport protein Sec24, putati... 28 8.9 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 28 8.9 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 28 8.9 At1g79350.1 68414.m09247 DNA-binding protein, putative contains ... 28 8.9 At1g70470.1 68414.m08108 expressed protein 28 8.9 At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi do... 28 8.9 At1g63470.1 68414.m07177 DNA-binding family protein contains a A... 28 8.9 At1g53040.2 68414.m06006 expressed protein contains Pfam profile... 28 8.9 At1g53040.1 68414.m06005 expressed protein contains Pfam profile... 28 8.9 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 28 8.9 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 28 8.9 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 28 8.9 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 28 8.9 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 28 8.9 At5g01370.1 68418.m00050 expressed protein 23 9.9 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 53.2 bits (122), Expect = 3e-07 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPPP P P PPPPPP PP P PP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 48.8 bits (111), Expect = 6e-06 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPPP P P PPPPPP P P PP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/38 (52%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXR-GPRPP 115 P P PPPPP P P PPPPPP PP P PP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPP 414 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/55 (40%), Positives = 23/55 (41%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P PPPPP P P PPPPPP PP P PP PP + P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPP----PPPPPYVYPSPPPPPPSPPPYVYP 426 Score = 47.2 bits (107), Expect = 2e-05 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PPPPPP PP PP P P PP P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/57 (36%), Positives = 24/57 (42%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPPPP P PPPPP + PP P PP + + PP P Sbjct: 395 PPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSP 451 Score = 45.6 bits (103), Expect = 5e-05 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PPPPPP PP PP P P PP P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 44.0 bits (99), Expect = 2e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P PPPPP P P PPPPPP PP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 35.9 bits (79), Expect = 0.044 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXPXPAA 546 PP P PPP P PPP P PPPP P P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSP-PYV 443 Query: 547 XPXPXSXP 570 P P P Sbjct: 444 YPPPPPSP 451 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXPXPAA 546 PP P PPP P PPP P PPPP P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPY--V 433 Query: 547 XPXPXSXP 570 P P S P Sbjct: 434 YPPPPSPP 441 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/71 (26%), Positives = 19/71 (26%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXPXPAA 546 PP P PPP P PPP P PP P P Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPP 449 Query: 547 XPXPXSXPLXP 579 P P P P Sbjct: 450 SPQPYMYPSPP 460 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +2 Query: 5 PXPXXXPP---PPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PP PPP P PPPP P P P+P Sbjct: 415 PPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQP 453 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXP-XXPXPPXP 704 PP P PP PP PPP P P P PP P Sbjct: 394 PPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSP 440 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = +1 Query: 10 PXXPPXPPP-----PPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PPP PPP P PP P P PP P Sbjct: 414 PPPPPSPPPYVYPPPPPPYVYP--PPPSPPYVYPPPPPSP 451 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPP 698 PP P PP PP PPP P P PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPP 698 PP P PP PP PPP P P P PP Sbjct: 376 PPSPPPPPPPPPPPPPPPPP--PPPPPPPPPPPPYVYPSPPPPP 417 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 3/50 (6%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXP---XPPXPA 707 PP P PP PP PPP P P P PP P+ Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPS 439 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P P PPPP + P P PP Sbjct: 428 PPPPYVYPPPPSP--PYVYPPPPPSPQPYMY--PSPP 460 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP P P P PP P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPP 398 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP P P P PP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPP 401 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP P P P PP P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPP 402 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP P P P PP P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPP 403 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP P P P PP P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPP 404 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP P P P PP P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPP 405 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP P P P PP P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPP 406 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP P P P PP P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPP 407 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +1 Query: 10 PXXPPX--PPPPPPXXXPPXTPPXEXPTXXPXGP 105 P PP PPPP P P PP P P P Sbjct: 427 PPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPP 460 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P P PP PPP P P PP P Sbjct: 403 PPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPP 448 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPPP P P P P P P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPP 400 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPPP P P P P P P Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPPP P P P P P P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPPP P P P P P P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPPP P P P P P P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPPP P P P P P P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPPP P P P P P P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PPPP P P PP N P Sbjct: 438 PSPPYVYPPPPPSPQPYMYPSPPCNDLP 465 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P P PPPPP P P PP PPP PP P PP L Sbjct: 56 PEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQL 94 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/54 (38%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPR-PPXLXXRGXASAAGXDPP 163 P P PPPP P P PP PPP PP P+ PP + S D P Sbjct: 65 PPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P P PPPP P PP P PP Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPP 90 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P P P P P PPPPPP PP + PP PP L P Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPP 102 Score = 31.5 bits (68), Expect = 0.95 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP P + P P PP P Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSP 85 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PP PPP P P PP P Sbjct: 64 PPPPPPCPPPPSPPPCPPPPS-PPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 27.1 bits (57), Expect(2) = 0.12 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P P P Sbjct: 62 PPPPPPPPCPPPPSP 76 Score = 27.1 bits (57), Expect(2) = 0.33 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PP P PPP Sbjct: 68 PPCPPPPSPPPCPPP 82 Score = 27.1 bits (57), Expect(2) = 0.25 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P P P Sbjct: 71 PPPPSPPPCPPPPSP 85 Score = 26.2 bits (55), Expect(2) = 1.6 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P P P P PPP Sbjct: 64 PPPPPPCPPPPSPPP 78 Score = 26.2 bits (55), Expect(2) = 0.43 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P P P Sbjct: 66 PPPPCPPPPSPPPCP 80 Score = 26.2 bits (55), Expect(2) = 0.72 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P P P P PPP Sbjct: 73 PPSPPPCPPPPSPPP 87 Score = 26.2 bits (55), Expect(2) = 0.12 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPPP P A P P P P Sbjct: 91 PPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 25.0 bits (52), Expect(2) = 0.43 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPP P P+ P P L P Sbjct: 72 PPPSPPPCPPPPSPPPSPPPPQLPP 96 Score = 25.0 bits (52), Expect(2) = 0.25 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPP P P P P P P Sbjct: 81 PPPSPPPSPPPPQLPPPPQLPPPAP 105 Score = 24.6 bits (51), Expect(2) = 0.33 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P P PP P P P P P P Sbjct: 74 PSPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 24.2 bits (50), Expect(2) = 0.72 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXP 570 P PPP P P P P P Sbjct: 80 PPPPSPPPSPPPPQLPPPPQLP 101 Score = 23.0 bits (47), Expect(2) = 1.6 Identities = 9/25 (36%), Positives = 10/25 (40%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPP P P + P P P Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLP 95 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/39 (51%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPX--PPPPPPXNXPPXTXRGPRPP 115 P P PPPPP P P PPPPPP PP P PP Sbjct: 432 PPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 470 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/60 (38%), Positives = 25/60 (41%), Gaps = 3/60 (5%) Frame = +2 Query: 5 PXPXXXPPPP---PXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPPP P P P PPPPP + PP P PP + S PP P Sbjct: 438 PPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSP 497 Score = 46.4 bits (105), Expect = 3e-05 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 4/61 (6%) Frame = +2 Query: 5 PXPXXXPPPP----PXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLX 172 P P PPPP P P P PPPPPP PP P PP + PP Sbjct: 452 PPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYS 511 Query: 173 P 175 P Sbjct: 512 P 512 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 3/60 (5%) Frame = +2 Query: 5 PXPXXXPPPPPX---PXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPPPP P PPPPPP PP P PP + PP P Sbjct: 468 PPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSP 527 Score = 42.7 bits (96), Expect = 4e-04 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP P PPPP PP PP P P PP P Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPP 457 Score = 42.7 bits (96), Expect = 4e-04 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPP P PPPPPP PP P PP Sbjct: 427 PPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPP 461 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPP P P PPPPP + PP P PP PP P Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSP 482 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXT-XRGPRPP 115 P P PPPP P PPPP P + PP T P PP Sbjct: 575 PPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPP 612 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PPPPPP PP P P P P P Sbjct: 497 PPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTP 531 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPP P P PPPP PP P PP Sbjct: 421 PTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPP 455 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPPP P PPPP P P R P PP Sbjct: 506 PPPVYSPPPPPVYSSP-PPPPSPAPTPVYCTRPPPPP 541 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP-----PPPPPXNXPPXTXRGPRPP 115 P P PPPP P P PPPPP + PP P PP Sbjct: 514 PPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPP 555 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP---PPPXNXPPXTXRGPRPP 115 P P PPPP P PP PPP + PP P PP Sbjct: 403 PPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPP 442 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P PP P P PPPP P P T P PP Sbjct: 394 PRPPVVTPLPP-PSLPSPPPPAPIFSTPPTLTSPPPP 429 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 5/62 (8%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPX-----PPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P PPPPP P PPPPPP + PP P P PP Sbjct: 515 PPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHS 574 Query: 170 XP 175 P Sbjct: 575 PP 576 Score = 37.5 bits (83), Expect = 0.014 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P PPPP + PP + P P Sbjct: 545 PPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSP 581 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPP-----PPXNXPPXTXRGPRPP 115 P P PPPPP P PPPP PP P P PP Sbjct: 603 PTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPP 644 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP---PPPXNXPPXTXRGPRPP 115 P P PPP P P PPP PPP PP P PP Sbjct: 595 PTPVSSPPPTPVYSPPPPPPCIEPPP--PPPCIEYSPPPP 632 Score = 35.1 bits (77), Expect = 0.077 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPPP P PP P PP P PP Sbjct: 587 PYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPP 621 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/58 (34%), Positives = 22/58 (37%), Gaps = 5/58 (8%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPP---PPXNXPPXTXRGPRP--PXLXXRGXASAAGXDPP 163 P P PPPP PPPP PP + PP P P P L + PP Sbjct: 546 PPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPP 603 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PPP P PPPPP PP Sbjct: 593 PPPTPVSSPPPTPVYSPPPPPPCIEPPP 620 Score = 33.9 bits (74), Expect = 0.18 Identities = 21/71 (29%), Positives = 21/71 (29%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXPXPAA 546 PP P PPP PPP P PPPP P P Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSP-----PPPPPPPPPPPPVY 480 Query: 547 XPXPXSXPLXP 579 P P S P P Sbjct: 481 SPPPPSPPPPP 491 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PP PPP P + P P PP P Sbjct: 431 PPPPVYSPPPPPPPPPPVYSP-PPPPPPPPPPPVYSPPPPPPPPPP 475 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP PP PP PPP P + P P PP P Sbjct: 461 PPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPP 506 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 570 PXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPP 698 P P PP PP PPP SP P P PP Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXA-XPXXPXPPXP 704 PP P PP PP PPP P P P PP P Sbjct: 444 PPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPP 490 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 570 PXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPP 698 P P PP PP PPP SP P P PP Sbjct: 451 PPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/71 (26%), Positives = 20/71 (28%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXPXPAA 546 PP P PPP PPP P PPP P PA Sbjct: 470 PPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAP 529 Query: 547 XPXPXSXPLXP 579 P + P P Sbjct: 530 TPVYCTRPPPP 540 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPP--XTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 PPPP P PPPP + PP P PP PP P Sbjct: 563 PPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPP 614 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/36 (38%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXN---XPPXTXRGPRPPXL 121 PPPP P PPP P + PP P PP + Sbjct: 693 PPPPSAPCEESPPPAPVVHHSPPPPMVHHSPPPPVI 728 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPP----PXNXPPXTXRGPRPP 115 PPPPP PPPPP PP P PP Sbjct: 630 PPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPP 664 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPP P P PPP P P PP + PP P Sbjct: 684 PSPVHYSSPPPPPSAPCEESPPP---APVVHHSPPPPMVHHSPPPPVIHQSPPPPSP 737 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/71 (25%), Positives = 19/71 (26%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXPXPAA 546 PP P PPP PP P PPPP P + Sbjct: 438 PPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSP 497 Query: 547 XPXPXSXPLXP 579 P P P P Sbjct: 498 PPPPPPPPPPP 508 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPP 698 PP P PP PP PPP SP P P PP Sbjct: 438 PPPPPPPPPPVYSPPPPP----PPPPPPPVYSPPPPPPPPPPPP 477 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P PPPP PP P PP Sbjct: 643 PPPVYYSSPPPPPVYYSSPPPP----PPVHYSSPPPP 675 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP---XTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP PPPP PP GP PP + G + A+ PP Sbjct: 706 PAPVVHHSPPPPMVHHSPPPPVIHQSPPPPSPEYEGPLPPVI---GVSYASPPPPP 758 Score = 30.7 bits (66), Expect = 1.7 Identities = 20/70 (28%), Positives = 22/70 (31%), Gaps = 2/70 (2%) Frame = +1 Query: 367 PPXPXPPP-XXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXP-XP 540 PP P PPP P PPP P PPPP P Sbjct: 501 PPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYY 560 Query: 541 AAXPXPXSXP 570 ++ P P S P Sbjct: 561 SSPPPPHSSP 570 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +3 Query: 570 PXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 P P PP PP P P +SP P PP P Sbjct: 570 PPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPP 614 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPP---XNXPPXTXRGPRPP 115 PPPP PPPPPP + PP PP Sbjct: 651 PPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPP 683 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP PP PP PPP P + P PP P Sbjct: 446 PPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPP 491 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PP PPP +P P PP P Sbjct: 498 PPPPPPPPPPPVYSPPPPPVYSSPP-PPPSPAPTPVYCTRPPPPPP 542 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P P PPPPP P PP P PP Sbjct: 602 PPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPP 634 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 570 PXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPP 698 P PP PP PPP SP P P PP Sbjct: 420 PPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPP 462 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPP 698 PP P PP PP PPP P P P PP Sbjct: 475 PPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSP--PPPP 516 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +1 Query: 10 PXXPPX--PPPPPPXXXPPXTPPXEXPTXXPXGP 105 P P PPPPPP PP PP + P P Sbjct: 601 PPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPP 634 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 P P PP PP PPP P + P P PP P Sbjct: 405 PSLPSPPPPAPIFSTPPTLTSPPPPSPPP---PVYSPPPPPPPPPP 447 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP PP PP PPP P P PP P Sbjct: 433 PPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPP 478 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/43 (30%), Positives = 15/43 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXP 695 PP P PP PP PP + P + P P P Sbjct: 451 PPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PPP +SP P P P P Sbjct: 538 PPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPP 583 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PP PP + P P P PP P Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPP---PPPPPPPPPP 508 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP P PPP TPP + P PP P Sbjct: 401 PLPPPSLPSPPPPAPIFSTPP-TLTSPPPPSPPPP 434 Score = 28.7 bits (61), Expect = 6.7 Identities = 19/71 (26%), Positives = 20/71 (28%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXPXPAA 546 PP P PP P PPP RPPPP P + Sbjct: 487 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPH--S 544 Query: 547 XPXPXSXPLXP 579 P P P P Sbjct: 545 PPPPQFSPPPP 555 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/54 (27%), Positives = 16/54 (29%) Frame = +3 Query: 3 HXPPPXXXPPPPXPXXXXXXXXXXXXXXXXPXGAPXPRXXXXGAXRXRRXPTPP 164 + PPP PPPP P P AP P P PP Sbjct: 495 YSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPP 548 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPPP P P PPPPP N T P PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 Score = 44.8 bits (101), Expect = 1e-04 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPP 88 P PPPPP P P PPPPPP PP Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P PPPPP P P PPPPPP G PP PP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPP 97 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 PP P P PPPPPP PP P PP + PP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PP P P PPPPPP PP P PP + PP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPP-----PPPPAVNMSVETGIPPPPPP 80 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXPXPAA 546 PP P PPP P PPP P PPPP P P + Sbjct: 42 PPPPPPPPPPPPPPP-PPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRS 100 Query: 547 XPXP 558 P P Sbjct: 101 QPPP 104 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 9/46 (19%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPX---------PPPPPPXNXPPXTXRGPRPP 115 P P PPPPP P P PPPPPP P PP Sbjct: 49 PPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPP 94 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPP-PPPXNXPPXTXRGPRPP 115 P PPPP P PPP PP N P PR P Sbjct: 87 PLSSPPPPQPPPRSQPPPKPPQKNLPRRHPPPPRSP 122 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +2 Query: 23 PPPPPXPXXPXP-PPPPPXNXPPXTXRGPRPP 115 PPPPP P PPP PP + P+PP Sbjct: 76 PPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPP 107 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXPA 707 PP PPP P P P PP PA Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPA 65 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 41 PXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPPPP PP P PP S PP P Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PPP P +PP P PP P Sbjct: 75 PPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKP 106 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPPP P P P P P P Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPP 63 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Frame = +2 Query: 5 PXPXXXPPP-PPXPXXPXPPPPPP 73 P P PPP PP P PPPP Sbjct: 96 PPPRSQPPPKPPQKNLPRRHPPPP 119 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/47 (44%), Positives = 24/47 (51%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 PPPPP P PPPPP PP R P PP + G + + G PP Sbjct: 550 PPPPPPPGTQAAPPPPPP--PPMQNRAPSPPPM-PMGNSGSGGPPPP 593 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/57 (42%), Positives = 25/57 (43%), Gaps = 4/57 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXP----XPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PPPPP P P PPPPPP PP P PP G A+A PP Sbjct: 502 PLKGSAPPPPPPPPLPTTIAAPPPPPP---PPRAAVAPPPPP-PPPGTAAAPPPPPP 554 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/57 (38%), Positives = 24/57 (42%), Gaps = 2/57 (3%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXP--XPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P PPPPP P PPPPPP PP T P PP A+ PP + Sbjct: 517 PTTIAAPPPPPPPPRAAVAPPPPPP---PPGTAAAPPPPPPPPGTQAAPPPPPPPPM 570 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = +2 Query: 23 PPPPPXPXX--PXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 PPPPP P PPPPPP GP PP AAG PP Sbjct: 592 PPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPPRMGMANGAAGPPPP 640 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +3 Query: 864 PPRPPXPPXXTXXXXXXXXXXALXPXXXXPPPPGXXARXXXPPXAAXTRAGXPPHXLP 1037 PP PP P A PPPPG A PP T+A PP P Sbjct: 511 PPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPP 568 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXPXXXXAXXXXXXXXXXXXLGPXPX 183 T PP PPPP PP PP P PP P A P P Sbjct: 519 TIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPP 578 Query: 184 KM 189 M Sbjct: 579 PM 580 Score = 36.3 bits (80), Expect = 0.033 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T PP PPPP PP PP P PP P Sbjct: 545 TAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMP 581 Score = 35.5 bits (78), Expect = 0.058 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 5/51 (9%) Frame = +2 Query: 26 PPPPXPXXPXP-----PPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 PPPP P P PPPPP P T P PP R + PP Sbjct: 492 PPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPP 542 Score = 35.5 bits (78), Expect = 0.058 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PPPPP P PP GPP P Sbjct: 562 PPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPP 593 Score = 35.1 bits (77), Expect = 0.077 Identities = 44/205 (21%), Positives = 47/205 (22%), Gaps = 17/205 (8%) Frame = +1 Query: 10 PXXPPXPPPPP---------PXXXPPXTPPXEXPTXXPXGPPXPXXXXAXXXXXXXXXXX 162 P PP PPPPP P PP TPP PP P Sbjct: 416 PPPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPP 475 Query: 163 XLGPXPXKMXXKKNCXKKKKXKXXXPDXAPXGXXXXXXXXXXXXXXXXXXXXXXXXXXXX 342 P P + K+ P P Sbjct: 476 PPPPLPPAVMPLKH--------FAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPP 527 Query: 343 XXXXAXXGPPXPXPPP-----XXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGP 507 A PP P PPP P PPP G Sbjct: 528 PPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGS 587 Query: 508 XXRPPPPXPXP---AAXPXPXSXPL 573 PPPP P P A P P P+ Sbjct: 588 GGPPPPPPPMPLANGATPPPPPPPM 612 Score = 34.7 bits (76), Expect = 0.10 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 5/62 (8%) Frame = +2 Query: 5 PXPXXXPPPPPX--PXXPXPPPPPPXNXP---PXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P P PPPPP P PPPPP P P P PP + PP Sbjct: 454 PPPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPP 513 Query: 170 XP 175 P Sbjct: 514 PP 515 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXX---PXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P PPPPP P P PP AAG PP Sbjct: 569 PMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPPMAMANGAAGPPPP 624 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 6/45 (13%) Frame = +2 Query: 5 PXPXXXPPPP------PXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P P P PP P P PPPPPP P P PP L Sbjct: 436 PLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPPL 480 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PP PP A + P P PP P Sbjct: 417 PPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPP 462 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PPPPP P P PP + G PP A+ A PP Sbjct: 556 PGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPP 608 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 PPPPP PPP P P PP + A+ PP Sbjct: 565 PPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPP 611 Score = 31.1 bits (67), Expect = 1.3 Identities = 23/69 (33%), Positives = 25/69 (36%), Gaps = 12/69 (17%) Frame = +2 Query: 5 PXPXXXPPPPPXP-------XXPXPPPPPP-----XNXPPXTXRGPRPPXLXXRGXASAA 148 P P PPPPP P PPP PP + PP P PP + A Sbjct: 416 PPPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMP--LKHFA 473 Query: 149 GXDPPXLXP 175 PP L P Sbjct: 474 PPPPPPLPP 482 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 1/55 (1%) Frame = +3 Query: 864 PPRPPXPPXXTXXXXXXXXXXALXPXXXXPPPPGXXAR-XXXPPXAAXTRAGXPP 1025 PP PP P PPPPG A PP RA PP Sbjct: 524 PPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPP 578 Score = 28.7 bits (61), Expect = 6.7 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 7/54 (12%) Frame = +2 Query: 23 PPPPPXPXX-------PXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 PPPPP P PPP PP P P PP AA PP Sbjct: 475 PPPPPLPPAVMPLKHFAPPPPTPPA-FKPLKGSAPPPPPPPPLPTTIAAPPPPP 527 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXPA 707 PP PPP + A P P PP A Sbjct: 510 PPPPPPLPTTIAAPPPPPPPPRAA 533 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/37 (51%), Positives = 20/37 (54%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPPP P P PPP P PP T + P PP Sbjct: 115 PPPTVKPPPPPTPYTP--PPPTPYTPPPPTVKPPPPP 149 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P PPPP P PP T P PP Sbjct: 105 PPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPP 141 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +2 Query: 5 PXPXXXPPPP-PXPXXPXPPPPPPXNXPP 88 P P PPPP P P P PPPPP PP Sbjct: 147 PPPVVTPPPPTPTPEAPCPPPPPTPYPPP 175 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/57 (33%), Positives = 22/57 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPP P PPPP PP T + P PP + PP + P Sbjct: 89 PPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKP 145 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP----PPPPPXNXPPXTXRGPRPP 115 P P PPPP P P P PPPPP PP P P Sbjct: 123 PPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAP 163 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/57 (33%), Positives = 23/57 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPPP P PPPP P T + P PP + + PP + P Sbjct: 61 PKPPTVKPPPPY----IPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKP 113 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T P PPPPP PP TP E P P P P Sbjct: 137 TPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYP 173 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/59 (37%), Positives = 25/59 (42%), Gaps = 6/59 (10%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP----PPPPX--NXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P P PPP P P PP PPPP PP T + P PP + + PP Sbjct: 68 PPPPYIPCPPP-PYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPP 125 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +2 Query: 5 PXPXXXPPPPP--XPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PPPPP P P P P P PP T P P Sbjct: 139 PPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPP 176 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/58 (32%), Positives = 22/58 (37%), Gaps = 3/58 (5%) Frame = +2 Query: 11 PXXXPPPP--PXPXXPXPPPPPPXNXPPXTX-RGPRPPXLXXRGXASAAGXDPPXLXP 175 P PPPP P P P P PP PP + P PP + PP + P Sbjct: 64 PTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKP 121 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P PPPPP PP P + P PP P Sbjct: 82 PKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPP 116 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPP---XTPPXEXPTXXPXGPPXP 114 T P P PPPP PP TPP PT PP P Sbjct: 129 TPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPP 168 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P PP P P P P PP Sbjct: 138 PPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPP 174 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXP 85 P P P PP P P PPPP P P Sbjct: 156 PTPTPEAPCPPPPPTPYPPPPKPETCP 182 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/57 (29%), Positives = 20/57 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PP P P PPPP P P+PP + PP + P Sbjct: 49 PKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKP 105 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +2 Query: 5 PXPXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PPP PP P PPPP P P P P Sbjct: 133 PTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTP 171 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 3/60 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP---PPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P P PP P P PPPPP PP PP + PP P Sbjct: 76 PPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTP 135 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PP PP P P P PP P Sbjct: 90 PPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTP 135 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Frame = +1 Query: 10 PXXPPX---PPPPPPXXXPPXTP-PXEXPTXXPXGPP 108 P PP PPPP P PP TP PT P PP Sbjct: 113 PPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPP 149 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP---PPPXNXPPXTXRGPRPP 115 P P PPPP P PPP PPP P P PP Sbjct: 131 PPPTPYTPPPPT-VKPPPPPVVTPPPPTPTPEAPCPPPPP 169 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PP P P A P P P PP P Sbjct: 132 PPTPYTPPPPTVKPPPPPVVTPPPPTPTPEA-PCPPPPPTPYPPPP 176 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPP 698 PP P PP PP PP +P P P PP Sbjct: 98 PPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPP 141 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 1/69 (1%) Frame = +1 Query: 376 PXPPPXXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXPXP-AAXP 552 P PP P PPP P PPPP P P A P Sbjct: 106 PPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCP 165 Query: 553 XPXSXPLXP 579 P P P Sbjct: 166 PPPPTPYPP 174 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P P P PP PP PP P+PP Sbjct: 32 PKPSPHPVKPPKHPAKPPKPPTVKPP--THTPKPP 64 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +1 Query: 10 PXXPPX--PPPPPPXXXPPXTPPXEXPTXXPXGP 105 P PP PPPP P P PP P P P Sbjct: 145 PPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKP 178 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = +1 Query: 10 PXXPPXPPP---PPPXXXPPXTP-PXEXPTXXPXGPPXP 114 P P PPP PPP P P P PT P PP P Sbjct: 141 PTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPP-PPKP 178 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/57 (29%), Positives = 19/57 (33%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P PP PP P P PP PP P PP + PP + P Sbjct: 42 PKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYI-PCPPPPYTPKPPTVKPPPPPYVKP 97 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 45.2 bits (102), Expect = 7e-05 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 4/61 (6%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP----PPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLX 172 P P PPPPP P PPP PPP PP P PP A PP Sbjct: 552 PPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHS 611 Query: 173 P 175 P Sbjct: 612 P 612 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P PPPPPP + PP P PP Sbjct: 543 PPPPVHSPPPP-PVYSPPPPPPPVHSPPPPVFSPPPP 578 Score = 41.9 bits (94), Expect = 7e-04 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPP---PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P P PPPP P + PP P PP Sbjct: 576 PPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPP 615 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P PPPPP + PP P PP Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPP 554 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPPP P PPPP PP P PP PP P Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSP 582 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 5/41 (12%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PPPP P P PPPPPP PP P P Sbjct: 590 PPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPP 630 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = +2 Query: 5 PXPXXXPPPPPX---PXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P P PPPPP P P PPP + P PRPP + Sbjct: 606 PPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKI 647 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P PPPP PP P PP Sbjct: 589 PPPPVHSPPPPAPVH-SPPPPVHSPPPPPPVYSPPPP 624 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +1 Query: 10 PXXPPX---PPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PPPPPP PP PP P PP P Sbjct: 550 PPPPPVYSPPPPPPPVHSPP--PPVFSPPPPVYSPPPP 585 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXP------XPPPPPPXNXPPXTXRGPRPP 115 P PPP P PPPPPP + PP P PP Sbjct: 511 PVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPP 553 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +2 Query: 5 PXPXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PPP PP P PP PP N PP P P Sbjct: 622 PPPVFSPPPSQSPPVVYSP-PPRPPKINSPPVQSPPPAP 659 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P PPPP PP P P PP P Sbjct: 582 PPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPP 616 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P PP + PP + PP Sbjct: 615 PPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPP 651 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PP PPP SP P PP P Sbjct: 536 PPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSP---PPPVFSPPPP 578 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPP 698 PP P PP PP PPP SP P PP Sbjct: 589 PPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSP--PPPVFSPPP 630 Score = 25.4 bits (53), Expect(2) = 7.3 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPPP P + P P P P Sbjct: 529 PVYSPPPPPPPVHSPPPPVHSPPPP 553 Score = 21.4 bits (43), Expect(2) = 7.3 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 376 PXPPPXXPXPPP 411 P PP P PPP Sbjct: 526 PPPPVYSPPPPP 537 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 45.2 bits (102), Expect = 7e-05 Identities = 22/60 (36%), Positives = 24/60 (40%), Gaps = 3/60 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP---PPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPPPP P PP PPPP + PP P PP + PP P Sbjct: 610 PPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSP 669 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P PPPPPP + PP P PP Sbjct: 520 PPPPVYSPPPPPPVYS-PPPPPPVHSPPPPVHSPPPP 555 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPP-----PPXNXPPXTXRGPRPP 115 P P PPPPP P PPPP PP + PP P PP Sbjct: 521 PPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPP 562 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 3/60 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP---PPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPPP P PP PPPP + PP P PP PP P Sbjct: 573 PPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSP 632 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPPP P PPPP PP P PP Sbjct: 512 PPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPP 548 Score = 41.9 bits (94), Expect = 7e-04 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP---PPPPPXNXPPXTXRGPRPP 115 P P PPPP P P PPPPP + PP P PP Sbjct: 566 PPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPP 605 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPP-PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P P PPPP + PP P PP Sbjct: 539 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 576 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPP-PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P P PPPP + PP P PP Sbjct: 546 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 583 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/60 (33%), Positives = 23/60 (38%), Gaps = 3/60 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP---PPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPPP P P PPPP + PP + P PP + PP P Sbjct: 625 PPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTP 684 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPPPX-PXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P P PPPP + PP P PP Sbjct: 553 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPP 590 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P PPPP PP P PP Sbjct: 494 PPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPP 530 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP---PPPXNXPPXTXRGPRPP 115 P P PPPPP P PPP PPP PP P PP Sbjct: 504 PSPIHSPPPPPVYSPPPPPPVYSPPP---PPPVYSPPPPP 540 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP---PPPPPXNXPPXTXRGPRPP 115 P P PPPP P P PPPP + PP P PP Sbjct: 552 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPP 591 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP----PPPPXNXPPXTXRGPRP 112 P P PPPPP P PP PPP + PP P P Sbjct: 530 PPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 569 Score = 36.3 bits (80), Expect = 0.033 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PPPP PP PP P PP P Sbjct: 604 PPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPP 635 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXN-XPPXTXRGPRPP 115 P P PPP P PPPPP + PP P PP Sbjct: 502 PPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPP 539 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 6/43 (13%) Frame = +2 Query: 5 PXPXXXPPP------PPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP PP P PPPPPP PP PP Sbjct: 495 PPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPP 537 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPX-PXXPXPPPPPP-XNXPPXTXRGPRPP 115 P P PPPP P P PPPP + PP P PP Sbjct: 560 PPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPP 598 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPP P PPP P + PP P PP Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPP 521 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 5/58 (8%) Frame = +2 Query: 5 PXPXXXPPPP----PXPXXPXPPPPPPXNXPPXTXRGP-RPPXLXXRGXASAAGXDPP 163 P P PPPP P P PPPP PP P PP + + PP Sbjct: 633 PPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSPPP 690 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 5/36 (13%) Frame = +2 Query: 23 PPPPPXPXXPXP-----PPPPPXNXPPXTXRGPRPP 115 PPPPP P P PPPPP PP PP Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPP 528 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP PP PP PPP SP P PP P Sbjct: 495 PPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPP 540 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P PPPPP P PP P PP P Sbjct: 609 PPPPVYSPPPPPPVHSP-PPPVFSPPPPVHSPPPP 642 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +1 Query: 19 PPXPPP-PPPXXXPPXTPPXEXPTXXPXGPP 108 PP PP PP P +PP P P PP Sbjct: 510 PPPPPVYSPPPPPPVYSPPPPPPVYSPPPPP 540 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 P P P R P PPP SP P PP P Sbjct: 469 PQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPP 514 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 1/45 (2%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXX-RXPPXPPPXASPXXAXPXXPXPP 698 PP P PP PP PPP SP P PP Sbjct: 503 PPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPP 547 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +1 Query: 19 PPXPPP----PPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PPP PPP PP PP P PP P Sbjct: 536 PPPPPPVHSPPPPVHSPP--PPVHSPPPPVHSPPPP 569 Score = 23.8 bits (49), Expect(2) = 9.4 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 370 PXPXPPPXXPXPPP 411 P P PP P PPP Sbjct: 518 PPPPPPVYSPPPPP 531 Score = 23.8 bits (49), Expect(2) = 7.3 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 370 PXPXPPPXXPXPPP 411 P P PP P PPP Sbjct: 527 PPPPPPVYSPPPPP 540 Score = 23.0 bits (47), Expect(2) = 7.3 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXP 570 P PPPP P + P S P Sbjct: 532 PVYSPPPPPPVHSPPPPVHSPP 553 Score = 22.6 bits (46), Expect(2) = 9.4 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXP 558 P PPPP P + P P Sbjct: 523 PVYSPPPPPPVYSPPPPP 540 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 44.4 bits (100), Expect = 1e-04 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPP P P PP PPP + PP + P PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPP 93 Score = 41.9 bits (94), Expect = 7e-04 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PPP P P P PP PPP + PP Sbjct: 67 PPPTSPPPPSPPPPSPPPPSPPPPSPPP 94 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PP P P P PP PPP + PP + P PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPS---PPPP 95 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXPA 707 PP PP SP P P PP PA Sbjct: 73 PPPSPPPPSPPPPSPPPPSPPPPA 96 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 639 PXPPPXASPXXAXPXXPXPPXPA 707 P PPP SP P P PP P+ Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPS 86 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPPP P P + P P P P Sbjct: 68 PPTSPPPPSPPPPSPPPPSPPPPSP 92 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXPA 707 PP PP SP P P PP P+ Sbjct: 68 PPTSPPPPSPPPPSPPPPSPPPPS 91 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXP 570 P PPPP P P + P P P Sbjct: 73 PPPSPPPPSPPPPSPPPPSPPP 94 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXG 102 P PP PPPP P PP P G Sbjct: 75 PSPPPPSPPPPSPPPPSPPPPAFAVGKTPEG 105 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRG 133 P P PPPPP P PPPPP PP P PP RG Sbjct: 673 PLPGGGPPPPPPPPGGGPPPPPGGGPPPP----PPPPGALGRG 711 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PP P P PPPPP PP GP PP Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPP 701 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P PPPPP PP P P P PP P Sbjct: 672 PPLPGGGPPPPP--PPPGGGPPPPPGGGPPPPPPP 704 Score = 29.1 bits (62), Expect = 5.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 364 GPPXPXPPPXXPXPPP 411 GPP P PPP PPP Sbjct: 678 GPPPPPPPPGGGPPPP 693 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/59 (35%), Positives = 23/59 (38%), Gaps = 2/59 (3%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP--PPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPPPP P P PPPP + PP P PP + PP P Sbjct: 760 PPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSP 818 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP--PPPPPXNXPPXTXRGPRPP 115 P P PPPPP P P PPPP + PP P PP Sbjct: 678 PPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 716 Score = 41.9 bits (94), Expect = 7e-04 Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 3/38 (7%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPP---PPPPXNXPPXTXRGPRPP 115 P PPPPP P PP PPPP + PP P PP Sbjct: 643 PVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPP 680 Score = 41.9 bits (94), Expect = 7e-04 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP---PPPPXNXPPXTXRGPRPP 115 P P PPPP P PP PPPP + PP P PP Sbjct: 752 PPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPP 791 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP---PPPPPXNXPPXTXRGPRPP 115 P P PPPP P P PPPPP + PP P PP Sbjct: 663 PPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPP 702 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPPPX-PXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P P PPPP + PP + P PP Sbjct: 700 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPP 737 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPPPX-PXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P P PPPP + PP P PP Sbjct: 686 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 723 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPPPX-PXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P P PPPP + PP P PP Sbjct: 693 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 730 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P PPPPP + PP P PP Sbjct: 735 PPPPVFSPPPPAPIYS-PPPPPVHSPPPPVHSPPPPP 770 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP---PPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPPP P P PPPP + PP P PP A PP Sbjct: 699 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPP 754 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPPPX-PXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P P PPPP PP P PP Sbjct: 650 PPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPP 687 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPP---PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P P P PPPP PP P PP Sbjct: 789 PPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPP 828 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P PPP P + PP P PP Sbjct: 727 PPPPVQSPPPP-PVFSPPPPAPIYSPPPPPVHSPPPP 762 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP---PPPPPXNXPPXTXRGPRPP 115 P P PPPP P P PPPP + PP P PP Sbjct: 649 PPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPP 688 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P P PPPP + PP P PP Sbjct: 736 PPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPP 777 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/41 (46%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = +2 Query: 5 PXPXXXPPPPP-XPXXPXPP---PPPPXNXPPXTXRGPRPP 115 P P PPPP P P PP PPPP + PP P PP Sbjct: 671 PPPVYSPPPPVHSP--PPPPVHSPPPPVHSPPPPVHSPPPP 709 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +1 Query: 4 TXPXXPPX--PPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T P PP PPPPPP PP PP P PP P Sbjct: 637 TSPQSPPVHSPPPPPPVHSPP--PPVFSPPPPMHSPPPP 673 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPX-PXXPXPPPPPPX-NXPPXTXRGPRPP 115 P P PPPP P P PPPP + PP P PP Sbjct: 657 PPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPP 695 Score = 35.1 bits (77), Expect = 0.077 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 4/61 (6%) Frame = +2 Query: 5 PXPXXXPPPP----PXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLX 172 P P PPPP P P PPPP PP P PP + + PP Sbjct: 714 PPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHS 773 Query: 173 P 175 P Sbjct: 774 P 774 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 32 PPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPPPP + PP P PP Sbjct: 639 PQSPPVHSPPPPPPVHSPPPPVFSPPPP 666 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PPPP PP PP P PP P Sbjct: 751 PPPPPVHSPPPPVHSPP-PPPVHSPPPPVHSPPPP 784 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PPPP PP P P P P P Sbjct: 722 PPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPP 753 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P P P P P PP P P+P Sbjct: 517 PKPEESPKPEPPKPEESPKPQPPKQETPKPEESPKP 552 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 6/36 (16%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP---PPP---XNXPPXT 94 P P PPPP P PPP PPP PP T Sbjct: 795 PPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPPAT 830 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P PPPP PP +P P PP P Sbjct: 788 PPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKP 822 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPP 698 PP P PP P PPP SP P PP Sbjct: 727 PPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPP 770 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 4/50 (8%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPX----PPPXASPXXAXPXXPXPPXP 704 PP P PP PP PPP SP P PP P Sbjct: 706 PPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPP 755 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/47 (42%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPX--PPPPPPXNXPPXTXRGPRPPXLXXRGXA 139 P PPPPP P PPPPPP PP + RPP +G A Sbjct: 259 PPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKGAA 305 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXD 157 P PPPPP P PPPP PP +G P A+ D Sbjct: 273 PPPQPPPPPPPKPQPPPPPKIARPPPAPPKGAAPKRQGNTSSGDASDVD 321 Score = 35.1 bits (77), Expect = 0.077 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P P PPP P PPP PP P Sbjct: 279 PPPPPKPQPPPPPKIARPPPAPPKGAAP 306 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PP P PPPPP PP P PP Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPP 283 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/52 (32%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXP--PPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDP 160 P PP P P PPP P PP + P PP + A G P Sbjct: 255 PLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKGAAP 306 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASP 665 PP P PP R PP PP A+P Sbjct: 274 PPQPPPPPPPKPQPPPPPKIARPPPAPPKGAAP 306 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPPP P PPPPP PP P PP + PP P Sbjct: 576 PPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSP 632 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/58 (34%), Positives = 22/58 (37%), Gaps = 1/58 (1%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-XNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPPP P P PPPP + PP P PP + PP P Sbjct: 568 PPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSP 625 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPP---PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P P P PPPP + PP P PP Sbjct: 596 PPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPP 635 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 PPP P P P PP P PP P PP PP P Sbjct: 534 PPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASP 582 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPPP-XPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P P PPPP PP T +PP Sbjct: 612 PSPVYSPPPPSHSPPPPVYSPPPPTFSPPPTHNTNQPP 649 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P P P P P PPPP + PP PP A PP P Sbjct: 535 PPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPP 589 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP---PPPPXNXPPXTXRGPRPP 115 P P PPPP P PP PPPP PP P PP Sbjct: 560 PPPVYSSPPPPHVYSPPPPVASPPPPS--PPPPVHSPPPP 597 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP----PPPPXNXPPXTXRGPRPP 115 P P PPPP P PP PPPP PP P PP Sbjct: 552 PPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPP--SPPPP 590 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP---PPPXNXPPXTXRGPRPP 115 P P PPP PPP PPP + PP P PP Sbjct: 559 PPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPP 598 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP----PPPPXNXPPXTXRGP 106 P P PPPP P PP PPP + PP T P Sbjct: 603 PPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPP 640 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXT---PPXEXPTXXPXGPPXP 114 P P PPPP PP T PP P G P P Sbjct: 618 PPPPSHSPPPPVYSPPPPTFSPPPTHNTNQPPMGAPTP 655 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPP---XPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPP P P PP P PP P PP Sbjct: 516 PVKNRRSPPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPP 555 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 10/47 (21%) Frame = +2 Query: 5 PXPXXXPPPP----PXPXXPXPPP----PPPXN--XPPXTXRGPRPP 115 P P PP P P P PPP PPP + PP P PP Sbjct: 539 PMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPP 585 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/37 (51%), Positives = 20/37 (54%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG+G GG GGGGG G G GGGGG G G Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCG 38 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 G G GG GGGGGG G GGGGG G Sbjct: 94 GAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGG 128 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG+G G GGGGGG G GGGG G G Sbjct: 12 GGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGG 48 Score = 36.3 bits (80), Expect = 0.033 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -1 Query: 742 GXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 G GG+ GG G GG G G++ GGG GG Sbjct: 15 GGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGG 50 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/61 (34%), Positives = 23/61 (37%), Gaps = 1/61 (1%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEA-XGGGXGGXRXXXXXXXXXXGXGGXXXGXG 569 GG GG GG G G G G + G GGG GG + G GG G Sbjct: 75 GGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGS 134 Query: 568 G 566 G Sbjct: 135 G 135 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG G + GG GGGGGG G GGGG G Sbjct: 93 GGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKG 127 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G G G G GG GG GGGGG GG G Sbjct: 5 GGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGG 39 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 G GG GG G GG G G G GGG GG Sbjct: 13 GKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGG 49 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G G GG GG GG GG GG G Sbjct: 17 GGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGG 51 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 G GG A + GG+ GG GG GGG G G GGG G Sbjct: 83 GGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGG 137 Score = 33.5 bits (73), Expect = 0.24 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = -2 Query: 174 GXKXG-GSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G K G GS GGRG GG GG GGG G GGGGG G Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGG--GGGAKGGCGGGGKSGGGGGGGGYMVAPG 57 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGG----XGXXGXGGGGGXXXGXG 4 GG G GG GGG GG G GGGGG G G Sbjct: 78 GGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGG 118 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXG 569 GG GG G G GG G G GGG G GG G G Sbjct: 80 GGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGGG 138 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/48 (37%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = -2 Query: 141 DAXPRXXXXGGRGPRXVXGGXFXGGGGG----GXGXXGXGGGGGXXXG 10 ++ P+ GG GG GG GG G G G GGGGG G Sbjct: 70 ESDPKGGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGG 117 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGG G G GGGG G Sbjct: 108 GGGGGGKNGGGCGGGGGGKGGKSGGGSGGGGYMVAPG 144 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 Query: 86 VGXSXGGVXGGXXXGGGGGGXGGXXG 9 +G G GG GGGGGG GG G Sbjct: 1 MGGKGGSGSGGGGKGGGGGGSGGGRG 26 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 101 PXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 P G G GG GG GGG GG G G Sbjct: 73 PKGGSGGGGKGGGGGGGISGGGAGGKSGCGG 103 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/50 (34%), Positives = 20/50 (40%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGG 25 G GG+ + GG G + G GGG GG G GGGG Sbjct: 89 GISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGGG 138 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GG GGG G GGG G G G Sbjct: 75 GGSGGGGKGGGGGGGISGGGAGGKSGCG 102 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 G GG G G GG G GGG G GG Sbjct: 107 GGGGGGGKNGGGCGGGGGGKGGKSGGGSGGGG 138 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -2 Query: 114 GGRGPRXVXGGXFXG-GGGGGXGXXGXGGGGGXXXGXG 4 GG G GG G GGG G G GGG G G Sbjct: 75 GGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGG 112 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 42.7 bits (96), Expect = 4e-04 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPPP P PPPPPP P P PP Sbjct: 378 PANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPP 414 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P P PPP P GP PP Sbjct: 388 PPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPP 424 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 7/42 (16%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPP------PXNXPPXTXRG-PRPP 115 P PPP P P PPPPP P PP + +G P+PP Sbjct: 395 PPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPP 436 Score = 36.3 bits (80), Expect = 0.033 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXN--XPPXTXRGPRPP 115 PPPPP PPPPPP + PP P+ P Sbjct: 410 PPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKGP 442 Score = 33.5 bits (73), Expect = 0.24 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXPXXXXAXXXXXXXXXXXXLGPXPX 183 T PP PP P PP PP P PP P A GP P Sbjct: 367 TTANAPPAPPGPANQTSPPPPPPPSAAAPPP--PPPPKKGPAAPPPPPPPGKKGAGPPPP 424 Query: 184 KMXXKKNCXK 213 KK K Sbjct: 425 PPMSKKGPPK 434 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +3 Query: 864 PPRPPXPPXXTXXXXXXXXXXALXPXXXXPPPPGXXARXXXPPXAAXTRAGXPP 1025 PP PP P T A P PPP A PP AG PP Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPP--PPPKKGPAAPPPPPPPGKKGAGPPP 423 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRG 103 PPPP P PP PP N T G Sbjct: 421 PPPPPPMSKKGPPKPPGNPKGPTKSG 446 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/59 (35%), Positives = 25/59 (42%), Gaps = 2/59 (3%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRG--PRPPXLXXRGXASAAGXDPPXLXP 175 P P P PP P P P PPPP + PP T P PP + + PP + P Sbjct: 158 PTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSV-PSPPDVTP 215 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPP--PPXNXPPXTXRGPRPP 115 P PPP P P P P PP PP P + P PP Sbjct: 96 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 132 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPP--PPXNXPPXTXRGPRPP 115 P PPP P P P P PP PP P + P PP Sbjct: 114 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 150 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPP--PPXNXPPXTXRGPRPP 115 P PPP P P P P PP PP P + P PP Sbjct: 132 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 168 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/55 (32%), Positives = 22/55 (40%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P PPP P P P P PP P + P P PP + + PP + P Sbjct: 150 PVSPPPPTPTPSVPSPTPPVPTDPMP----SPPPPVSPPPPTPTPSVPSPPDVTP 200 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP P P P PP +PP PT P P Sbjct: 80 PVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 114 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P P P PP PP TP P+ P P P Sbjct: 85 PPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPP 119 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P P P P P PP P P P P PP + PP P Sbjct: 84 PPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 140 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P P P P P PP P P P P PP + PP P Sbjct: 102 PTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 158 Score = 32.7 bits (71), Expect = 0.41 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P P PP PP TP P+ P P P Sbjct: 142 PSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDP 173 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +1 Query: 4 TXPXXPPXPPPPP--PXXXPPXTPPXEXPTXX--PXGPPXP 114 T P PP P P P P PP +PP PT PP P Sbjct: 130 TPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVP 170 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 6/59 (10%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP------PPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P P P PP P P PP P P + + PP Sbjct: 178 PPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPP 236 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/49 (32%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +2 Query: 32 PPXPXXPXPPPPPPXNXP-PXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 PP P P PPPP + P P P PP + PP P Sbjct: 74 PPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 122 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP-----PPPPXNXPPXTXRGPRPP 115 P P P PP P P PP PP P + P + P P Sbjct: 208 PSPPDVTPTPPTPSVPSPPDVTPTPPTPPSVPTPSGSPPYVP 249 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPP-XPXXPXPPPPPPXNXPP-XTXRGPRPP 115 P P P PP P P P P P PP T P PP Sbjct: 140 PTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPP 178 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPP-PXNXPPXTXRGPRP 112 PP P P P PP P P PP + P P Sbjct: 74 PPAPVPPVSPPPPTPSVPSPTPPVSPPPPTP 104 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/46 (32%), Positives = 15/46 (32%), Gaps = 1/46 (2%) Frame = +3 Query: 570 PXPXXXPPXXXXXXXXXXXXRXPPXPPPXAS-PXXAXPXXPXPPXP 704 P P PP PP P P S P P P PP P Sbjct: 77 PVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 122 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 42.3 bits (95), Expect = 5e-04 Identities = 23/58 (39%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPP---PPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P PPPPP P PPP PPP PP P PP R S + PP P Sbjct: 573 PPPPPPPPPLPSRSIPPPLAQPPPPRPPP-----PPPPPPSSRSIPSPSAPPPPPPPP 625 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 5/62 (8%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP-----PPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P P PPPP P P PPP P P PP P PP G A PP Sbjct: 588 PPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPP---PPPPSFGSTGNKRQAQPPPPPP 644 Query: 170 XP 175 P Sbjct: 645 PP 646 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/69 (31%), Positives = 24/69 (34%), Gaps = 12/69 (17%) Frame = +2 Query: 5 PXPXXXPPPPPXPXX------------PXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAA 148 P P PPPPP P P PPPPPP P P PP + + Sbjct: 613 PSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSI 672 Query: 149 GXDPPXLXP 175 PP P Sbjct: 673 RVGPPSTPP 681 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/60 (35%), Positives = 26/60 (43%), Gaps = 8/60 (13%) Frame = +2 Query: 5 PXPXXXPPPPPXP---XXPXPPPPPPXN-----XPPXTXRGPRPPXLXXRGXASAAGXDP 160 P P PP PP P PPPPPP + PP + P PP G +++G P Sbjct: 696 PKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPP 755 Score = 36.7 bits (81), Expect = 0.025 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP P PPPP PP + P+ P PP P Sbjct: 594 PPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPP 625 Score = 35.5 bits (78), Expect = 0.058 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T P PP PPP P PP P P PP P Sbjct: 571 TPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPP 607 Score = 35.5 bits (78), Expect = 0.058 Identities = 19/47 (40%), Positives = 22/47 (46%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PPP P P PPPP T G PP L +G ++A PP Sbjct: 726 PAPPPPPLSKTPVPPPPPGLGRGTSSG--PPPLGAKG-SNAPPPPPP 769 Score = 35.1 bits (77), Expect = 0.077 Identities = 21/60 (35%), Positives = 23/60 (38%), Gaps = 5/60 (8%) Frame = +2 Query: 5 PXPXXXPPPPPXP-----XXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P PPPPP P P PP PPP PP + R PP + PP L Sbjct: 676 PPSTPPPPPPPPPKANISNAPKPPAPPP--LPPSSTRLGAPPPPPPPPLSKTPAPPPPPL 733 Score = 34.3 bits (75), Expect = 0.13 Identities = 38/187 (20%), Positives = 42/187 (22%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXPXXXXAXXXXXXXXXXXXLGPXPXKMXXK 198 PP PPPPPP T P+ P PP P + P P Sbjct: 482 PPPPPPPPPPLFTSTT--SFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTT 539 Query: 199 KNCXKKKKXKXXXPDXAPXGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXGPPXP 378 + P + A PP P Sbjct: 540 SFSPSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRP 599 Query: 379 XPPPXXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXPXPAAXPXP 558 PPP P P R P PPPP PAA P Sbjct: 600 -PPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAP 658 Query: 559 XSXPLXP 579 P P Sbjct: 659 PPPPPPP 665 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 PP PPPPP P PP T P PP Sbjct: 714 PPPPPPPPLSKTPAPPPPPLSKTPVPPPPP 743 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 8/43 (18%) Frame = +2 Query: 11 PXXXPPPPPX--------PXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPPP P P PPPPPP T P P Sbjct: 504 PPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQP 546 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PP PPP + A P PP P Sbjct: 618 PPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPP 663 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 8/43 (18%) Frame = +2 Query: 11 PXXXPPPPPX--------PXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPPP P P PPPPPP T P P Sbjct: 483 PPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQP 525 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PPPPPP + P P PP Sbjct: 501 PSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPP 533 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = +3 Query: 561 LXPPXPXXXPPXXXXXXXXXXXXRXPPXPPP---XASPXXAXPXXPXPPXP 704 L PP P PP + PP PPP S P P PP P Sbjct: 480 LLPPPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPP 530 Score = 31.5 bits (68), Expect = 0.95 Identities = 21/66 (31%), Positives = 23/66 (34%), Gaps = 11/66 (16%) Frame = +2 Query: 23 PPPPPXPXX----------PXPPPPPPXNXPPXTXRGPRPPXLXXRGXASA-AGXDPPXL 169 PPPPP P PPPPPP P+PP +S G PP Sbjct: 659 PPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPP 718 Query: 170 XPXXXK 187 P K Sbjct: 719 PPPLSK 724 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PPPPPP + P+ P PP P Sbjct: 522 PSQPPPPPPPPPLF---TSTTSFSPSQPPPPPPLP 553 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP PP PPP P + P P P Sbjct: 573 PPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAP 618 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPX--ASPXXAXPXXPXPPXP 704 PP P PP PP PPP S P P PP P Sbjct: 504 PPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPPPPPP 551 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +3 Query: 864 PPRPPXPPXXTXXXXXXXXXXALXPXXXXPPPPGXXARXXXPPXAAXTRAGXPP 1025 PP PP PP P PPPP +R P A PP Sbjct: 573 PPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPP 626 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 6/52 (11%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXAS------PXXAXPXXPXPPXP 704 PP P PP PP PPP S A P P PP P Sbjct: 596 PPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPP 647 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/51 (31%), Positives = 18/51 (35%), Gaps = 4/51 (7%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXAS----PXXAXPXXPXPPXPA 707 PP P R PP PPP S P + P P PP P+ Sbjct: 577 PPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPS 627 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T P PPPPPP + P+ P PP P Sbjct: 496 TTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPP 532 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 13/48 (27%) Frame = +2 Query: 11 PXXXPPPPPXPXXP-------------XPPPPPPXNXPPXTXRGPRPP 115 P PPPPP P PPPPP PP R PP Sbjct: 543 PSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPP 590 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/52 (30%), Positives = 18/52 (34%), Gaps = 6/52 (11%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXR------XPPXPPPXASPXXAXPXXPXPPXP 704 PP P PP + PP PPP +S P P PP P Sbjct: 572 PPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPP 623 Score = 28.7 bits (61), Expect = 6.7 Identities = 22/68 (32%), Positives = 24/68 (35%), Gaps = 18/68 (26%) Frame = +2 Query: 26 PPPPXP-----------XXPXPPPPPPXN-------XPPXTXRGPRPPXLXXRGXASAAG 151 PPPP P P PPPPPP + PP T P PP + Sbjct: 639 PPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKP 698 Query: 152 XDPPXLXP 175 PP L P Sbjct: 699 PAPPPLPP 706 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/62 (27%), Positives = 21/62 (33%), Gaps = 5/62 (8%) Frame = +3 Query: 867 PRPPXPPXXTXXXXXXXXXXALXPXXXXPPPPGXXARXXXPP-----XAAXTRAGXPPHX 1031 P PP PP + + P PPP + PP + TR G PP Sbjct: 658 PPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPP 717 Query: 1032 LP 1037 P Sbjct: 718 PP 719 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPP-PXNXPPXTXRGPRPP 115 PPPPP PPPPP P P P PP Sbjct: 572 PPPPP------PPPPPLPSRSIPPPLAQPPPP 597 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 3/34 (8%) Frame = +2 Query: 23 PPPPPXPXX---PXPPPPPPXNXPPXTXRGPRPP 115 PPPPP P PPPPPP PP T P PP Sbjct: 618 PPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPP 651 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +2 Query: 5 PXPXXXPPPPP-XPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P PPPPP P P PPPP + PP P PP + Sbjct: 522 PSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYI 561 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +2 Query: 23 PPPPPX---PXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPPP P PPPPPP PP T P P Sbjct: 661 PPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSP 694 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P PPPPP P PPPP P P PP L Sbjct: 495 PSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPL 533 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPX--PXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPPP P PPP P PP T P PP Sbjct: 670 PVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPP 708 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPP-PPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP PP P PPPP + PP PP Sbjct: 530 PPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPP 567 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXP--XPPPPPPXNXPPXTXRGPRPP 115 P PPPPP P PPPPP P T P PP Sbjct: 641 PPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPP 679 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/34 (50%), Positives = 18/34 (52%), Gaps = 4/34 (11%) Frame = +2 Query: 26 PPPPXPXXPXP----PPPPPXNXPPXTXRGPRPP 115 PPPP P P P PPP N PP T + P PP Sbjct: 549 PPPPSPSPPPPYIYSSPPPVVNCPP-TTQSPPPP 581 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/60 (31%), Positives = 24/60 (40%), Gaps = 5/60 (8%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP-----PPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P P P PPP P PPPPP + PP + P PP + + PP + Sbjct: 505 PPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPS---PPPPYIYSSPPPPSPSPPPPYI 561 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = +2 Query: 23 PPPPPX--PXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 PPPPP P PPPPP P + P PP + + PP P Sbjct: 633 PPPPPVYYPPVTASPPPPPVYYTP-VIQSPPPPPVYYSPVTQSPPPPPPVYYP 684 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPX---PXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPPP P PPPP P PP + P PP Sbjct: 698 PPVTQSPPPPPVYYLPVTQSPPPPSPVYYPP-VAKSPPPP 736 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPX---PXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPP P P PPPP P PP T + P PP Sbjct: 713 PVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVT-QSPPPP 751 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 PPPP PPPPPP + P PP +A+ PP Sbjct: 607 PPPPTYYATQSPPPPPPPTY--YAVQSPPPPPPVYYPPVTASPPPPP 651 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +2 Query: 23 PPPPPXPXXPXP---PPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 PPPP P PPPPP + T R PP + A PP Sbjct: 425 PPPPSFKMSPTVRVLPPPPPSSKMSPTFRATPPPPSSKMSPSFRATPPPP 474 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/65 (32%), Positives = 23/65 (35%), Gaps = 8/65 (12%) Frame = +2 Query: 5 PXPXXXPP----PPPXPXXPXP----PPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDP 160 P P PP PPP P P PPPPP P T P P + A + Sbjct: 678 PPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPS 737 Query: 161 PXLXP 175 P P Sbjct: 738 PVYYP 742 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 4/55 (7%) Frame = +2 Query: 23 PPPPPXPXXP----XPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 PPPP P PPPPPP P P PP A PP P Sbjct: 486 PPPPSSKMSPSVKAYPPPPPPPEYEP----SPPPPSSEMSPSVRAYPPPPPLSPP 536 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P PPPP PP P PP + P P Sbjct: 743 PVTQSPPPPSTPVEYHPPASPNQSPPPEYQSPPP 776 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 4/41 (9%) Frame = +2 Query: 5 PXPXXXPPPPPX----PXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPPP P PPPP P P PP Sbjct: 434 PTVRVLPPPPPSSKMSPTFRATPPPPSSKMSPSFRATPPPP 474 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 8/37 (21%) Frame = +1 Query: 28 PPPPPPXXXPPXTPPXEX--------PTXXPXGPPXP 114 PPPPPP P PP P P PP P Sbjct: 502 PPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPP 538 Score = 27.1 bits (57), Expect(2) = 0.70 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PP P PPP Sbjct: 501 PPPPPPPEYEPSPPP 515 Score = 23.4 bits (48), Expect(2) = 0.70 Identities = 11/29 (37%), Positives = 13/29 (44%), Gaps = 4/29 (13%) Frame = +1 Query: 505 PXXRPPPPXPXP----AAXPXPXSXPLXP 579 P PPPP P P ++ P P P P Sbjct: 531 PPLSPPPPSPPPPYIYSSPPPPSPSPPPP 559 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPR 109 P P PPP P PPPPPP PP + PR Sbjct: 365 PVPPPRRSPPPLQTPPPPPPPPPLAPPPPPQKRPR 399 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 28 PPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PPP PP P P P PP P Sbjct: 365 PVPPPRRSPPPLQTPPPPPPPPPLAPPPP 393 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPR 414 PP P PPP P PPP+ Sbjct: 380 PPPPPPPPLAPPPPPQ 395 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +1 Query: 22 PXPPP---PPPXXXPPXTPPXEXPTXXPXGPP 108 P PPP PPP PP PP P P PP Sbjct: 365 PVPPPRRSPPPLQTPPPPPPP--PPLAPPPPP 394 Score = 26.2 bits (55), Expect(2) = 0.69 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 517 PPPPXPXPAAXPXP 558 PPPP P P A P P Sbjct: 380 PPPPPPPPLAPPPP 393 Score = 25.8 bits (54), Expect(2) = 1.5 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXP 558 P PPPP P P P P Sbjct: 375 PLQTPPPPPPPPPLAPPP 392 Score = 24.2 bits (50), Expect(2) = 0.69 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 367 PPXPXPPPXXPXPP 408 PP PPP P PP Sbjct: 374 PPLQTPPPPPPPPP 387 Score = 23.4 bits (48), Expect(2) = 1.5 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP PPP PPP Sbjct: 368 PPRRSPPPLQTPPPP 382 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGGG G G GGGG G G Sbjct: 97 GGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGG 133 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/39 (51%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGG--GGGGXGXXGXGGGGGXXXGXG 4 GG G GG GG GGGG G G GGGGG G G Sbjct: 48 GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGG 86 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG + GGGGG G GGGGG G G Sbjct: 98 GGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGG 134 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGG G G G GGG G G Sbjct: 90 GGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGG 126 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGG G G G GGGGG G G Sbjct: 105 GGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGG 141 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G G G G GG GG GGGGGG GG G Sbjct: 101 GHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGG 135 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGG--GXGXXGXGGGGGXXXGXG 4 GG G GG GGGGG G G GGGGG G G Sbjct: 76 GGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGG 114 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG + GGGG G G GGGG G G Sbjct: 91 GGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGG 127 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG + GGGG G G GGGG G G Sbjct: 84 GGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGG 120 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGG G G GGGG G G Sbjct: 104 GGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGG 140 Score = 31.5 bits (68), Expect = 0.95 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 4/64 (6%) Frame = -1 Query: 745 GGXAAGGAXG-GXXAGXGGXGXXGXAXXGEAXGGG---XGGXRXXXXXXXXXXGXGGXXX 578 GG GG G G G GG G G G GGG GG G GG Sbjct: 51 GGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHY 110 Query: 577 GXGG 566 G GG Sbjct: 111 GGGG 114 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 730 GGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG G GG G G G GGG G Sbjct: 107 GGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHG 138 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG G G G G GGGGG G G Sbjct: 57 GGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGG 93 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXG 10 G GGG G G GGGGG G Sbjct: 42 GYGGGHGGHGGHGGGGGHGHG 62 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPP P P P PPPP + P + P PP Sbjct: 15 PSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPP 51 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPPP P PPPPP + P P PP Sbjct: 22 PPPPPPSLPPPVPPPPPSHQPYSYPPPPPPP 52 Score = 32.7 bits (71), Expect = 0.41 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP P PP P PP P P PP Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPP 38 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP---PPPPPXNXPPXTXRGPRPP 115 P P PP PP P P PPPPP +GP P Sbjct: 25 PPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYP 64 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PP P P PP P+ P PP P Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPP 37 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +2 Query: 23 PPPPPXPXXPXP--PPPPPXNXPPXTXRG 103 PPPPP P P P P PP P +G Sbjct: 72 PPPPPPPSAPPPLVPDPPRHQGPNDHEKG 100 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPP--PPXNXPPXTXRGP 106 P P PP P PPPP PP PP P Sbjct: 7 PYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQP 42 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PPP PP P P P PP P Sbjct: 22 PPPPPPSLPPPVPPPPPSHQPYSYP---PPPPPPP 53 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Frame = +2 Query: 23 PPPPPXPXXPXP----PPPPPXNXPPXTXRGPRPP 115 PP PP P P PPPPP + PP P PP Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPPPVP--PPPP 38 Score = 26.2 bits (55), Expect(2) = 0.93 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PP P PPP Sbjct: 24 PPPPSLPPPVPPPPP 38 Score = 23.8 bits (49), Expect(2) = 0.93 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXP 570 P PPPP P + P P P Sbjct: 31 PPVPPPPPSHQPYSYPPPPPPP 52 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPP---PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P P P PPPP + PP P PP Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPP 88 Score = 35.5 bits (78), Expect = 0.058 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP P PPPP P PP P PP P Sbjct: 50 PPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSP 81 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +2 Query: 5 PXPXXXPPPPP----XPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P P PPPPPP PP PP Sbjct: 62 PSPPPPSPPPPKKSSCPPSPLPPPPPP---PPPNYVFTYPP 99 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 6/41 (14%) Frame = +1 Query: 10 PXXPPXPPPP------PPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PPPP PP PP P+ P PP P Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPP 89 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +1 Query: 10 PXXPPXPPPP-PPXXXPPXTPPXEXPTXXPXGPP 108 P P PPPP PP PP P P PP Sbjct: 58 PSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PPPPP PP PP P+ P PP P Sbjct: 43 PCLQNQPPPPP---SPP--PPSCTPSPPPPSPPPP 72 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 41 PXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPPP PP P PP Sbjct: 43 PCLQNQPPPPPSPPPPSCTPSPPPP 67 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXP 96 T PP PPPP PP P P P Sbjct: 61 TPSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 27.1 bits (57), Expect(2) = 1.4 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PP P PPP Sbjct: 52 PPSPPPPSCTPSPPP 66 Score = 22.6 bits (46), Expect(2) = 1.4 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +1 Query: 517 PPPPXPXPAAXPXPXSXPLXP 579 PPPP P P PL P Sbjct: 64 PPPPSPPPPKKSSCPPSPLPP 84 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GG GP G GGGGGG G G GGGGG Sbjct: 109 GGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G + G GG GGGGGG GG G Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG+G GG G G G GGGGG G G Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGG 138 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G G G GGG GG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGG 138 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 410 GGGXGXXGGGXGXGGP 363 GGG G GGG G GGP Sbjct: 125 GGGGGGGGGGGGGGGP 140 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GG GP G GGGGGG G G GGGGG Sbjct: 109 GGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G + G GG GGGGGG GG G Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 3/35 (8%) Frame = -3 Query: 113 GXGGPXGXXVGXSX---GGVXGGXXXGGGGGGXGG 18 G GGP G G GG GG GGGGGG GG Sbjct: 361 GGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGG 395 Score = 33.5 bits (73), Expect = 0.24 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRX-VXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 G K GG GG GP GG GG G G GGGGG G Sbjct: 341 GGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGG 396 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 179 GXGPXXXXXXXXXXXXPAXXXXGXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GP P G GGP G G GG G GGGG GG G Sbjct: 293 GPGPAGGKIEGKGMPFPVQMGGGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGG 349 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 G GG G G GG+ G GGGGG GG Sbjct: 386 GGGGGGGGGGGPMSGGLPPGFRPMGGGGGGGG 417 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGG-GXXXGXG 4 GG GP GG GGGGG G GGGG G G Sbjct: 315 GGGGPGGKKGGP--GGGGGNMGNQNQGGGGKNGGKGGG 350 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGG-GGGGXGXXG-XGGGGGXXXG 10 GG P G G + GG GG GGGG G GGGGG G Sbjct: 315 GGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNG 367 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG+G GG G G G GGGGG G G Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGG 138 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G G G GGG GG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGG 138 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/59 (32%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGG--GGGGXGXXGXGGGGGXXXGXG 4 G K G + + GG+ GG G GGGG G G GGGG G Sbjct: 321 GKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGG 379 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 410 GGGXGXXGGGXGXGGP 363 GGG G GGG G GGP Sbjct: 125 GGGGGGGGGGGGGGGP 140 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPPP P PPPP PP R P PP Sbjct: 22 PLPPPPPPPPPPMRRRAPLPPPP--PPPMRRRAPLPP 56 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +2 Query: 23 PPPPPXPXX---PXPPPPPPXNXPPXTXRGPRPP 115 PPPPP P P PPPPPP R P PP Sbjct: 41 PPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPP 74 Score = 35.1 bits (77), Expect = 0.077 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PP P PPPPPP PP R P PP Sbjct: 15 PPMRGRVPLPPPPPPP-PPPMRRRAPLPP 42 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXP--TXXPXGPPXP 114 PP PPPPP P PP P P PP P Sbjct: 26 PPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPP 59 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 3/20 (15%) Frame = +2 Query: 23 PPPPPXPXX---PXPPPPPP 73 PPPPP P PPPPPP Sbjct: 56 PPPPPAMRRRVLPRPPPPPP 75 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 561 LXPPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXPA 707 L PP P PP R P PPP P P PP PA Sbjct: 23 LPPPPPPPPPPMR----------RRAPLPPPPPPPMRRRAPLPPPPPPA 61 Score = 25.0 bits (52), Expect(2) = 4.3 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 376 PXPPPXXPXPPP 411 P PPP P PPP Sbjct: 22 PLPPPPPPPPPP 33 Score = 22.6 bits (46), Expect(2) = 4.3 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPL 573 P PPPP A P P P+ Sbjct: 26 PPPPPPPPMRRRAPLPPPPPPPM 48 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GRG R GG GGGGGG G G GGG G G G Sbjct: 114 GRG-RGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYG 148 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/53 (35%), Positives = 21/53 (39%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG ++A G G G G GGG G G GGGGG G G Sbjct: 87 GGGDAGSEAGSYAGSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGG 139 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G G GG G GGGGGG GG G Sbjct: 106 GSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGG 140 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G GG G G GGG GG Sbjct: 123 GGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGG 159 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/57 (36%), Positives = 23/57 (40%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G + A + G G R G GGGGG G G GGGGG G G Sbjct: 85 GGGGGDAGSEAGSYAGSHAGSGSGGRSGSGRGRGSGGGGGHG-GGGGGGGGRGGGGG 140 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GGR G GGG GG G G G GGG G G Sbjct: 108 GGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNG 144 Score = 33.5 bits (73), Expect = 0.24 Identities = 20/52 (38%), Positives = 22/52 (42%) Frame = -2 Query: 159 GSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GS + + R GRG G GGGGGG G G G G G G G Sbjct: 100 GSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRG-GGGGSGNGEGYGEG 150 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGG G G GGG G G Sbjct: 123 GGHGGGGGGGGG-RGGGGGSGNGEGYGEGGGYGGGYG 158 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXG 21 G G G +G GG G G G GG G Sbjct: 39 GIGAGIGIGIGIGGGGSGSGAGAGSGSGGGG 69 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGG G G GGG G G G Sbjct: 133 GGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGP-PXP 114 PP PPPPPP P PP PT P P P P Sbjct: 161 PPLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSP 193 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P PPPPP P P PPPP P P P P Sbjct: 161 PPLPPPPPPYP-SPLPPPPSPSPTPGPDSPLPSP 193 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/57 (29%), Positives = 19/57 (33%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P P P P P P P PP + P P + G DPP P Sbjct: 230 PGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPPLPSP 286 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P P P P P P P P P P P P + G D P P Sbjct: 165 PPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSP 221 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP P P P P +P + P P PP Sbjct: 202 PGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPP 234 Score = 29.1 bits (62), Expect = 5.1 Identities = 19/67 (28%), Positives = 21/67 (31%), Gaps = 10/67 (14%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP----------PPPXNXPPXTXRGPRPPXLXXRGXASAAGX 154 P P P P P P P P P PPP + P P P + G Sbjct: 202 PGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGP 261 Query: 155 DPPXLXP 175 D P P Sbjct: 262 DSPLPSP 268 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPP-PPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P P P P P P P + P + GP P Sbjct: 162 PLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSP-GPDSP 198 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/49 (44%), Positives = 23/49 (46%) Frame = -2 Query: 150 PAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 PA D GG G GG + GGGGGG G G G GGG G G Sbjct: 110 PANDRPSAPRAYGGGGGYSGGGGGY-GGGGGGYGGGGGGYGGGGDGGGG 157 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGG 644 GG +GG GG G GG G G G GGG Sbjct: 124 GGGYSGGG-GGYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG G GG G GG G G G GGG GG Sbjct: 123 GGGGYSGGGGGYGGGGGGYGGGG----GGYGGGGDGG 155 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G G GGGGGG G G GGGGG G G Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWG 96 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGGGG G G GGGGG G G Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWGGG 98 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GG G GG GGGGGG G G GGGGG Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGG 100 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GG G GG GGGGGG G G GGGGG Sbjct: 73 GGGGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 129 RXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 R GG G GG GGGGGG G GGGGG Sbjct: 66 RWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGG 101 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGGGG G G GGGG G G Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGWGWGGGG 99 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGGGG G G GGG G G G Sbjct: 73 GGGGGGGGGGGGGGGGGGGGWGWGGGGG 100 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 742 GXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 G GG GG G GG G G G GGG GG Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GG G GG GGGGGG G GGGGG Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGG 644 GG GG GG G GG G G G GGG Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG GGGGGG G G G GGG G Sbjct: 77 GGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGGGG G G GG G G G Sbjct: 74 GGGGGGGGGGGGGGGGGGGWGWGGGGGG 101 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGGGG G G G G G G G Sbjct: 75 GGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGGGG G G G GG G G Sbjct: 76 GGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGG G GGGG G G Sbjct: 74 GGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCG 110 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXG-GGGGXXXG 10 GG G GG GGGGGG G G GGGG G Sbjct: 82 GGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKG 117 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXR 629 GG GG GG G GG G G GGG G R Sbjct: 80 GGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGR 118 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 95 GXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G G GG GG GGGGGG G G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGG 98 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/62 (35%), Positives = 24/62 (38%), Gaps = 5/62 (8%) Frame = +2 Query: 5 PXPXXXPP-----PPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P P PP PPP P P PPPP PP + P P L + PP L Sbjct: 1056 PLPEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPL 1115 Query: 170 XP 175 P Sbjct: 1116 SP 1117 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Frame = +2 Query: 5 PXPXXXPPP----PPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPP PP P P PPPPP + PP P PP Sbjct: 1088 PSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = +2 Query: 5 PXPXXXPPP-PPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP PP P PPPPP PP +PP S PP Sbjct: 1074 PLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPP 1127 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 10 PXXPPXPP-PPPPXXXPPXTPPXEXPT 87 P PP PP PPP PP PP + T Sbjct: 1107 PSQPPPPPLSPPPSPPPPPPPPSQSLT 1133 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 864 PPRPPXPPXXTXXXXXXXXXXALXPXXXXPPPPGXXARXXXPP 992 PP PP PP L P PPPP PP Sbjct: 1081 PPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPP 1123 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/55 (40%), Positives = 24/55 (43%) Frame = -2 Query: 168 KXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 + GG D GRG GG + GGGG G G G GGGGG G G Sbjct: 564 RSGGRFGGRDFRREGSFGSGRGGYGGGGGGYGGGGGYGGGG-GYGGGGGYGGGYG 617 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGG-GGXGXXGXGGGGGXXXGXG 4 GG G GG + GGGG GG G G G GG G G Sbjct: 588 GGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYG 625 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G GG G G G A GG GG Sbjct: 592 GGYGGGGGYGGG-GGYGGGGGYGGGYGG-ASSGGYGG 626 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PPPP P PP PP E P P PP P Sbjct: 78 PLFPPPPLPRLPPPLLPPPEEPPREPPPPPPP 109 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPP 88 P PPP P P PPPPPP PP Sbjct: 90 PPLLPPPEEPPREPPPPPPPPEEPPP 115 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = +1 Query: 10 PXXPPXPPP--PPPXXXPPXTPPXE--XPTXXPXGPPXP 114 P PP P P PPP PP PP E P P PP P Sbjct: 78 PLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 35.5 bits (78), Expect = 0.058 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +2 Query: 5 PXPXXXPP---PPPXPXXPXPPPPPPXNXPP 88 P P PP PP P PPPPPP PP Sbjct: 84 PLPRLPPPLLPPPEEPPREPPPPPPPPEEPP 114 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPP P P P PPP P P PP Sbjct: 81 PPPPLPRLPPPLLPPPEEPPREPPPPPPPP 110 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP P PPP PP PP P P PP P Sbjct: 38 PLSPP-PSPPPSPSSPPRLPP-PFPALFPPEPPLP 70 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P P PP PP P P PPP PP R P PP L Sbjct: 58 PFPALFPPEPPLP--PRFELPPPLFPPPPLPRLP-PPLL 93 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPP-XTXRGPRPP 115 P PPP P P P PPP PP R P PP Sbjct: 71 PRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPP 106 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P PPP P P PP PP PP P P L Sbjct: 52 PPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRL 88 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 561 LXPPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 L PP P PP P PPP P P P PP P Sbjct: 62 LFPPEPPL-PPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPP 108 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 PPP P P PPP P P R P P Sbjct: 29 PPPLVFPLLPLSPPPSPPPSPSSPPRLPPP 58 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP 73 P P P PP P P PPPP Sbjct: 94 PPPEEPPREPPPPPPPPEEPPPP 116 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = +2 Query: 5 PXPXXXP--PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P P P P P P P P PP PP P P L R PP L Sbjct: 29 PPPLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPL 85 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PPP P PP P PP P P Sbjct: 81 PPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPP 116 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/57 (38%), Positives = 24/57 (42%), Gaps = 6/57 (10%) Frame = +2 Query: 11 PXXXPPPPPXPXXPX-----PPPPPPXNXPPXTXRGPRPPXL-XXRGXASAAGXDPP 163 P PPPPP P P PPPPPP P PP L +S+A PP Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPPLKKTAALSSSASKKPP 295 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/45 (33%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +2 Query: 23 PPPPPXPXXPX-----PPPPPPXNXPPXTXRGPRPPXLXXRGXAS 142 PPPPP P PPPPP + + P RG +S Sbjct: 259 PPPPPPPKLKNNGPSPPPPPPLKKTAALSSSASKKPPPAPRGSSS 303 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 3/60 (5%) Frame = +2 Query: 5 PXPXXXPP---PPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PP P P P PP P P P T P PP S+ DP L P Sbjct: 135 PKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLAP 194 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/49 (32%), Positives = 21/49 (42%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P P P PPP PP + PP P PP + +S+ PP + Sbjct: 29 PTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVI 77 Score = 37.5 bits (83), Expect = 0.014 Identities = 19/57 (33%), Positives = 23/57 (40%), Gaps = 4/57 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPX----PPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PP PP P PPPP + PP + P PP + A+ PP Sbjct: 35 PPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPP 91 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 5/58 (8%) Frame = +2 Query: 5 PXPXXXPPPP----PXPXXPXPPPPPPXNXPPXTXR-GPRPPXLXXRGXASAAGXDPP 163 P PPPP P P PP PP PP T P PP + S PP Sbjct: 50 PVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPP 107 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPP P PP P N PP P PP Sbjct: 110 PQTVSPPPPPDASPSPPAPTTTNPPPKP--SPSPP 142 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 PPP P P PP + PP P PP PP P Sbjct: 97 PPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETP 146 Score = 32.7 bits (71), Expect = 0.41 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 3/60 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXN---XPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPP PPP P PP T P PP A PP P Sbjct: 80 PPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSP 139 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P PP P PPP P + P T P PP Sbjct: 116 PPPPDASPSPPAPTTTNPPPKPSPSPPGET---PSPP 149 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T PP P P PP P +PP E P+ P P Sbjct: 129 TTTNPPPKPSPSPPGETP--SPPGETPSPPKPSPSTP 163 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +1 Query: 28 PPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PPPP PP + P + T P P P Sbjct: 172 PPPPATSASPPSSNPTDPSTLAPPPTPLP 200 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPPP P PPPPP + P P PP Sbjct: 313 PPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PPPPPP P PP P PP P Sbjct: 311 PPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 36.3 bits (80), Expect = 0.033 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PPPPPP PP P PP P Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPP 341 Score = 35.9 bits (79), Expect = 0.044 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPP P PPPPPP PP + P PP Sbjct: 303 PPPQKSIPPPPPPPP---PPLLQQPPPPP 328 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXP 85 P P PPPP PPPPPP P Sbjct: 317 PPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 5/35 (14%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 PPP P PPPPPP PP + P PP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPP 337 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 5/33 (15%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP-----PPPPXNXPP 88 P P PPPP P PP PPPP PP Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +2 Query: 35 PXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPPPPP PP + P PP + PP Sbjct: 303 PPPQKSIPPPPPP--PPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P PPPPPP PP + T P P P Sbjct: 25 PSPLPLPPPPPPPLKPPSS--GSATTKPPINPSKP 57 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +2 Query: 23 PPPPPX---PXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPPP P PPPPPP + + + R P Sbjct: 324 PPPPPSVSKAPPPPPPPPPPKSLSIASAKVRRVP 357 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 35 PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPPPP P +PP Sbjct: 25 PSPLPLPPPPPPPLKPPSSGSATTKPP 51 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGP 106 P P PPPPP P P P PP P Sbjct: 25 PSPLPLPPPPPPPLKP-PSSGSATTKPPINPSKP 57 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/32 (53%), Positives = 18/32 (56%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 G GG G VG + GG GG GGGGG GG Sbjct: 281 GVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGG 312 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/32 (53%), Positives = 18/32 (56%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 G GG G VG + GG GG GGGGG GG Sbjct: 349 GVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGG 380 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/32 (53%), Positives = 18/32 (56%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 G GG G VG + GG GG GGGGG GG Sbjct: 431 GVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGG 462 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GGRG GG GGG GG G GGGG G G Sbjct: 223 GGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVG 259 Score = 39.1 bits (87), Expect = 0.005 Identities = 38/153 (24%), Positives = 38/153 (24%) Frame = -1 Query: 1024 GGXPARVXAAXGGXXXRAXXPGGGGXXXXGXRAXXXXXXXXXGVXXGGXGGRGGXXXXXX 845 GG V A GG A GGGG G R G GG GG G Sbjct: 284 GGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVG 343 Query: 844 XXXXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXGGXAAGGAXGGXXAGXGGXGXXGXAXX 665 GG GG G A G G Sbjct: 344 GGVGGGVGGGVGGGVGGAVGGAVGGAVGGGG--GGSVGGGGRGSGGASGGASGGASGGAS 401 Query: 664 GEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 G A GG GG GG G GG Sbjct: 402 GGASGGASGGVGGAGGAGGSVGAGGGVGGGVGG 434 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G VG S GG GG G GGG GG G Sbjct: 277 GVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVG 311 Score = 38.3 bits (85), Expect = 0.008 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 2/59 (3%) Frame = -1 Query: 736 AAGGAXGG--XXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 A GGA GG AG G G G A G GGG GG GG G GG Sbjct: 515 AVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGAGGSTGGGAAGGGG 573 Score = 37.9 bits (84), Expect = 0.011 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 1/60 (1%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXG-XAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXG 569 G A GGA GG G GG G G G GGG GG G GG G G Sbjct: 50 GAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRG 109 Score = 37.1 bits (82), Expect = 0.019 Identities = 32/142 (22%), Positives = 34/142 (23%) Frame = -1 Query: 991 GGXXXRAXXPGGGGXXXXGXRAXXXXXXXXXGVXXGGXGGRGGXXXXXXXXXXXXXXXXX 812 GG R GGG G GG G GG Sbjct: 158 GGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGG 217 Query: 811 XXXXXRXXXXXXXXXXXXXXXXGGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGX 632 G + GG+ GG G GG G G A GGG GG Sbjct: 218 GTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGG 277 Query: 631 RXXXXXXXXXXGXGGXXXGXGG 566 GG G G Sbjct: 278 VGGGVGGGVGGSVGGAVGGAVG 299 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G VG GG GG G GGG GG G Sbjct: 345 GVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVG 379 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G VG GG GG G GGG GG G Sbjct: 427 GVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVG 461 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GGRG GG G GG G G GGG G G G Sbjct: 313 GGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGG 349 Score = 36.3 bits (80), Expect = 0.033 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG A GG GG AG G G G GGG GG G GG G GG Sbjct: 113 GGGAGGGVGGGVGAGGGAGGSVG-------AGGGIGGGAGGAIGGGASGGVGGGGKGRGG 165 Query: 565 XS 560 S Sbjct: 166 KS 167 Score = 36.3 bits (80), Expect = 0.033 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 G AGG GG GG G G G GGG GG GG G G Sbjct: 466 GSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVG 525 Score = 35.9 bits (79), Expect = 0.044 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = -1 Query: 742 GXAAGGAXGGXXAGXGGXGXXGXAXXGE--AXGGGXGGXRXXXXXXXXXXGXGGXXXGXG 569 G GG GG G GG G G G A GGG G G GG G G Sbjct: 62 GVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVG 121 Query: 568 G 566 G Sbjct: 122 G 122 Score = 35.9 bits (79), Expect = 0.044 Identities = 22/59 (37%), Positives = 22/59 (37%) Frame = -1 Query: 742 GXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 G A GGA GG G GG G G G GG G G GG G GG Sbjct: 441 GGAVGGAVGG-AVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGG 498 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GRG V G GG GG G G GGGGG G G Sbjct: 43 GRGSVGVGAGA-GGGASGGIGVGGGGGGGGGIGGSG 77 Score = 35.5 bits (78), Expect = 0.058 Identities = 24/60 (40%), Positives = 24/60 (40%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG GGA GG AG GG G G G A GG GG GG G GG Sbjct: 90 GGAIGGGASGG--AGGGGKG-RGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGG 146 Score = 35.5 bits (78), Expect = 0.058 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXG 569 GG AGG GG GG G G GG GG GG G G Sbjct: 122 GGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVG 180 Score = 35.1 bits (77), Expect = 0.077 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 1/60 (1%) Frame = -1 Query: 742 GXAAGGAXGGXXAGXGGXGXXGXA-XXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 G AGGA GG +G G G G G GGG GG G GG G G Sbjct: 86 GGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAG 145 Score = 35.1 bits (77), Expect = 0.077 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GGS G G GG GGGGG G G G GGG G G Sbjct: 453 GGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVG 509 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/57 (35%), Positives = 22/57 (38%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG + GG + GG G GGGG G G GGGG G G Sbjct: 66 GGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKG-RGRKGGGGAGGGVG 121 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G VG + GG GG G GGG G G Sbjct: 285 GVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGG 319 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 G GG G G GG GG GG GG GG Sbjct: 72 GIGGSGGVGAGGGVGGGAGGAIGGGASGGAGG 103 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = -2 Query: 168 KXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 + GG GG G GG GG GG G GG GG G G Sbjct: 110 RKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRG 164 Score = 34.3 bits (75), Expect = 0.13 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 1/60 (1%) Frame = -1 Query: 742 GXAAGGAXGGXXA-GXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 G AGGA GG + G GG G G GGG GG G GG GG Sbjct: 141 GGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGG 200 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G VG + GG GG G GGG G G Sbjct: 353 GVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGG 387 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G VG + GG GG G GGG G G Sbjct: 435 GVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGG 469 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGGGG G G GG G G G Sbjct: 59 GGIGVGGGGGGGGGIGGSGGVGAGGGVG 86 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXGXV 3 G G G G + GGV GG GGG GG G G + Sbjct: 159 GGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGI 195 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GGS A GG G V GG GG G G GG G G G Sbjct: 283 GGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAG 339 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG A GG G V GG GG GG G GGG G G Sbjct: 433 GGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGG 489 Score = 33.9 bits (74), Expect = 0.18 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 1/58 (1%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGG-XGXXGXGGGGGXXXGXG 4 G GG A GG G GG GG GGG G G GGG G G G Sbjct: 434 GGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGG 491 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 G G V GG GGG GG G G GGG G G Sbjct: 56 GASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAG 90 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GGA G G G G G GGG GG Sbjct: 82 GGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGG 118 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -1 Query: 745 GGXAAGGAXGG--XXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG A+GG GG G G G G G GGG GG Sbjct: 149 GGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGG 187 Score = 33.5 bits (73), Expect = 0.24 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 6/66 (9%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGG------XGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGX 584 GG GG GG G GG G G G GGG G GG Sbjct: 425 GGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGV 484 Query: 583 XXGXGG 566 G GG Sbjct: 485 GVGGGG 490 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG +GGA GG G G G G GG GG Sbjct: 463 GGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGG 499 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 111 GRGPRXVXGGXFXGG-GGGGXGXXGXGGGGGXXXGXG 4 G G R GG GG GG G G G GG G G G Sbjct: 509 GGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAG 545 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 G GG G +G S G GG GG GG GG Sbjct: 64 GGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGG 95 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG+ A GG R GG GGG GG G G GG G G Sbjct: 83 GGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGG 139 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/58 (34%), Positives = 22/58 (37%), Gaps = 1/58 (1%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXG-XGGGGGXXXGXG 4 G G A + GG + GG G GGGG G G GGG G G G Sbjct: 121 GGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGG 178 Score = 32.7 bits (71), Expect = 0.41 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 3/60 (5%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGG---RGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG A GG G GG GGGG G G G GG G G G Sbjct: 212 GASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAG 271 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -3 Query: 107 GGPXGXXVGXSXGGVXGGXXXG-GGGGGXGGXXG 9 GG G G + GG GG G GG GG GG G Sbjct: 390 GGASGGASGGASGGASGGASGGVGGAGGAGGSVG 423 Score = 32.7 bits (71), Expect = 0.41 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -1 Query: 742 GXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 G GGA GG G G G G G GG GG G GG G GG Sbjct: 437 GGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGG-GGGIGG 494 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG G GG GGGG G G G GG G Sbjct: 183 GGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGG 217 Score = 32.3 bits (70), Expect = 0.54 Identities = 42/166 (25%), Positives = 42/166 (25%), Gaps = 13/166 (7%) Frame = -1 Query: 1024 GGXPARVXAAXGGXXXRAXXPGGGGXXXXGXR------------AXXXXXXXXXGVXXGG 881 GG V A GG A GGGG G R A G GG Sbjct: 352 GGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGG 411 Query: 880 XGGRGGXXXXXXXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXGGXAAGGAXGGXXAG 701 GG GG GG GG G AG Sbjct: 412 VGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAG 471 Query: 700 XGGXGXXGXAXX-GEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 G G G G GGG GG G GG G G Sbjct: 472 GGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVG 517 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGG 25 G GG+ A GG G GG GGG G G G GGG Sbjct: 390 GGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGG 439 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -3 Query: 107 GGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXGXV 3 GG G G + GG GG GG GG G G V Sbjct: 394 GGASGGASGGASGGASGGVGGAGGAGGSVGAGGGV 428 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGG---GGGXXXGXG 4 G G G GGGGGG G G GG GGG G G Sbjct: 52 GAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAG 90 Score = 31.9 bits (69), Expect = 0.72 Identities = 21/61 (34%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXG-GXXXGXG 569 G +GG G G G G G G A GGG G R G G G G G Sbjct: 72 GIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAG 131 Query: 568 G 566 G Sbjct: 132 G 132 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GGRG V GG G G G G GGG G G Sbjct: 251 GGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVG 287 Score = 31.9 bits (69), Expect = 0.72 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG GG GG G G G G A G A GGG GG G GG Sbjct: 343 GGGVGGGVGGGVGGGVG--GAVGGAVGG-AVGGGGGGSVGGGGRGSGGASGGASGGASGG 399 Query: 565 XS 560 S Sbjct: 400 AS 401 Score = 31.5 bits (68), Expect = 0.95 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GGS G G G G GGG G G G GGG G G Sbjct: 303 GGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVG 359 Score = 31.5 bits (68), Expect = 0.95 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG+ A G G GG GG GGG G G GG G G Sbjct: 318 GGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGG 374 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXGXV 3 G G G G + GG GG G GG GG G V Sbjct: 376 GSVGGGGRGSGGASGGASGGASGGASGGASGGASGGV 412 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -3 Query: 107 GGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXGXV 3 GG G G + GGV G GG G GG G V Sbjct: 398 GGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGV 432 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG GG G G GG GG Sbjct: 501 GGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGG 537 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 742 GXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXR 629 G AGG GG G G G G A GGG G R Sbjct: 541 GGGAGGGVGGGANVGVGVGAGGSTGGGAAGGGGVGNRR 578 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -2 Query: 129 RXXXXGGRGPRXVXGGXFXGGGGGGX--GXXGXGGGGGXXXGXG 4 R GG V GG GGG GG G GGG G G G Sbjct: 108 RGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGG 151 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -2 Query: 129 RXXXXGGRGPRXVXGGXFXGGGGGG--XGXXGXGGGGGXXXGXG 4 R GG V GG GGG GG G G GGG G G Sbjct: 163 RGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAG 206 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/57 (33%), Positives = 21/57 (36%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG+ + A G G GG G GG G GGGGG G G Sbjct: 326 GGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGG 382 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGGG G G G GG G Sbjct: 367 GGAVGGGGGGSVGGGGRGSGGASGGASG 394 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 G GG+ + A GG G GG GG GGG G G GG G Sbjct: 468 GGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGG 522 Score = 30.7 bits (66), Expect = 1.7 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Frame = -2 Query: 159 GSXPAADAXPRXXXXGGRGPRXVXGGXFXGGG----GGGXGXXGXGGGGGXXXGXG 4 GS A+ GG G V GG GG GG G G GGG G G G Sbjct: 226 GSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGG 281 Score = 30.7 bits (66), Expect = 1.7 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 2/62 (3%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXG--GXRXXXXXXXXXXGXGGXXXGX 572 GG GG GG G G G A G GGG G G GG G Sbjct: 275 GGGVGGGVGGGVGGSVG--GAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGA 332 Query: 571 GG 566 GG Sbjct: 333 GG 334 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G G G G + GG GG G GG GG G Sbjct: 380 GGGRGSGGASGGASGGASGGASGGASGGASGGVGG 414 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GGRG GG G GG G G GG G Sbjct: 381 GGRGSGGASGGASGGASGGASGGASGGASGGVGGAGG 417 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXGXV 3 G GG G G + GGV GG G GGG G G V Sbjct: 485 GVGGGGGIG-GGAGGGVGGGVGGGVGGGVRGAVGGAV 520 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G V + GG GG GG G G GG G Sbjct: 503 GVGGGVGGGVRGAVGGAVGG-GVGGAGRGSGGASG 536 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG+ A GG R G GGG GG G G GG G G Sbjct: 138 GGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGG 194 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G G GG GG G GG GG G Sbjct: 373 GGGGSVGGG-GRGSGGASGGASGGASGGASGGASG 406 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/53 (35%), Positives = 21/53 (39%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG+ A + GG G GG G GG G GGGGG G G Sbjct: 413 GGAGGAGGSVGAGGGVGG-GVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGG 464 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXGXV 3 G GG G G GG+ GG G GGG GG G V Sbjct: 479 GAGGGVGVGGG---GGIGGGAGGGVGGGVGGGVGGGV 512 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 G S A GG G GG GGG G G G GGG G G Sbjct: 96 GASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAG-GSVGAGGGIGGGAG 145 Score = 29.9 bits (64), Expect = 2.9 Identities = 23/60 (38%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = -1 Query: 742 GXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXG-GXXXGXGG 566 G AGG+ G AG G G G A G A GG GG + G G G G GG Sbjct: 127 GGGAGGSVG---AGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGG 183 Score = 29.9 bits (64), Expect = 2.9 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G K GG A GG V G G GGGG G G GG G G Sbjct: 164 GGKSGGG--AGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGG 218 Score = 29.9 bits (64), Expect = 2.9 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXG-XXGXGGGGGXXXGXG 4 GG A GG G GG GG GG G G GG GG G G Sbjct: 199 GGGTVGAGGRGSGGASGGGGTVGA-GGRGSGGASGGVGVGGGAGGSGGGSVGGG 251 Score = 29.9 bits (64), Expect = 2.9 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGG--GGXGXXGXGGGGGXXXGXG 4 G G S A + GG V GG G GG GG GGGGG G G Sbjct: 323 GASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGG 381 Score = 29.9 bits (64), Expect = 2.9 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG+ A GG GG GG GG G G GGG G G G Sbjct: 382 GRGSGGASGGASGGASGGASGGASG-GASGGV--GGAGGAGGSVGAGGGVGGGVGGG 435 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G G G VG GG G GG G GG G Sbjct: 511 GVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAG 545 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 G GG+ A G G GG GG GGG G G GG G Sbjct: 314 GRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGG 368 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG+ A GG V G GG G G G G GGG G G Sbjct: 386 GGASGGASGGASGGASGGASGGASG-GVGGAGGAGGSVGAGGGVGGGVGGGVGGGVG 441 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GRG GG GGG GG G GGG G G Sbjct: 528 GRGSGGASGGAGAGGGAGG----GVGGGANVGVGVG 559 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G GG G GG G GGGGG G G Sbjct: 279 GGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGG 314 Score = 28.7 bits (61), Expect = 6.7 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = -1 Query: 745 GGXAAGG-AXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXG 569 GG GG GG G G G G G GG G G GG G G Sbjct: 154 GGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGG--RGSG 211 Query: 568 GXS 560 G S Sbjct: 212 GAS 214 Score = 28.7 bits (61), Expect = 6.7 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G S A+ GG V GG G GGG G G GG G G Sbjct: 319 GASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGG 375 Score = 28.7 bits (61), Expect = 6.7 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG + R G G G G GGG G G G GGG G G Sbjct: 450 GAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGI-GGGAGGGVGGGVG 505 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXG--GGGGXXXGXG 4 G G GG GG GG G G G G GG G G Sbjct: 198 GGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVG 235 Score = 28.3 bits (60), Expect = 8.9 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG A G G R G GG GG G G G GGG G G Sbjct: 228 GGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVG-AGGGLGGGVGGGVG 283 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGG-VXGGXXXGGGGGGXGGXXG 9 G GG G VG GG V GG GG GG G Sbjct: 491 GIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGG 526 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGG-VXG--GXXXGGGGGGXGGXXG 9 G GG G VG GG V G G GGG GG G G Sbjct: 495 GAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSG 532 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP PPPPPP PP P PP Sbjct: 505 PPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPP 541 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +2 Query: 5 PXPXXXPPPPPX---PXXPXPPPPPPXNXPPXTXRGPRP 112 P PPP P P P PPPP P PP T P P Sbjct: 622 PVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPP 660 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +2 Query: 23 PPPPPX---PXXPXPPPPPPXNXPPXTXRGPRP 112 PPP P P P PPPP P PP T P P Sbjct: 613 PPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPP 645 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXT--PPXEXPTXXPXGPPXP 114 P P PPPP P PP T PP P P P P Sbjct: 606 PQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSP 642 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXT--PPXEXPTXXPXGPPXP 114 P P PPPP P PP T PP P P P P Sbjct: 621 PPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSP 657 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 7/38 (18%) Frame = +2 Query: 23 PPPPPXPXX-------PXPPPPPPXNXPPXTXRGPRPP 115 PPPPP P PPPP P PP P PP Sbjct: 441 PPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPP 478 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP----XNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P PPPPP PP P PP + PP Sbjct: 476 PPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPP 532 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PP PP P PPPP P T + P PP Sbjct: 522 PPPPPPSPPPPCPESSPPPPVVYYAPVT-QSPPPP 555 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXT--PPXEXPTXXP---XGPPXP 114 P P PPPP P PP T PP P P PP P Sbjct: 636 PPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPP 675 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PPPP P PP P PP P Sbjct: 523 PPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSP 557 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +2 Query: 5 PXPXXXPPPPPX---PXXPXPPPPPPXNXPPXTXRGPRP 112 P PPP P P PPPP P PP T P P Sbjct: 547 PVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPP 585 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +2 Query: 5 PXPXXXPPPPP---XPXXPXPPPPPPXNXPPXTXRGPRP 112 P PPP P P PPPP P PP T P P Sbjct: 592 PVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPP 630 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +2 Query: 5 PXPXXXPPPPPX---PXXPXPPPPPPXNXPPXTXRGPRP 112 P PPP P P PPPP P PP T P P Sbjct: 562 PVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPP 600 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPP P P PPPP + PP PP Sbjct: 457 PPPPPPSPSPPPPYVYSSPPPPYVYSSPP 485 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPPP P PP PP P PP Sbjct: 451 PSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPP 487 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP-----PPPXNXPPXTXRGPRPP 115 P P PPPP PPP PPP PP P PP Sbjct: 459 PPPPSPSPPPPYVYSSPPPPYVYSSPPP---PPYVYSSPPPP 497 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXT--PPXEXPTXXPXGPPXP 114 P PPPP P PP T PP P P P P Sbjct: 576 PPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSP 612 Score = 30.7 bits (66), Expect = 1.7 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 5/62 (8%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP-----PPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P PPPP P PPP PPP PP P PP + PP Sbjct: 469 PYVYSSPPPPYVYSSPPPPPYVYSSPPP---PPYVYSSPPPPYVYSSPPPPYVYSSPPPP 525 Query: 170 XP 175 P Sbjct: 526 PP 527 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP--PPPPPXNXPPXTXRGPRPP 115 P P PPPP P PPPP P + P PP Sbjct: 532 PCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPP 570 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXP-PPXASPXXAXPXXPXPPXPA 707 PP P PP P P PP SP P P PP P+ Sbjct: 614 PPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPS 661 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 5/40 (12%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXT--PPXEXPTXXP---XGPPXP 114 P PPPP P PP T PP P P PP P Sbjct: 561 PPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPP 600 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPX---PPPPPPXNXPPXTXRGPRPPXL 121 P PPP P P PPPP P P T P P L Sbjct: 577 PVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPL 618 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 PPP PPPPP P PP + S PP Sbjct: 398 PPPIYVYSSPPPPPSSKMSPTVRAYSPPPPPSSKMSPSVRAYSPP 442 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 6/57 (10%) Frame = +2 Query: 23 PPPPPXPXXPX-----PPPPPPXNXPPXTXR-GPRPPXLXXRGXASAAGXDPPXLXP 175 PPPP P PPPPP P P PP + A PP P Sbjct: 408 PPPPSSKMSPTVRAYSPPPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSP 464 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG A A GG G GG G GG G G G GGGG G G Sbjct: 175 GGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGG 227 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG A GG G G GG G G G GGG G GG G GG Sbjct: 194 GGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGG 253 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 G + GG A GG G GG GG GGG G G GGGG Sbjct: 237 GGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGGG 287 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGG G GGGG G G Sbjct: 198 GGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYG 234 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GGA GG G GG G + GE GG GG Sbjct: 240 GGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGG 276 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G G S GG GG GGG GG G G Sbjct: 167 GGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGG 201 Score = 35.9 bits (79), Expect = 0.044 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG GG GG G G G G A GGG G GG G GG Sbjct: 168 GGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGG 227 Score = 35.9 bits (79), Expect = 0.044 Identities = 22/60 (36%), Positives = 23/60 (38%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG + GGA G G GG G G G A GGG G GG G GG Sbjct: 199 GGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSG-GGEGGGYGGGAAGGYGGGGGG 257 Score = 35.5 bits (78), Expect = 0.058 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG + GG G GG GGGG G G GGG G G G Sbjct: 190 GGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGG 246 Score = 35.5 bits (78), Expect = 0.058 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GGS A G G GG GGG G G G G GGG G G Sbjct: 196 GAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYG 252 Score = 35.5 bits (78), Expect = 0.058 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG +GG GG G G G GE GG GG GG G GG Sbjct: 231 GGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEH---GGGSGGGHGGGGGHGGGG 287 Score = 35.1 bits (77), Expect = 0.077 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG A GG G G G G G G G GG G GG G GG Sbjct: 117 GGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGG 176 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG + GGGGG G G G GG G G Sbjct: 153 GGAGASGYGGGAY-GGGGGHGGGGGGGSAGGAHGGSG 188 Score = 35.1 bits (77), Expect = 0.077 Identities = 24/63 (38%), Positives = 25/63 (39%), Gaps = 4/63 (6%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXG-GXGXXGXAXXGEAXG---GGXGGXRXXXXXXXXXXGXGGXXX 578 GG +AGGA GG G G G G G G A G GG GG GG Sbjct: 176 GGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGS 235 Query: 577 GXG 569 G G Sbjct: 236 GGG 238 Score = 35.1 bits (77), Expect = 0.077 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 G GGS GG G GG + GG GG G G GG GG Sbjct: 211 GGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGG 261 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXG 569 G GG GG G G G G G GGG GG G GG G G Sbjct: 205 GAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGG 263 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXG 569 G GG GG G G G + G GGG GG G GG G G Sbjct: 163 GAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGG 221 Score = 33.5 bits (73), Expect = 0.24 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG GG GG G G G G G G G GG G GG G G Sbjct: 185 GGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYG 244 Score = 33.5 bits (73), Expect = 0.24 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG+ A GG GG G GGGG G G GG G G G Sbjct: 216 GSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGG 272 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG + G G GG GGGG G G G GGG G G Sbjct: 226 GGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGG 282 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G GG GGGGGG G GG G G G Sbjct: 159 GYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEG 194 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG G GG + G GGG G G GGGGG G Sbjct: 253 GGGGGGEGGGGSYGGEHGGGSG-GGHGGGGGHGGG 286 Score = 32.3 bits (70), Expect = 0.54 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G S A GG G GG G G GG G G GGGG G G Sbjct: 152 GGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGG-GEGGGAGGGGSHGGAG 207 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/57 (31%), Positives = 20/57 (35%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG+ + GG G GG GGGGG G G G G G Sbjct: 88 GGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASG 144 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXG--GGXGG 635 GG AA AG GG G G A G A G GG GG Sbjct: 91 GGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGG 129 Score = 31.5 bits (68), Expect = 0.95 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 2/62 (3%) Frame = -1 Query: 745 GGXAAGGAXGGXXA-GXGGXGXXG-XAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGX 572 GG GG GG + G GG G GE GGG GG G GG Sbjct: 37 GGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAAS 96 Query: 571 GG 566 G Sbjct: 97 SG 98 Score = 31.5 bits (68), Expect = 0.95 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG A A G G G G GGG G G GGGG G Sbjct: 125 GGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAG 181 Score = 31.5 bits (68), Expect = 0.95 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGG--GGGXGXXGXGGGGGXXXGXG 4 GGS A G G G GGG GGG G G GGGG G Sbjct: 131 GGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHG 185 Score = 31.5 bits (68), Expect = 0.95 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGG--GGGXXXGXG 4 G GGS G G GG GG GGG G G GG GGG G G Sbjct: 181 GGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGG-GAYGGGGAHGGGYGSGGG 238 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGG-XGXXGXGGGGGXXXGXG 4 GG G V G + G GGG G G G GGG G Sbjct: 41 GGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEG 78 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GG G GGG G G GGG G G Sbjct: 54 GGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGG 90 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 G GG A + G G GG G GGG G G GGG G Sbjct: 84 GSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAG 138 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 2/59 (3%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXG--XGGGGGXXXGXG 4 G GG + GG G GGG G G G GGGGG G G Sbjct: 118 GHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGG 176 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GG GG G G GGG G G G Sbjct: 37 GGHGGGGGSGGVSSGGYGGESG-GGYGGGSGEGAGGG 72 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 G GG G G GG G GG G G GG Sbjct: 60 GYGGGSGEGAGGGYGGAEGYASGGGSGHGGGG 91 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 2/59 (3%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGG--GGGXXXGXG 4 G GG GG GG GGGGG G GG GGG G G Sbjct: 220 GGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHG 278 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G G GGV G G GGG GG G Sbjct: 35 GGGGHGG---GGGSGGVSSGGYGGESGGGYGGGSG 66 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = -1 Query: 742 GXAAGGAXGGXXA-GXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 G AGG GG GG G G A GG GG G GG Sbjct: 66 GEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGG 125 Query: 565 XS 560 S Sbjct: 126 GS 127 Score = 29.9 bits (64), Expect = 2.9 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGG--GGXXXGXG 4 G GG+ A GG G G G GGG G G GG GG G G Sbjct: 70 GGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSG 128 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -3 Query: 113 GXGGPXGXXVGXSX--GGVXGGXXXGGGGGGXGGXXG 9 G G G G S GG GG GGGGG G G Sbjct: 146 GNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGG 182 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G + GG GG GG GGGGGG G G G G Sbjct: 54 GGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGG 110 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 G GG GG G G G G GG G GG G GG Sbjct: 186 GSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGG 245 Score = 29.1 bits (62), Expect = 5.1 Identities = 22/60 (36%), Positives = 24/60 (40%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG GG+ G AG G G G A G + GG GG G GG G GG Sbjct: 58 GGGYGGGS--GEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGG-GGGYGG 114 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGGG G G GG G G Sbjct: 35 GGGGHGGGGGSGGVSSGGYGGESGGGYG 62 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/57 (28%), Positives = 17/57 (29%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG + G G G GGGGG G G G G G Sbjct: 55 GESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGG 111 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/51 (41%), Positives = 24/51 (47%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 G G+ + R GGRG GG + GGGGGG G G GG GG Sbjct: 79 GAPVQGNSGGGSSGGRGGFGGGRGGGRGSGGGY-GGGGGGYGGRGGGGRGG 128 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/49 (42%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -2 Query: 147 AADAXPRXXXXGGRGPRXVXGGXFXGGGGG-GXGXXGXGGGGGXXXGXG 4 A D GG G GG + GGGGG G G G GGGGG G Sbjct: 141 ARDCSEGGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGGGSCYSCG 189 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G R GG GG G G G G GGG G G G Sbjct: 89 GSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGG 125 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G GG G G G GGG GG Sbjct: 147 GGGGYGGG-GGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 33.9 bits (74), Expect = 0.18 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -2 Query: 141 DAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGX-GGGGGXXXGXG 4 D P GG G GG F GG GGG G G GGGGG G G Sbjct: 78 DGAPVQGNSGG-GSSGGRGG-FGGGRGGGRGSGGGYGGGGGGYGGRG 122 Score = 31.9 bits (69), Expect = 0.72 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 2/73 (2%) Frame = -3 Query: 578 GXRGXEXGXGXAAGX--GXGGGGRXXGPXXXXXXXXXXXXXXXXXXXXXXXXXGXXXRGG 405 G RG G G G G GGGGR G GG Sbjct: 103 GGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGGGGGYGGGG 162 Query: 404 GXGXXGGGXGXGG 366 G G GGG G GG Sbjct: 163 GYGGGGGGYGGGG 175 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -1 Query: 742 GXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 G + GG+ GG G GG G G G GGG GG Sbjct: 84 GNSGGGSSGG-RGGFGG-GRGGGRGSGGGYGGGGGG 117 Score = 29.1 bits (62), Expect = 5.1 Identities = 21/71 (29%), Positives = 22/71 (30%) Frame = -3 Query: 578 GXRGXEXGXGXAAGXGXGGGGRXXGPXXXXXXXXXXXXXXXXXXXXXXXXXGXXXRGGGX 399 G G G G +G G GGGG G GGG Sbjct: 95 GGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEG---GGGY 151 Query: 398 GXXGGGXGXGG 366 G GGG G GG Sbjct: 152 GGGGGGYGGGG 162 Score = 29.1 bits (62), Expect = 5.1 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 1/72 (1%) Frame = -3 Query: 578 GXRGXEXGXGXAAGXGXGG-GGRXXGPXXXXXXXXXXXXXXXXXXXXXXXXXGXXXRGGG 402 G RG G G G G GG GGR G GGG Sbjct: 99 GGRGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGY----GGG 154 Query: 401 XGXXGGGXGXGG 366 G GGG G GG Sbjct: 155 GGGYGGGGGYGG 166 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXP--XGPPXP 114 P PP PP PPP PP +PP P P PP P Sbjct: 412 PPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPP 448 Score = 36.3 bits (80), Expect = 0.033 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PPP PP P +PP P P PP P Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSP--PPSP 440 Score = 36.3 bits (80), Expect = 0.033 Identities = 21/55 (38%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPP--XNXPPXT--XRGPRPPXLXXRGXASAAGXDPP 163 P PPPPP PPPPP + PP + GP PP + G + A+ PP Sbjct: 441 PVYSPPPPPSIHYSSPPPPPVHHSSPPPPSPEFEGPLPPVI---GVSYASPPPPP 492 Score = 35.1 bits (77), Expect = 0.077 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PPPPP P P P PP + PP P PP S PP Sbjct: 406 PIVALPPPPPPSPPLPPPVYSPPPS-PPVFSPPPSPPVYSPPPPPSIHYSSPP 457 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PP P PPPP P PP P PP Sbjct: 403 PSPPIVALPPPPPPSPPLPPPVYSPPPSPP 432 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP SP + P PP P Sbjct: 418 PPLPPPVYSPPPSPPVFSPPPSP 440 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PP P PP P P+ PP P Sbjct: 428 PPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPP 459 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/58 (34%), Positives = 22/58 (37%), Gaps = 5/58 (8%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPPP P P PPPP + PP + P PP L PP Sbjct: 142 PPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPPVKSPPPP 199 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/60 (33%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P P PPPP P P PPPP + PP + P PP PP L Sbjct: 126 PPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYL 185 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/58 (32%), Positives = 22/58 (37%), Gaps = 5/58 (8%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPPP P P PPPP + PP + P PP + PP Sbjct: 46 PPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPP 103 Score = 37.5 bits (83), Expect = 0.014 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 5/58 (8%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPPP P P PPPP + PP + P PP PP Sbjct: 62 PPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPP 119 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 5/58 (8%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPPP P P PPPP + PP + P PP PP Sbjct: 78 PPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 135 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 5/58 (8%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPPP P P PPPP + PP + P PP PP Sbjct: 94 PPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 151 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 5/58 (8%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPPP P P PPPP + PP + P PP PP Sbjct: 110 PPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 167 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +2 Query: 23 PPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 PPPP P P PPPP PP + P PP PP Sbjct: 36 PPPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPP 87 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP PPPP PP P PP Sbjct: 45 PPPPVKSPPPPYEYKS-PPPPVKSPPPPYYYHSPPPP 80 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPP PPPP PP + P PP Sbjct: 30 PYYYSSPPPPYEYKSPPPPVKSPPPPYEYKSPPPP 64 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP PPP P P PP Sbjct: 173 PPPPVKSPPPPYLYSSPPPPVKSPPPPVYIYASPPPP 209 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/39 (51%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGG--GGGGXGXXGXGGGGGXXXGXG 4 GG G GG GG GGGG G G GGGGG G G Sbjct: 48 GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGG 86 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/39 (51%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGG--GXGXXGXGGGGGXXXGXG 4 GG G GG GGGGG G G G GGGGG G G Sbjct: 76 GGGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGGHHGGGG 114 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G G GG GGGGGG GG G Sbjct: 74 GYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGG 108 Score = 31.5 bits (68), Expect = 0.95 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 4/64 (6%) Frame = -1 Query: 745 GGXAAGGAXG-GXXAGXGGXGXXGXAXXGEAXGGG---XGGXRXXXXXXXXXXGXGGXXX 578 GG GG G G G GG G G G GGG GG G GG Sbjct: 51 GGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGGHH 110 Query: 577 GXGG 566 G GG Sbjct: 111 GGGG 114 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGG--XGXXGXGGGGGXXXGXG 4 GG G GG GGGGG G G GGGG G G Sbjct: 68 GGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGG 106 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG G G G G GGGGG G G Sbjct: 57 GGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGG 93 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXG 10 G GGG G G GGGGG G Sbjct: 42 GYGGGHGGHGGHGGGGGHGHG 62 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG P P G G GG GGGGGG G G G GGG G G Sbjct: 84 GGYPPLYGTTPPGGGDVGGGGGGYGGGT-PGGGGGGGGDTGAGAGGGGYGGGG 135 Score = 38.3 bits (85), Expect = 0.008 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGG-GXGXXGXGGGGGXXXGXG 4 GG P P G GG GGGGG G G G GGGGG G G Sbjct: 72 GGYPPLDGTTPTGGYPPLYGTTPPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAG 125 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGE-AXGGGXGG 635 GG GG GG G G G G G A GGG GG Sbjct: 96 GGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGG 133 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGG 644 GG GG G AG GG G G G G G Sbjct: 113 GGGGGGGGDTGAGAGGGGYGGGGDTGAGGGVGSG 146 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GG G G GGG GG G G GGG G Sbjct: 114 GGGGGGGDTGAGAGGGGYGGGGDTGAGGGVG 144 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = -1 Query: 745 GGXAAGGAXGG---XXAGXGGXGXXGXAXXGEAXGGGXG 638 GG GG GG AG GG G G G G G G Sbjct: 108 GGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGGVGSG 146 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 PPPPP P P PP P N P P R +A PP P Sbjct: 727 PPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPP 777 Score = 37.1 bits (82), Expect = 0.019 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PP PP P PPPP PP P PP G SA PP Sbjct: 708 PPPPPAPPAPPTPIVHTSSPPPPPPPPPP----PAPPTPQSNG-ISAMKSSPP 755 Score = 35.9 bits (79), Expect = 0.044 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PP PP +PP P P PP P Sbjct: 708 PPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTP 742 Score = 35.5 bits (78), Expect = 0.058 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PPPPPP T P P PP P Sbjct: 689 PPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTP 720 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPP---XPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPPP PPPPPP + GP P Sbjct: 770 PPPPTAPPPPPLGQTRAPSAPPPPPPKLGTKLSPSGPNVP 809 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 7/42 (16%) Frame = +2 Query: 11 PXXXPPP-------PPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPP P P P PPPPPP T P PP Sbjct: 670 PARSPPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPP 711 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 28 PPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PPPPPP P TP + P PP P Sbjct: 707 PPPPPPAPPAPPTPIVHTSSPPPPPPPPP 735 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPX---PPPPPPXNXPPXT 94 P P PPPPP PPPPPP P T Sbjct: 687 PRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPT 719 Score = 31.5 bits (68), Expect = 0.95 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 Query: 22 PXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PPPPPP + + P P PP P Sbjct: 687 PRPPPPPPPPPMQHSTVTKVPPPPPPAPPAP 717 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 9/44 (20%) Frame = +1 Query: 10 PXXPPXPPPPP---------PXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PPPPP P PP P P PP P Sbjct: 687 PRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPP 730 Score = 30.3 bits (65), Expect = 2.2 Identities = 22/71 (30%), Positives = 23/71 (32%), Gaps = 16/71 (22%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPX----------------PPPPPPXNXPPXTXRGPRPPXLXXRGX 136 P P PPPPP P P PP P + P P PP L Sbjct: 727 PPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRA 786 Query: 137 ASAAGXDPPXL 169 SA PP L Sbjct: 787 PSAPPPPPPKL 797 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 576 PXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXPA 707 P PP R PP PPP P PP PA Sbjct: 670 PARSPPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPA 713 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P P PPPPPP + P PP Sbjct: 674 PPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPP 710 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 7/42 (16%) Frame = +1 Query: 10 PXXPPXPP-------PPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PP PPP PP PP T P PP P Sbjct: 754 PPAPPAPPRLPTHSASPPPPTAPP--PPPLGQTRAPSAPPPP 793 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/68 (25%), Positives = 17/68 (25%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXPXPAA 546 PP P PPP P PP P PPPP A Sbjct: 727 PPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRA 786 Query: 547 XPXPXSXP 570 P P Sbjct: 787 PSAPPPPP 794 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/55 (30%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP--PPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P P P P PP PPPP P PP S +G + P Sbjct: 755 PAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPPPKLGTKLSPSGPNVP 809 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +3 Query: 561 LXPPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 L P P PP PP PP +P P PP P Sbjct: 686 LPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPP 733 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXR 130 P P PPPP PPPP + PP T P PP R Sbjct: 136 PPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITR 177 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PPPPP P PPP PP P PP + PP Sbjct: 56 PPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPP 108 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PPPPP P PPP PP P PP + PP Sbjct: 65 PPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPP 117 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PPPPP P PPP PP P PP + PP Sbjct: 92 PPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPP 144 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP----PPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PPPPP P PPP PPP PP P PP L + PP Sbjct: 119 PPVLLSPPPPPVLLSPPPPPVNLSPPP---PPVLLSPPPPPVLFSPPPPTVTRPPPP 172 Score = 35.1 bits (77), Expect = 0.077 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP----PPPXNXPPXTXRGPRPPXL 121 P PPPPP P PPP PPP PP P PP L Sbjct: 110 PPVNLSPPPPPVLLSPPPPPVLLSPPP---PPVNLSPPPPPVL 149 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPPP P PP PP R P PP Sbjct: 146 PPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPP 182 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +2 Query: 23 PPPPPXPXXPX-PPPPPPXNXPPXTXRGPRPP 115 PPPPP PPPPPP R P PP Sbjct: 194 PPPPPYKYGRVYPPPPPPPQAARSYKRSPPPP 225 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PPPPP PPP PP P PP + PP Sbjct: 38 PLVDLSPPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPP 90 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXN---XPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P P PPPPP N PP P PP + PP Sbjct: 34 PEPAPLVDLSPPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPP 81 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP PPPP P P PP Sbjct: 162 PPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPP 198 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P PPPP + P PP Sbjct: 161 PPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPP 197 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 4/30 (13%) Frame = +2 Query: 23 PPP----PPXPXXPXPPPPPPXNXPPXTXR 100 PPP PP P PPPPP P R Sbjct: 154 PPPVLFSPPPPTVTRPPPPPTITRSPPPPR 183 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 5/22 (22%) Frame = +2 Query: 23 PPPPPXPXXPX-----PPPPPP 73 PPPPP P PPPPPP Sbjct: 206 PPPPPPPQAARSYKRSPPPPPP 227 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PP PP P P PPPPPP P R PP Sbjct: 26 PPQPPPPPPPPPPPPPPRLGPRLRLRLLPPP 56 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPP P P P PPPPPP P PP Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGPRLRLRLLPP 55 Score = 33.9 bits (74), Expect = 0.18 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPP 72 P PP PPPPPP PP P Sbjct: 26 PPQPPPPPPPPPPPPPPRLGP 46 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXP 84 PP PPPPP PP PP P Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGP 46 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = +2 Query: 23 PPPPPXPXX------PXPPPPPPXNXPPXTXRGPRPPXLXXR 130 PPPPP P PPP PP PP P PP L R Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPPPP--PPPPRLGPR 47 Score = 30.3 bits (65), Expect = 2.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PPP P PPP Sbjct: 26 PPQPPPPPPPPPPPP 40 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 370 PXPXPPPXXPXPPPR 414 P P PPP P PPPR Sbjct: 29 PPPPPPPPPPPPPPR 43 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP P PP PP + P P PP P Sbjct: 9 PPPPLPPRLELRRQRAPPPQPPPPPPPPPPPP 40 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/47 (42%), Positives = 21/47 (44%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 G S + R GG G GG GGG GG G G GGGGG Sbjct: 88 GNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGG 134 Score = 35.5 bits (78), Expect = 0.058 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGG 22 GG + GGGGGG G GGGGG Sbjct: 155 GGGYSGGGGGGRYGSGGGGGGG 176 Score = 35.1 bits (77), Expect = 0.077 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -1 Query: 742 GXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 G + GG G G GG G G G + GGG GG Sbjct: 88 GNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGG 123 Score = 32.7 bits (71), Expect = 0.41 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = -2 Query: 141 DAXPRXXXXGGRGPRXVXGGXFXGGG-GGGXGXXGXGGGGGXXXGXG 4 D P GG G GG GGG GGG G GGG G G Sbjct: 82 DGAPVQGNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGG 128 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -2 Query: 132 PRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 P+ G V G GG GG G G GGG G G G Sbjct: 73 PKAIEVSGPDGAPVQGNSGGGGSSGGRGGFGGGGGRGGGRGGG 115 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG GGGGG G G GGGGG G Sbjct: 154 GGGGYSGGGGG-GRYGSGGGGGGGGG 178 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GGRG GG G GGG G G G G G G Sbjct: 97 GGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGG 133 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXG-GXGXXGXAXXGEAXGGG 644 GG GG GG G G G G G GGG Sbjct: 100 GGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGG 134 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 83 GXSXGGVXGGXXXGGGGGGXGGXXG 9 G S GG GG G GGGG GG G Sbjct: 157 GYSGGG--GGGRYGSGGGGGGGGGG 179 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG F GGGGGG G G GG G G G Sbjct: 189 GGSFGGGGGGGAGSYGGGGAGAGSGGGG 216 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G +G R GG GGGGGG GGG G G G Sbjct: 179 GRQGSRYGGGGGSFGGGGGGGAGSYGGGGAGAGSGGG 215 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -2 Query: 156 SXPAADAXPRXXXXGGRGPRXVXGGXFXGGG-GGGXGXXGXGGGGG 22 S P+ D + GG G GG G GGG G GGGGG Sbjct: 172 SLPSFDQGRQGSRYGGGGGSFGGGGGGGAGSYGGGGAGAGSGGGGG 217 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -1 Query: 730 GGAXGGXXAGXGGXGXXGXAXXGEAXGGGXG 638 GG+ GG G GG G G G GGG G Sbjct: 189 GGSFGG--GGGGGAGSYGGGGAGAGSGGGGG 217 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 104 GPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G G G GG G GG G G GG G Sbjct: 186 GGGGGSFGGGGGGGAGSYGGGGAGAGSGGGGG 217 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG GG GG G GG G G G GG GG G G GG Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGG 181 Score = 36.3 bits (80), Expect = 0.033 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG + GGGGG G G GGG G G G Sbjct: 127 GGGYGGGGGGYGGSGGYGGGAGGYGGSG 154 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G GG + G GG G G G GG GG G G Sbjct: 126 GGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAG 161 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG F GGGG G G G GG GG G G Sbjct: 122 GGGF-GGGGYGGGGGGYGGSGGYGGGAG 148 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 107 GGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 GG G G GG G GGG GG GG G Sbjct: 123 GGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGG 155 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG G G + GG GG G G GGG G G Sbjct: 131 GGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGG 165 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G G GG G GGG GG GG G Sbjct: 136 GYGGSGGY--GGGAGGYGGSGGYGGGAGGYGGNSG 168 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG + GG G G GG G G GG GG Sbjct: 164 GGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGG 200 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG G G + G GG G G G GG G G Sbjct: 138 GGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYG 172 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG + GG GG G G G GG G G Sbjct: 145 GGAGGYGGSGG-YGGGAGGYGGNSGGGYGGNAAGGYG 180 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGG-GGXGXXGXGGGG-GXXXGXG 4 GG G GG G GG GG G G G GG G G G Sbjct: 132 GGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGG 170 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXG---GXXXGGGGGGXGG 18 G GG G G S GG G G G G GG GG Sbjct: 155 GYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGG 189 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -2 Query: 114 GGRGPRXVXGGXFXG-GGGGGXGXXGXGGGGGXXXGXG 4 GG G GG G GG GG G G GG G G Sbjct: 135 GGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYG 172 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRG 133 PPPPP P PPPPPP P P PP + G Sbjct: 231 PPPPPPPHQAQPPPPPPSGLFP-----PPPPPMANNG 262 Score = 35.9 bits (79), Expect = 0.044 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP 73 P P PPPP P PPPPPP Sbjct: 235 PPPHQAQPPPPPPSGLFPPPPPP 257 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPP----PPPXNXPPXTXRGPRP 112 P PPPP P PPP PPP PP G RP Sbjct: 230 PPPPPPPPHQAQPPPPPPSGLFPPP--PPPMANNGFRP 265 Score = 31.9 bits (69), Expect = 0.72 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPP 72 PP PPPPP PP PP Sbjct: 230 PPPPPPPPHQAQPPPPPP 247 Score = 31.5 bits (68), Expect = 0.95 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXN 79 P PPPPP P PPPP N Sbjct: 237 PHQAQPPPPPPSGLFPPPPPPMANN 261 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGP 105 P PPPPP PP PP P P Sbjct: 237 PHQAQPPPPPPSGLFPPPPPPMANNGFRPMPP 268 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP PP P PPPP P + PP P PP Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPS-PPKKSYCPPPP 127 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PPP PP PP PP P PP P Sbjct: 86 PCLQNIPPPSPP---PPSPPPPSQACPPPPLPPSP 117 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/32 (50%), Positives = 17/32 (53%), Gaps = 4/32 (12%) Frame = +2 Query: 5 PXPXXXPPPPPXPXX----PXPPPPPPXNXPP 88 P P PPPPP P PPPPPP + PP Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPPPPHLPP 73 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 35 PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P PPPPPP + P PP Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPPP 68 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 22 PXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PPPPPP PP P P PP P Sbjct: 42 PHPPPPPP---PPPPPLYFSYFSLPPPPPPP 69 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 4/29 (13%) Frame = +1 Query: 10 PXXPPXPPPPP----PXXXPPXTPPXEXP 84 P PP PPPPP PP PP P Sbjct: 44 PPPPPPPPPPPLYFSYFSLPPPPPPPHLP 72 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPP-----PPXNXPPXTXRGPRPP 115 P PP PP P PPP PP N PP T P PP Sbjct: 44 PATSPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPP 83 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/57 (33%), Positives = 23/57 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P PPP P PPP PP + PP P PP ++ G D P + P Sbjct: 61 PPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPPQSTPTG-DSPVVIP 116 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P P PPP PP PP PP T PP + Sbjct: 52 PSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSI 90 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P P P PP P P TP + P P P Sbjct: 88 PSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKP 120 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 T P PP P PPP P P P P PP Sbjct: 91 TPPPSPP-QPQPPPQSTPTGDSPVVIPFPKPQLPP 124 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/53 (39%), Positives = 23/53 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P P PPPP + P + PRPP G A A D P Sbjct: 394 PPGSGGPKPPPPPGPKGPRPPPPMSLGP---KAPRPP----SGPADALDDDAP 439 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 3/34 (8%) Frame = +2 Query: 23 PPPPPXPXXPX---PPPPPPXNXPPXTXRGPRPP 115 PPP P P P PP PPP PP + GP+PP Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSG-GPKPP 403 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNX-----PPXTXRGPRPP 115 P P P P P PP PPP + PP +GPRPP Sbjct: 373 PVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPP 414 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PP P P PPP + PP R P PP Sbjct: 160 PPRPPTRPKSPPPRKSSFPP--SRSPPPP 186 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP P PPP P PP P PP P Sbjct: 385 PPRPPPPAPPPGSGGPKPPPP---PGPKGPRPPPP 416 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +3 Query: 636 PPXPPPXASPXXA-XPXXPXPPXP 704 PP PPP A P + P P PP P Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGP 408 Score = 25.0 bits (52), Expect(2) = 3.3 Identities = 10/17 (58%), Positives = 10/17 (58%), Gaps = 2/17 (11%) Frame = +1 Query: 367 PPXPXPPP--XXPXPPP 411 PP P PPP P PPP Sbjct: 388 PPPPAPPPGSGGPKPPP 404 Score = 23.0 bits (47), Expect(2) = 3.3 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +1 Query: 514 RPPPPXPXPAAXPXPXSXP 570 RPPPP P P S P Sbjct: 412 RPPPPMSLGPKAPRPPSGP 430 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/53 (39%), Positives = 23/53 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P P PPPP + P + PRPP G A A D P Sbjct: 394 PPGSGGPKPPPPPGPKGPRPPPPMSLGP---KAPRPP----SGPADALDDDAP 439 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 3/34 (8%) Frame = +2 Query: 23 PPPPPXPXXPX---PPPPPPXNXPPXTXRGPRPP 115 PPP P P P PP PPP PP + GP+PP Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSG-GPKPP 403 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNX-----PPXTXRGPRPP 115 P P P P P PP PPP + PP +GPRPP Sbjct: 373 PVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPP 414 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PP P P PPP + PP R P PP Sbjct: 160 PPRPPTRPKSPPPRKSSFPP--SRSPPPP 186 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP P PPP P PP P PP P Sbjct: 385 PPRPPPPAPPPGSGGPKPPPP---PGPKGPRPPPP 416 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +3 Query: 636 PPXPPPXASPXXA-XPXXPXPPXP 704 PP PPP A P + P P PP P Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGP 408 Score = 25.0 bits (52), Expect(2) = 3.3 Identities = 10/17 (58%), Positives = 10/17 (58%), Gaps = 2/17 (11%) Frame = +1 Query: 367 PPXPXPPP--XXPXPPP 411 PP P PPP P PPP Sbjct: 388 PPPPAPPPGSGGPKPPP 404 Score = 23.0 bits (47), Expect(2) = 3.3 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +1 Query: 514 RPPPPXPXPAAXPXPXSXP 570 RPPPP P P S P Sbjct: 412 RPPPPMSLGPKAPRPPSGP 430 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRG 133 P PPPPP P PPPP P P R P + RG Sbjct: 85 PASPQPPPPPPIENLPPPPPPLPKFSPSPIKRAISLPSMAVRG 127 Score = 23.8 bits (49), Expect(2) = 5.6 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 517 PPPPXPXPAAXPXP 558 PPPP P P P P Sbjct: 100 PPPPPPLPKFSPSP 113 Score = 23.4 bits (48), Expect(2) = 5.6 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 P P PPP PPP Sbjct: 88 PQPPPPPPIENLPPP 102 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP P PP PP + PT P PP Sbjct: 28 PSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPP 60 Score = 36.7 bits (81), Expect = 0.025 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P PP P PP PP + P+ P PP P Sbjct: 36 PIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTP 70 Score = 36.3 bits (80), Expect = 0.033 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 PP PP P PP PP PT P PP Sbjct: 43 PPTQPPSQPPTQPPTQPPSHPPTQPPTPPP 72 Score = 35.9 bits (79), Expect = 0.044 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP P P PP PP + PT P PP Sbjct: 32 PSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPP 64 Score = 35.5 bits (78), Expect = 0.058 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP P PP PP + PT P P Sbjct: 44 PTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSP 76 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGP-PXP 114 P PP PP P PP PP P+ P P P P Sbjct: 48 PSQPPTQPPTQPPSHPPTQPPTPPPSQSPSQPSPLP 83 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP P PP PP + P+ PP Sbjct: 52 PTQPPTQPPSHPPTQPPTPPPSQSPSQPSPLPP 84 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P PP P P PP P + PP P P Sbjct: 39 PSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPP 72 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXP 689 P P PP PP PPP SP P P Sbjct: 44 PTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSPSQPSPLPP 84 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGP 106 P P PPPPP P PPPP PP P Sbjct: 106 PPPAITPPPPPAITPPLSPPPPAITPPPPLATTP 139 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Frame = +2 Query: 23 PPPPPXPXXPXPPP----PPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 PPP P P P PP PP + PP + PP + A PP L P Sbjct: 45 PPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSP 99 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P PPPPP P PP P PP P PP L A PP L P Sbjct: 100 PQTTPPPPPAITPPPPPAITPPLSPPPPAITP-PPPLATTPPALPPKPLPPPLSP 153 Score = 35.1 bits (77), Expect = 0.077 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXP 96 T P P PPPPP PP +PP T P Sbjct: 103 TPPPPPAITPPPPPAITPPLSPPPPAITPPP 133 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 PPPP P P PP PP P P PP A PP L P Sbjct: 44 PPPPQP-DPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVAT--TPPALPP 90 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PPPP P TPP P PP P Sbjct: 96 PLSPPQTTPPPP---PAITPPPPPAITPPLSPPPP 127 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 T P PP P PPP P TPP P PP Sbjct: 138 TPPALPPKPLPPP-LSPPQTTPPPPPAITPPLSPP 171 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P P PPP P P PPPP PP P P L Sbjct: 256 PSPTISPPPLP-PQTLKPPPPQTTPPPPPAITPPLSPPL 293 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +1 Query: 19 PPXPPPP-PPXXXPPXTPPXEXPTXXPXGPP 108 P PP P PP PP T P P P PP Sbjct: 86 PALPPKPLPPPLSPPQTTPPPPPAITPPPPP 116 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXP--XPPPP-PPXNXPPXTXRGPRP 112 P P PPPP P PP P PP PP T P P Sbjct: 124 PPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPPP 162 Score = 31.9 bits (69), Expect = 0.72 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPP 72 P P PPPPP PP +PP Sbjct: 272 PPPPQTTPPPPPAITPPLSPP 292 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 PPPPP P PPPP P + P PP A+ PP Sbjct: 31 PPPPPCICICNPGPPPPQPDP----QPPTPPTFQPAPPANDQPPPPP 73 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 22 PXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PPPP P PP TPP P P P Sbjct: 42 PGPPPPQPDPQPP-TPPTFQPAPPANDQPPP 71 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P PPP P PPPP PP P P PP L P Sbjct: 90 PKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPP 144 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/58 (29%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGP-RPPXLXXRGXASAAGXDPPXLXP 175 P PPPPP P P P PP P PP + PP + P Sbjct: 63 PPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITP 120 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PPP P PPPP PP Sbjct: 254 PGPSPTISPPPLPPQTLKPPPPQTTPPP 281 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPP-PXNXPPXTXRGPRPPXL 121 P P PPPP P PP P P P P PP + Sbjct: 125 PPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPPPAI 164 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P P PP P PPPP + PP P P S PP Sbjct: 54 PTPPTFQPAPPANDQP-PPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPP 105 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPX-PPPP-PPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P PP P PP PP T P P A PP Sbjct: 71 PPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPP 125 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/47 (31%), Positives = 15/47 (31%), Gaps = 1/47 (2%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXP-XPPXP 704 PP P PP PP PP SP P PP P Sbjct: 46 PPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKP 92 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +2 Query: 5 PXPXXXPPP--PPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P P PP PP P P PP PP P P L Sbjct: 132 PPPLATTPPALPPKPLPPPLSPPQTTPPPPPAITPPLSPPL 172 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P P PPP PP PP P P PP Sbjct: 70 PPPPQSTSPPPVATTPPALPP--KPLPPPLSPP 100 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +3 Query: 864 PPRPPXPPXXTXXXXXXXXXXALXPXXXXPPPPGXXARXXXPPXAAXTRAGXPP 1025 PP P PP T AL P PPP + PP A T PP Sbjct: 120 PPLSPPPPAITPPPPLATTPPALPPKPL--PPPLSPPQTTPPPPPAITPPLSPP 171 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P PP PP PP P PP Sbjct: 254 PGPSPTISPPPLPPQTLKPPPPQTTPPPP 282 Score = 25.0 bits (52), Expect(2) = 2.1 Identities = 12/27 (44%), Positives = 12/27 (44%), Gaps = 2/27 (7%) Frame = +1 Query: 505 PXXRPPPPXPX--PAAXPXPXSXPLXP 579 P PPPP PA P P PL P Sbjct: 127 PAITPPPPLATTPPALPPKPLPPPLSP 153 Score = 23.8 bits (49), Expect(2) = 2.1 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP PPP PPP Sbjct: 120 PPLSPPPPAITPPPP 134 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPPP P PPPP PP GP+ P Sbjct: 9 PPPPPPPPPRLLVLPPLPPPPPPPPPQLPFGPKLP 43 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 630 RXPPXPPPXASPXXAXPXXPXPPXP 704 R PP PPP P P PP P Sbjct: 7 RRPPPPPPPPPRLLVLPPLPPPPPP 31 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/39 (48%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGG--XGXXGXGGGGGXXXGXG 4 GG G R GG + GGGGG G GGGGG G G Sbjct: 91 GGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGG 129 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/39 (48%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGG--GGGXXXGXG 4 GG G R GG + GGGGG G GG GGG G G Sbjct: 119 GGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGG 157 Score = 35.5 bits (78), Expect = 0.058 Identities = 19/39 (48%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGG--GGXGXXGXGGGGGXXXGXG 4 GG G R GG + GGGG GG G GGGG G G Sbjct: 99 GGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGG 137 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG + GGGG G G GGGG G Sbjct: 106 GGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRG 142 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/28 (57%), Positives = 17/28 (60%) Frame = -2 Query: 105 GPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 G R GG + GG GGG G G GGGGG Sbjct: 150 GGRREGGGGYGGGEGGGYG--GSGGGGG 175 Score = 32.3 bits (70), Expect = 0.54 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGG---GGGGXGXXGXGGGGGXXXGXG 4 GG R GG + GG GGGG G G GGG G G G Sbjct: 136 GGYSSRGGGGGSYGGGRREGGGGYG-GGEGGGYGGSGGGG 174 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG + GG GG G GG G GGG G G GG G GG Sbjct: 114 GGGSYGGG-GGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGG 172 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 G + GG + GG G GG GGGG G G G GG G G Sbjct: 123 GRREGGGGYSGGGGGYSSRGGGGGS--YGGGRREGGGGYGGGEGGGYGGSGGGGG 175 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -2 Query: 114 GGRGPRXVXGGXFX-GGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGG G GGGG G G Sbjct: 127 GGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEG 164 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXG 638 G GG GG G G G + G + GGG G Sbjct: 88 GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGG 123 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 69 GGGGGXGXXGXGGGGGXXXGXG 4 G GGG G G GGGG G G Sbjct: 88 GSGGGGGHRGGGGGGYRSGGGG 109 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/57 (31%), Positives = 22/57 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPP P P PPP + PP + P PP + A + P P Sbjct: 85 PPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPP 141 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P PPPPP PP + P P Sbjct: 61 PPPTVSSPPPP-PLDSSPPPPPDLTPPPSSPPPPDAP 96 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/51 (37%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP-PPPPXNXPPXTXR---GPRPPXLXXRGXASA 145 P PPPPP PP PPPP PP GP+ P G A++ Sbjct: 120 PPEVFEPPPPPADEDESPPAPPPPEQLPPPASSPQGGPKKPKKHHPGPATS 170 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP-----PPPXNXPPXTXRGPRPPXL 121 P P PPP P PPP PP PP T P PP L Sbjct: 30 PPPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPL 73 Score = 35.5 bits (78), Expect = 0.058 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PPPP P P PPP + PP Sbjct: 70 PPPLDSSPPPPPDLTPPPSSPPPPDAPP 97 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP--PPPPXNXPPXTXRGPRP 112 P P PPP P PP PPPP PP P P Sbjct: 69 PPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPP 106 Score = 32.3 bits (70), Expect = 0.54 Identities = 20/59 (33%), Positives = 22/59 (37%), Gaps = 6/59 (10%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPP--PPXN----XPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PP P P P PP PP N PP + P RG S+ PP Sbjct: 165 PGPATSPPAPSAPATSPPAPPNAPPRNSSHALPPKSTAAGGPLTSPSRGVPSSGNSVPP 223 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP--PPPPXNXPPXTXRGPRP 112 P PPPP P PP PPP + PP P P Sbjct: 63 PTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIP 100 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +1 Query: 19 PPXPP----PPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PP PPPP P TPP P PP P Sbjct: 68 PPPPPLDSSPPPP---PDLTPPPSSPPPPDAPPPIP 100 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/57 (29%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP----PPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P P PPPPP + P P L + G P Sbjct: 104 PPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPPEQLPPPASSPQGGPKKP 160 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXP-----PPPPPXNXPPXTXRGPRPP 115 P PPP P P PPPPP PP + P PP Sbjct: 56 PAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPS--SPPPP 93 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/59 (30%), Positives = 19/59 (32%), Gaps = 4/59 (6%) Frame = +2 Query: 11 PXXXPPPPPXPXXPX----PPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P PPP P P PPP PP P PP +S D P P Sbjct: 42 PADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIP 100 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/67 (25%), Positives = 17/67 (25%) Frame = +1 Query: 370 PXPXPPPXXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXPXPAAX 549 P P PPP P P P G PPPP P P Sbjct: 280 PSPPPPPPPPPPLPAFYNSSSRKDHPGIYRVERRESSVHKTKFAGGEFHPPPPPPPPPPV 339 Query: 550 PXPXSXP 570 S P Sbjct: 340 EYYKSPP 346 Score = 28.3 bits (60), Expect(2) = 0.014 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 10 PXXPPXPPPPPP 45 P PP PPPPPP Sbjct: 280 PSPPPPPPPPPP 291 Score = 28.3 bits (60), Expect(2) = 0.014 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPP 72 PP PPPPPP +PP Sbjct: 329 PPPPPPPPPPVEYYKSPP 346 Score = 25.8 bits (54), Expect(2) = 1.6 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPP 70 P P P P P PPPPP Sbjct: 270 PIPNLASEFHPSPPPPPPPPPP 291 Score = 23.4 bits (48), Expect(2) = 1.6 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +2 Query: 56 PPPPPPXNXPPXTXRGP 106 PPPPPP P + P Sbjct: 329 PPPPPPPPPPVEYYKSP 345 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +2 Query: 5 PXPXXXPPPPP-XPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PPPPP P PPPPP PP P P Sbjct: 69 PPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTP 105 Score = 35.5 bits (78), Expect = 0.058 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PPPPP P PPP PP P P Sbjct: 82 PPPIYSPPPPPIYPPPIYSPPPTPISPPPKVHHPAP 117 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/28 (50%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Frame = +2 Query: 11 PXXXPPPPPXPXXPX--PPPPPPXNXPP 88 P PPPPP P PPPPP + PP Sbjct: 50 PVTIPPPPPVYSRPVAFPPPPPIYSPPP 77 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P PPPPP PPPPP P P P Sbjct: 38 PIYSPPPPPYRSPVTIPPPPPVYSRPVAFPPPPP 71 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P PPPPP PPPPP PP P P Sbjct: 63 PVAFPPPPPI----YSPPPPPIYPPPIYSPPPPP 92 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 31 PPPPPXXXPPXTPPXEXPTXXPXGPP 108 PPPPP PP P P P PP Sbjct: 67 PPPPPIYSPPPPPIYPPPIYSPPPPP 92 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXP---XGPPXP 114 P P PPPPP PP P P P PP P Sbjct: 68 PPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTP 105 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PPPP P PP P P PP Sbjct: 67 PPPPPIYSPPPPPIYP---PPIYSPPPPPIYPP 96 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/41 (43%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +2 Query: 5 PXPXXXPPPPPX-PXXPXPPPPPP-XNXPPXTXRGPRPPXL 121 P P PPP P P PPPPPP + PP + PP L Sbjct: 49 PSPSMSPPPSPSLPLSSSPPPPPPHKHSPPPLSQSLSPPPL 89 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P PPPP P PPP PP PP R + PP L P Sbjct: 62 PLSSSPPPPPPHKHSPPPLSQSLSPPPLITVIHPP--PPRFYYFESTPPPPPLSP 114 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/53 (30%), Positives = 20/53 (37%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P PPP P PPP P + P + P PP S + PP + Sbjct: 39 PTICSPPPSKPSPSMSPPPSP-SLPLSSSPPPPPPHKHSPPPLSQSLSPPPLI 90 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPPP PPPPPP P R P PP Sbjct: 28 PLPPPPPPPLMRRRAPPPPPP---PLMRRRAPPPP 59 Score = 35.9 bits (79), Expect = 0.044 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPR 109 PPPPP PPPPPP P R P+ Sbjct: 45 PPPPPLMRRRAPPPPPPPPLPRPCSRPPK 73 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = +2 Query: 23 PPPPPX--PXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 PPPPP P PPPPPP P R P PP + PP L Sbjct: 17 PPPPPLMRRRAPLPPPPPP---PLMRRRAPPPPPPPLMRRRAPPPPPPPPL 64 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 4/25 (16%) Frame = +2 Query: 23 PPPPPXPXX----PXPPPPPPXNXP 85 PPPPP P P PPPPPP P Sbjct: 43 PPPPPPPLMRRRAPPPPPPPPLPRP 67 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 PP P R PP PPP A P P PP P Sbjct: 20 PPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLP 65 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 5/36 (13%) Frame = +1 Query: 22 PXPPPPPPXXX-----PPXTPPXEXPTXXPXGPPXP 114 P PPPPPP PP PP P PP P Sbjct: 28 PLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPP 63 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 6/36 (16%) Frame = +2 Query: 23 PPPPPXPXX----PXPPPPP--PXNXPPXTXRGPRP 112 PPPPP P P PPPPP PP P P Sbjct: 30 PPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLP 65 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 37.5 bits (83), Expect = 0.014 Identities = 22/44 (50%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = -2 Query: 150 PAAD--AXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGG 25 PA D + PR GG G GG GGGGGG G G GGGG Sbjct: 110 PANDRPSAPRAYGGGG-GYSYGGGGGGYGGGGGGYGGGGDGGGG 152 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGGGG G G G GGG G G Sbjct: 125 GGYSYGGGGGGYGGGGGGYGGGGDGGGG 152 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -2 Query: 102 PRXVXGGXFXGGGGGGXGXXGXGGG-GGXXXGXG 4 PR GG GGGG G G GGG GG G G Sbjct: 118 PRAYGGGGGYSYGGGGGGYGGGGGGYGGGGDGGG 151 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GG GGGGGG G G GG GG G G Sbjct: 779 GGHHGGGGCGGGHHGGGGGGCGGCGGGGCGGGGDGGG 815 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G GG G G G GGG GG Sbjct: 779 GGHHGGGGCGGGHHGGGGGGCGGCGGGG-CGGGGDGG 814 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGG----GGXGXXGXGGGGGXXXGXG 4 GG G V GG F GG G GG G G GGGG G G Sbjct: 122 GGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSG 162 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GP GG GGG GG G GGG G G G Sbjct: 117 GGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNG 153 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG GP GG GGGGG G GGGGG G Sbjct: 153 GGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGG 187 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GP GG GGGGGG G G GGG G G Sbjct: 108 GGGGPGYGGGGYGPGGGGGGV-VIGGGFGGGAGYGSG 143 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/38 (50%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXX-GXGGGGGXXXGXG 4 GG G + GG GGGGGG G GGGGG G G Sbjct: 167 GGGG--GIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHG 202 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXGXV 3 G GG G + GG GG GGGGGG G G V Sbjct: 168 GGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGGV 204 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G G G +G G GG G GGGG GG G Sbjct: 137 GAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGG 171 Score = 31.9 bits (69), Expect = 0.72 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 1/58 (1%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXG-GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG P G G G GG GG G G G G GGG G G Sbjct: 113 GYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGG 170 Score = 31.9 bits (69), Expect = 0.72 Identities = 21/57 (36%), Positives = 22/57 (38%) Frame = -1 Query: 730 GGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGGXS 560 GG G +G GG G G G GGG GG G GG G GG S Sbjct: 153 GGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGG----CGGSCSGGGGGGGGYGHGGVS 205 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXG 638 G GG GG G GG G G G GGG G Sbjct: 165 GIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYG 200 Score = 30.7 bits (66), Expect = 1.7 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = -1 Query: 745 GGXAAGG-AXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXG 569 GG GG GG G GG G G G GGG G G GG G G Sbjct: 105 GGYGGGGPGYGGGGYGPGGGG--GGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSG 162 Query: 568 G 566 G Sbjct: 163 G 163 Score = 30.7 bits (66), Expect = 1.7 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 4/64 (6%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXG----GGXGGXRXXXXXXXXXXGXGGXXX 578 GG GGA G G G G G G G GG GG G GG Sbjct: 131 GGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCS 190 Query: 577 GXGG 566 G GG Sbjct: 191 GGGG 194 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXGXG 4 GGGG G G G G GGG G G Sbjct: 153 GGGGPGYGSGGGGIGGGGGIGGG 175 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GGGG G G GGG G G Sbjct: 155 GGPGYGSGGGGIGGGGGIGGGVIIGGGG 182 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 G AGG GG GG G G GGG GG Sbjct: 100 GELTAGGYGGGGPGYGGGGYGPGGGGGGVVIGGGFGG 136 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGG-GGGGXGXXGXGGGGGXXXGXG 4 GG G G + GG GGGG G GGG G G G Sbjct: 136 GGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIG 173 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 G GG GG G + GG G GG G G GGG G Sbjct: 150 GGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYG 200 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = -1 Query: 742 GXAAGGAXGGXXAGXGG-XGXXGXAXXGEAXGGGXGG 635 G GG GG G G G G G GGG GG Sbjct: 160 GSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGG 196 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 37.5 bits (83), Expect = 0.014 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +2 Query: 5 PXPXXXPPP--PPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PPP PP P P P P PP P P+P Sbjct: 58 PQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKP 95 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXP-XXPXPPPPPPXNXPPXTXRGPRP 112 P P PPP P P P PP PP P GP P Sbjct: 83 PEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPP 119 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +2 Query: 5 PXPXXXP-PPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P P PP P P P P PP PP P P Sbjct: 91 PAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTP 127 Score = 35.5 bits (78), Expect = 0.058 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PPP P P P P P P PP + P+P Sbjct: 28 PSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQ-PKP 62 Score = 35.1 bits (77), Expect = 0.077 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P PPP P PPP PP P PP Sbjct: 46 PSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPP 82 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRG 133 P P PPP P P P P P P PP P P + G Sbjct: 75 PQPKPAPPPEPKPAPPPAPKPVPCPSPPKPP-APTPKPVPPHG 116 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P PPP P P PPP P + P P+P Sbjct: 26 PGPSPCPSPPPKP-QPKPPPAPSPSPCPSPPPKPQP 60 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 10 PXXPPXPPP--PPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP P P PP P PP P+ P PP P Sbjct: 22 PVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKP 58 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXP---XXPXPPPPPPXNXPPXTXRGPRPP 115 P P P PPP P P PPP P P P PP Sbjct: 34 PPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPP 73 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P P P P P PP P P P PP Sbjct: 54 PPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPP 90 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T P P P PPP P P P P PP P Sbjct: 71 TPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAP 107 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PP PP P PP P P PP P Sbjct: 62 PVPPPACPPTPPKPQPKPAPP---PEPKPAPPPAP 93 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P P P P PP PP P P+P Sbjct: 52 PSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKP 87 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P PP P PPP P PP P P Sbjct: 64 PPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCP 99 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P PPP P P PPP P P+PP Sbjct: 73 PKPQPKPAPPPEPK----PAPPPAPKPVPCPSPPKPP 105 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P P P P P P P P + PP P PP Sbjct: 30 PCPSPPPKPQPKP-PPAPSPSPCPSPPPKPQPKPVPP 65 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P P P P P P P P P P+P Sbjct: 40 PKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKP 75 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P PPP P PP P P+ P P P Sbjct: 28 PSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKP 62 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +2 Query: 5 PXPXXXPPP-PPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P P P P P P P PP PP T P+P Sbjct: 42 PPPAPSPSPCPSPPPKPQPKPVPPPACPP-TPPKPQP 77 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPP-PXNXPPXTXRG---PRPP 115 P PP PP P P P PPP P PP + P PP Sbjct: 65 PPACPPTPPKPQ-PKPAPPPEPKPAPPPAPKPVPCPSPP 102 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P P P P P P P P P PP Sbjct: 102 PKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPP 138 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P PP P P PP + P+PP Sbjct: 8 PSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQ-PKPP 43 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P P P P P PP P P P P Sbjct: 50 PCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEP 85 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP P P PP P P P P P P Sbjct: 32 PSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPP 66 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P P P P P PPP P P+P Sbjct: 44 PAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKP 79 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP P P P P P PT P P P Sbjct: 101 PPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAP 135 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/71 (25%), Positives = 18/71 (25%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXPXPAA 546 PP P P P PPP P PP P P P Sbjct: 69 PPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVP-PHGPPPKPAPAPTP 127 Query: 547 XPXPXSXPLXP 579 P P P P Sbjct: 128 APSPKPAPSPP 138 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 10 PXXPPXPPPPP-PXXXP-PXTPPXEXPTXXPXGPPXP 114 P PP P P P P P P PP P P PP P Sbjct: 69 PPTPPKPQPKPAPPPEPKPAPPPAPKPVPCP-SPPKP 104 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 3/36 (8%) Frame = +1 Query: 10 PXXPPXPPPPP---PXXXPPXTPPXEXPTXXPXGPP 108 P P PPP P P PP P P GPP Sbjct: 83 PEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPP 118 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP P P PP P P P P P Sbjct: 52 PSPPPKPQPKPVPPPACPPTPPKPQPKPAPPP 83 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXP-PXPA 707 PP P PP + PP P P P P P P P PA Sbjct: 82 PPEPKPAPPPAPKPVPCPSPPK-PPAPTPKPVPPHGPPPKPAPAPTPA 128 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P P P P P PP P P P P Sbjct: 99 PSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKP 133 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P PP P P P P P P+P Sbjct: 105 PAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKP 140 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXN 79 P P P P P P P P PP P N Sbjct: 119 PKPAPAPTPAPSP-KPAPSPPKPEN 142 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G R GG + GGGGG G GG G G G Sbjct: 89 GGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG+ GG +G GG G G G + GGG GG Sbjct: 90 GGGGRGGSGGGYRSG-GGGGYSGGGGGGYSGGGGGGG 125 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -2 Query: 141 DAXPRXXXXGGRGPRXVXGGXFXGGGGG--GXGXXGXGGGGG 22 +A R GG G GG GGGGG G G G GGGG Sbjct: 81 EAQSRGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGG 122 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G G GG GG GGGGGG G G Sbjct: 90 GGGGRGGSGGGYRSGG--GGGYSGGGGGGYSGGGG 122 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Frame = -2 Query: 72 GGGGGGXGXXGXG---GGGGXXXGXG 4 GGGGGG G G G GGGG G G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGG 113 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG G G GGGG G G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGG 115 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 37.1 bits (82), Expect = 0.019 Identities = 23/60 (38%), Positives = 26/60 (43%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG GG+ GG +G GG G G G + GGG GG G GG G GG Sbjct: 90 GGGGRGGSGGGYRSG-GGGGYSGGGGGGYS-GGGGGGYERRSGGYGSGGGGGGRGYGGGG 147 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G R GG + GGGGG GGGGG G G Sbjct: 89 GGGGGRGGSGGGYRSGGGGG---YSGGGGGGYSGGGG 122 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/35 (51%), Positives = 19/35 (54%), Gaps = 4/35 (11%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGG----XGXXGXGGGGG 22 GG G GG + GGGGGG G G GGGGG Sbjct: 105 GGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGG 139 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXG--GGGGXXXGXG 4 GG G GG GGGGGG G G G GGG G G Sbjct: 121 GGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDG 159 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -2 Query: 141 DAXPRXXXXGGRGPRXVXGGXFXGGGGG--GXGXXGXGGGGG 22 +A R GG G GG GGGGG G G G GGGG Sbjct: 81 EAQSRGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGG 122 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGG----GGGXXXGXG 4 G G R GG + GGGGGG G GG GG G G Sbjct: 98 GGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGG 137 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G G GG GG GGGGGG G G Sbjct: 90 GGGGRGGSGGGYRSGG--GGGYSGGGGGGYSGGGG 122 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GG G R GG GGG G G G GGGG Sbjct: 136 GGGGGRGYGGGGRREGGGYGGGDGGSYGGGG 166 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGE--AXGGGXGG 635 GG +GG GG G GG G G+ + GGG GG Sbjct: 130 GGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 168 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGG-GGGXGXXGXGGGGG 22 GG G GG GGG GGG G GGGGG Sbjct: 137 GGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 168 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Frame = -2 Query: 72 GGGGGGXGXXGXG---GGGGXXXGXG 4 GGGGGG G G G GGGG G G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGG 113 Score = 29.9 bits (64), Expect = 2.9 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 5/65 (7%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGG-----XGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXX 581 GG +GG GG G GG G G G G G GG R G GG Sbjct: 106 GGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRR---EGGGYGGGDGGSY 162 Query: 580 XGXGG 566 G GG Sbjct: 163 GGGGG 167 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG G G GGGG G G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGG 115 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 G P GG GGGGGG G G GGG G Sbjct: 51 GSKPNKKWGGGMGGGGGGGGGSGGGGGGRG 80 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 G + + GG GGGGGG G GG GG Sbjct: 51 GSKPNKKWGGGMGGGGGGGGGSGGGGGGRGG 81 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXGXG 4 GG GGG G G GGGG G G Sbjct: 60 GGMGGGGGGGGGSGGGGGGRGGG 82 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 569 GXEXGXGXAAGXGXGGGGRXXGP 501 G G G G G GGGGR GP Sbjct: 61 GMGGGGGGGGGSGGGGGGRGGGP 83 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 69 GGGGGXGXXGXGGGGGXXXGXG 4 GGG G G G GG GG G G Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRG 80 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P PP P P PPPPPP + PP + P P Sbjct: 54 PEPEDYLPLPPPPQTP-PPPPPPQSLPPPSP-SPEP 87 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP-PPPPPXNXPP 88 P P PPPPP P P P P P + PP Sbjct: 64 PPPQTPPPPPPPQSLPPPSPSPEPEHYPP 92 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 6/45 (13%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPP------PXNXPPXTXRGPRPPXL 121 P P PPP P P PPPP P PP P PP L Sbjct: 73 PPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPPPL 117 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +1 Query: 10 PXXPPX---PPPPPPXXXPPXTPPXEXPTXXPXGP 105 P PP PPPPPP PP +P E P P P Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSPE-PEHYPPPP 94 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +2 Query: 23 PPPPPXPXXPXPPPP--PPXNXPPXTXRGPRP 112 P P P P PPPP PP PP + P P Sbjct: 52 PSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSP 83 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P P P PPPP PP PP Sbjct: 50 PAPSPEPEDYLPLPPPPQTPPPPPPPQSLPP 80 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +1 Query: 22 PXPPPP--PPXXXPPXTPPXEXPTXXPXGPPXP 114 P PPPP PP PP + P P+ P P P Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPP 93 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXP 85 PPPP P P PPPP + P Sbjct: 103 PPPPRPLPPPPPPPLHFSSP 122 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP P PPP P PP PP P Sbjct: 63 PPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPP 94 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 4/38 (10%) Frame = +2 Query: 5 PXPXXXPPPPPX----PXXPXPPPPPPXNXPPXTXRGP 106 P P PPPP P P P P PP PP P Sbjct: 85 PEPEHYPPPPYHHYITPSPPPPRPLPPPPPPPLHFSSP 122 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 3/38 (7%) Frame = +1 Query: 10 PXXPPXP---PPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP P PPP P P PP PP P Sbjct: 69 PPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPP 106 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/39 (48%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGG--GGGXXXGXG 4 GG G R GG + GGGGG G GG GGG G G Sbjct: 102 GGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGG 140 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/28 (57%), Positives = 17/28 (60%) Frame = -2 Query: 105 GPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 G R GG + GG GGG G G GGGGG Sbjct: 133 GGRREGGGGYGGGEGGGYG--GSGGGGG 158 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G R GG + GGGG G G GGGG G Sbjct: 91 GGGGHRG--GGSYGGGGGRREGGGGYSGGGGGYSSRG 125 Score = 32.3 bits (70), Expect = 0.54 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGG---GGGGXGXXGXGGGGGXXXGXG 4 GG R GG + GG GGGG G G GGG G G G Sbjct: 119 GGYSSRGGGGGSYGGGRREGGGGYG-GGEGGGYGGSGGGG 157 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXGXG 4 GGGGG G GGGGG G G Sbjct: 90 GGGGGHRGGGSYGGGGGRREGGG 112 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG + GG GG G GG G GGG G G GG G GG Sbjct: 97 GGGSYGGG-GGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGG 155 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 G + GG + GG G GG GGGG G G G GG G G Sbjct: 106 GRREGGGGYSGGGGGYSSRGGGGGS--YGGGRREGGGGYGGGEGGGYGGSGGGGG 158 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -2 Query: 114 GGRGPRXVXGGXFX-GGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGG G GGGG G G Sbjct: 110 GGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEG 147 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP P PP PP PT P PP Sbjct: 103 PTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPP 135 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP P PP PP PT P PP Sbjct: 175 PTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPP 207 Score = 37.1 bits (82), Expect = 0.019 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP P PP PP + P P PP Sbjct: 179 PVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSPP 211 Score = 36.3 bits (80), Expect = 0.033 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP P PP PP + P P PP Sbjct: 107 PVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPP 139 Score = 35.1 bits (77), Expect = 0.077 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP P PP P + PT P PP Sbjct: 79 PVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPP 111 Score = 35.1 bits (77), Expect = 0.077 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP P PP P + PT P PP Sbjct: 111 PVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPP 143 Score = 35.1 bits (77), Expect = 0.077 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP P PP P + PT P PP Sbjct: 131 PVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPP 163 Score = 35.1 bits (77), Expect = 0.077 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP P PP P + PT P PP Sbjct: 151 PVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPP 183 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP P P PP PP PT P PP Sbjct: 71 PVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPP 103 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P P PP P PP +PP + P P PP Sbjct: 95 PTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPP 127 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP P P PP PP PT P PP Sbjct: 123 PVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPP 155 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP P P PP PP PT P PP Sbjct: 143 PVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPP 175 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P P PP P PP +PP + P P PP Sbjct: 167 PTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPP 199 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP P P PP PT P PP Sbjct: 187 PAKPPVKPPVYPPTKAPVKPPVSPPTKPPVTPP 219 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P P PP P PP PP + P P PP Sbjct: 75 PVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPP 107 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP P P PP + P P PP Sbjct: 83 PAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPP 115 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP P PP PP + P P P Sbjct: 99 PVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAP 131 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P P PP P PP PP + P P PP Sbjct: 127 PTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPP 159 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P P PP P PP PP + P P PP Sbjct: 147 PTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPP 179 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP P P PP + P P PP Sbjct: 155 PTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPP 187 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP P PP PP + P P P Sbjct: 171 PVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAP 203 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP P PP P + P P PP Sbjct: 183 PVSPPAKPPVKPPVYPPTKAPVKPPVSPPTKPP 215 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP PP +PP + P P PP Sbjct: 191 PVKPPVYPPTKAPVKPPVSPPTKPPVTPPVYPP 223 Score = 32.7 bits (71), Expect = 0.41 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP PP PP + P P PP Sbjct: 87 PVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPP 119 Score = 32.7 bits (71), Expect = 0.41 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP P P PP PP P P PP Sbjct: 91 PVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPP 123 Score = 32.7 bits (71), Expect = 0.41 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP PP PP + P P PP Sbjct: 159 PVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPP 191 Score = 32.7 bits (71), Expect = 0.41 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP P P PP PP P P PP Sbjct: 163 PVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPP 195 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP P P PP + P P PP Sbjct: 115 PAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPP 147 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP P P PP + P P PP Sbjct: 135 PTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPP 167 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP PP PP + P P P Sbjct: 119 PVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAP 151 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP PP PP + P P P Sbjct: 139 PVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAP 171 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 PP P P P +PP + P P PP Sbjct: 66 PPAKSPVKPPVKAPVSPPAKPPVKPPVYPP 95 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G + GG G GGG G GGGGG G G Sbjct: 59 GGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGGG 95 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GG G G GGGG G G G GG GG Sbjct: 30 GGNGGGSGKGQWLHGGGGEGGGGEGGGGEGG 60 Score = 31.5 bits (68), Expect = 0.95 Identities = 20/55 (36%), Positives = 21/55 (38%) Frame = -1 Query: 730 GGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG GG G GG G G + GGG GG G GG G GG Sbjct: 45 GGGEGGGGEGGGGEGGGGQKI---SKGGGGGGSGGGQRSSSGGGGGGGEGDGGGG 96 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGG 25 G GG + GG G GG GGGG G G GGGG Sbjct: 52 GEGGGGEGGGGQKISKGGGGGGSG-----GGQRSSSGGGGGGGEGDGGGG 96 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGG GG G GGGG G G Sbjct: 50 GGGEGGGGEGGGGQKISKGGGGGGSGGG 77 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -1 Query: 745 GGXAAGGAXGG--XXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG + GG G G + GGG GG Sbjct: 51 GGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGG 89 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXX---GGGGGGXGG 18 G GG G G GG GG GGGGGG GG Sbjct: 44 GGGGEGGG--GEGGGGEGGGGQKISKGGGGGGSGG 76 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG G GG G GGGG GGGGG G Sbjct: 46 GGEGGGGEGGG---GEGGGGQKISKGGGGGGSGGG 77 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G G + GG GG G GGG GG G Sbjct: 151 GPGGASGGASGGASGGASGGASGGASGGGPGGASG 185 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -3 Query: 107 GGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 GG G G + GG GG G GGG GG G Sbjct: 161 GGASGGASGGASGGASGGGPGGASGGGPGGASG 193 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 107 GGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 GG G G GG GG G GGG GG G Sbjct: 169 GGASGGASGGGPGGASGGGPGGASGGGPGGASG 201 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -3 Query: 107 GGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 GG G G + GG GG GG GG GG G Sbjct: 157 GGASGGASGGASGGASGGASGGGPGGASGGGPG 189 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGG--VXGGXXXGGGGGGXGGXXG 9 G GGP G G + GG GG GG GG GG G Sbjct: 125 GAGGPSGDKPGGASGGGDKPGGASGGGPGGASGGASG 161 Score = 32.3 bits (70), Expect = 0.54 Identities = 20/60 (33%), Positives = 22/60 (36%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG + GG G +G G G G A G A GG GG GG G G Sbjct: 135 GGASGGGDKPGGASGGGPGGASGGASGG-ASGGASGGASGGASGGGPGGASGGGPGGASG 193 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -3 Query: 107 GGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 GG G G + GG GG G GG GG G Sbjct: 145 GGASGGGPGGASGGASGGASGGASGGASGGASG 177 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -3 Query: 107 GGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 GGP G G S GG GG G GG GG G Sbjct: 150 GGPGGASGGAS-GGASGGASGGASGGASGGGPG 181 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G K GG+ D G G G GG GG GGG G G G Sbjct: 131 GDKPGGASGGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGG 187 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G K GG+ GG G GGG G G G GG G G Sbjct: 141 GDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPG 197 Score = 29.1 bits (62), Expect = 5.1 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = -1 Query: 742 GXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 G GGA GG G G G A GG GG G GG G G Sbjct: 131 GDKPGGASGGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPG 189 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG+ A GG GG GGG G G G GG G Sbjct: 149 GGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGGASG 205 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 36.7 bits (81), Expect = 0.025 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PPPPPP PP T PP P Sbjct: 120 PPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPP 154 Score = 35.9 bits (79), Expect = 0.044 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PPPPPP PP T PP P Sbjct: 151 PPPPPPPPPPPPTITPPVTTTTTGHHHHRPPPPPP 185 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 12/42 (28%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXP------------XPPPPPPXNXPPXT 94 P P PPPPP P PPPPPP P T Sbjct: 151 PPPPPPPPPPPPTITPPVTTTTTGHHHHRPPPPPPATTTPIT 192 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASP 665 PP P PP R PP PPP P Sbjct: 128 PPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPP 160 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GG + GGGGGG G G GGG G G Sbjct: 39 GGEWGGAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGG 75 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GGA GG G G G G GE GGG GG Sbjct: 43 GGAEGGGAWGGGGGGGGAWGGEGEGG-GEWGGGGEGG 78 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 95 GXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G G GG GG GGGGGG G G Sbjct: 35 GGAGGGEWGGAEGGGAWGGGGGGGGAWGG 63 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GG GG G GGGGG G G Sbjct: 38 GGGEWGGAEGGGAWGGGGGGGGAWGGEG 65 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXG 638 GG A GG GG A GG G G G GGG G Sbjct: 47 GGGAWGGGGGGGGA-WGGEGEGGGEWGGGGEGGGGG 81 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 G GG A+ GG G GG G GGG G G GGGGG Sbjct: 35 GGAGGGEWGGAEGGGAWGGGGGGG--GAWGGE--GEGGGEWGGGGEGGGGG 81 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G G G GE GGG G Sbjct: 48 GGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGGGRRG 84 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G GG GG GG G G GGG G G Sbjct: 44 GAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGG 80 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G G GG GG GGGGGG G G Sbjct: 36 GAGG--GEWGGAEGGGAWGG---GGGGGGAWGGEG 65 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +2 Query: 5 PXPXXX-PPPPPXPXXPXPPPP---PPXNXPPXTXRGPRPP 115 P P PPPPP PPPP PP PP P PP Sbjct: 26 PPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPP 66 Score = 36.3 bits (80), Expect = 0.033 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PPPP P PPPPP PP Sbjct: 59 PYPHPHPPPPSPYPHPHQPPPPPHVLPP 86 Score = 35.9 bits (79), Expect = 0.044 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P PP PP + PP P P Sbjct: 19 PLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQP 55 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/39 (46%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPP--PPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP PPP P P P PPPP + P + P PP Sbjct: 45 PPPHFSPPHQPPPSP-YPHPHPPPP-SPYPHPHQPPPPP 81 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPP---PXNXPPXTXRGPRPP 115 P PPP P P PPP P P PP P PP Sbjct: 51 PPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPP 88 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PPPP P PP P P PP P Sbjct: 37 PFSPPHHPPPPHFSPPHQPPPSPYPHPHPP-PPSP 70 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P PPPP P P PP P P PP P Sbjct: 59 PYPHPHPPPPSPYPHPHQPPP--PPHVLPPPPPTP 91 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +1 Query: 10 PXXPPXPP---PPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP P PPPP PP PP P P PP Sbjct: 33 PPPPPFSPPHHPPPPHFSPPHQPPPS-PYPHPHPPP 67 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P P P P P P P PP P PP Sbjct: 55 PPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPP 89 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P PPPP PP PP + PP P Sbjct: 25 PPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSP 59 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPP-PXNXPPXTXRGPRP 112 P PPPP PPP P P PP P P Sbjct: 40 PPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHP 74 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P PP P P PPP P P P Sbjct: 35 PPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSP 70 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 36.3 bits (80), Expect = 0.033 Identities = 20/57 (35%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXT----XRGPRPPXLXXRGXASAAGXDPP 163 P P PP P P P P PP PP PRPP + + G DPP Sbjct: 124 PGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFP-PESPPPGIDPP 179 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T P P PPP PP TP E P PP P Sbjct: 104 TPPEVTTVPSDPPPLG-PPQTPGPEFPVPPSPSPPMP 139 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPP---PPPPXNXPPXTXRGP 106 P PP P P P PP PP P P T + P Sbjct: 116 PPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTP 150 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGP 105 P PP PP PP +PP P GP Sbjct: 156 PIWEPPRPPDIFPPESPPPGIDPPPPLGP 184 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +2 Query: 11 PXXXPP--PPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P PP PP P P PP P P T P P Sbjct: 112 PSDPPPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTP 147 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 36.3 bits (80), Expect = 0.033 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGP 106 P PPPPP P PPPPP P + P Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPPPPDPFSWTNP 129 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP 73 P P PPP P PPPPPP Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPPP 120 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 PPP P PPPPPP + P PP +G + + PP Sbjct: 227 PPPQVKQSEPTPPPPPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPPP 273 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/54 (33%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +2 Query: 11 PXXXPPPPP---XPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PPPP P P PPPP P PP +S+A PP Sbjct: 236 PTPPPPPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPPPVKKVGALSSSASKPPP 289 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/57 (26%), Positives = 18/57 (31%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PP PPPPP + +PP RG + L P Sbjct: 252 PTPSPPPPIKKGSSPSPPPPPPVKKVGALSSSASKPPPAPVRGASGGETSKQVKLKP 308 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 36.3 bits (80), Expect = 0.033 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG GGGGGG G G GGG G G Sbjct: 90 GGIVVGGGGGGGGGGGGGGGSGGSNG 115 Score = 35.1 bits (77), Expect = 0.077 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGGGG G G G G G G G Sbjct: 194 GGGGGGGGGGGGGVDGSGSGSGSGSGGG 221 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXGXG 4 GGGGGG G G GGGG G G Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSG 213 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 84 GXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GGGGGG G G G G G G G Sbjct: 150 GEGSGGGGGGDGSSGSGSGSGSGSGSG 176 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGGGG G G G G G G Sbjct: 196 GGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -2 Query: 93 VXGGXFXGGGGGGXGXXG-XGGGGGXXXGXG 4 V GG GGGGGG G G G G G G G Sbjct: 189 VEGGGGGGGGGGGGGGGGVDGSGSGSGSGSG 219 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 93 VXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 V GG GGGGGG G G G G G Sbjct: 93 VVGGGGGGGGGGGGGGGSGGSNGSFFNGSG 122 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -2 Query: 102 PRXVXGGXFXGGGGGGXGXXGXGGGGG 22 P + G GGGGGG G G GG G Sbjct: 89 PGGIVVGGGGGGGGGGGGGGGSGGSNG 115 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GGGG G G G G G G Sbjct: 147 GGSGEGSGGGGGGDGSSGSGSGSGSGSG 174 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G G G GG GGGGGG GG G Sbjct: 72 GYGDGNGNGNAHGRADCPGGIVVGGGGGGGGGGGG 106 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGG G G G G G G G Sbjct: 145 GGGGSGEGSGG---GGGGDGSSGSGSGSGSGSGSGTG 178 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXGXV 3 G GG G G GGV G G G G GG G V Sbjct: 191 GGGGGGGGGGGGGGGGVDGS--GSGSGSGSGGGSGNV 225 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = -1 Query: 730 GGAXGGXXAGXGGXGXXG-XAXXGEAXGGGXG 638 GG GG G GG G G + G GGG G Sbjct: 192 GGGGGGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G + AD GG G GG GG G G G G G G G Sbjct: 76 GNGNGNAHGRADCPGGIVVGGGGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDG 132 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G R G + GGG G GGGGG G Sbjct: 128 GSGDGRVSSSGEYSASAGGGGSGEGSGGGGGGDGSSG 164 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/55 (30%), Positives = 19/55 (34%) Frame = -1 Query: 730 GGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG+ G G GG G G + G G G G GG G GG Sbjct: 147 GGSGEGSGGGGGGDGSSG-SGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGG 200 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -1 Query: 730 GGAXGGXXAGXGGXGXXGXAXXGEAXGGGXG 638 GG GG G GG G + G G G G Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSGSGSGSGGG 221 >At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly identical to RNA helicase [Arabidopsis thaliana] GI:1488521; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 671 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGG 25 GGRG R GG GGGGG G G GG G Sbjct: 639 GGRGNRFGGGGGNRFGGGGGRGRGGSGGRG 668 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P P PP P P TPP PT P PP P Sbjct: 75 PKPAPAPTPPKPKPKPAPTPPNPKPTPAPT-PPKP 108 Score = 34.7 bits (76), Expect = 0.10 Identities = 22/77 (28%), Positives = 23/77 (29%) Frame = +1 Query: 22 PXPPPPPPXXXPPXTPPXEXPTXXPXGPPXPXXXXAXXXXXXXXXXXXLGPXPXKMXXKK 201 P P PP P P TPP PT P PP P A P P Sbjct: 24 PAPKPPKPKPAPAPTPPKPKPTPAPT-PPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPT 82 Query: 202 NCXKKKKXKXXXPDXAP 252 K K P+ P Sbjct: 83 PPKPKPKPAPTPPNPKP 99 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P PP P P PP P P T P+P Sbjct: 64 PKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKP 99 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P PP P P PP P P T P+P Sbjct: 31 PKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKP 66 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P PP P P PP P P T P+P Sbjct: 42 PKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKP 77 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P PP P P PP P P T P+P Sbjct: 53 PKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKP 88 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P P PP P P TPP P P P P Sbjct: 86 PKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAP 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P PP P P PP P P T P+P Sbjct: 75 PKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKP 110 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P P P P P P PP P P+P Sbjct: 29 PKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKP 64 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P P P P P P PP P P+P Sbjct: 40 PKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKP 75 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P P P P P P PP P P+P Sbjct: 51 PKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKP 86 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P P P P P P PP P P+P Sbjct: 73 PKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKP 108 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PP P P PP P P P P+P Sbjct: 55 PKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKP 90 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +2 Query: 5 PXPXXXPP---PPPXPXXPXPPPPPPXNXP-PXTXRGPRPP 115 P P PP P P P P P P P P P P PP Sbjct: 33 PAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPP 73 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +2 Query: 5 PXPXXXPP---PPPXPXXPXPPPPPPXNXP-PXTXRGPRPP 115 P P PP P P P P P P P P P P PP Sbjct: 44 PTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPP 84 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P P P P P P P P P+P Sbjct: 95 PNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKP 128 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 4 TXPXXPPX--PPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T P P P PP P P TPP P P PP P Sbjct: 60 TPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPT-PPNP 97 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PP P P PP P P P P P Sbjct: 77 PAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAP 112 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P PP P P PP P P P P+P Sbjct: 24 PAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKP 57 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXX-PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P P P P P P P P P T P PP Sbjct: 70 PTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTP-APTPP 106 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P P P P PP P P P P P Sbjct: 90 PAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKP 124 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 35.9 bits (79), Expect = 0.044 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPP 88 PPPPP P PPPPP PP Sbjct: 37 PPPPPVYSPPISPPPPPPPPPP 58 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P P PPPPP + P PP Sbjct: 37 PPPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPP 73 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 PP PPPPP PP + P PP Sbjct: 45 PPISPPPPPPPPPPQSHAAAYKRYSPPPPP 74 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 639 PXPPPXASPXXAXPXXPXPPXP 704 P PPP SP + P P PP P Sbjct: 37 PPPPPVYSPPISPPPPPPPPPP 58 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +2 Query: 59 PPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 PPPPP PP + P PP A+ PP Sbjct: 37 PPPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPP 71 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPP 73 PPPPP PPPPP Sbjct: 70 PPPPPSKYGRVYPPPPP 86 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +1 Query: 4 TXPXXPPXPPPP--PPXXXPPXTPPXEXPTXXPXGPPXP 114 T P PP PP PP PP TP + PT P PP P Sbjct: 170 TPPVKPPTTTPPVQPPTYNPPTTP-VKPPTAPPVKPPTP 207 Score = 32.7 bits (71), Expect = 0.41 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP PP PP P P PP Sbjct: 138 PVKPPTTPPVQSPPVQPPTYKPPTSPVKPP 167 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 PP PP P PP T P + PT P P Sbjct: 121 PPTYKPPTPTVKPPTTSPVKPPTTPPVQSP 150 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXP 96 T P PP PP PP PP + PT P Sbjct: 179 TPPVQPPTYNPPTTPVKPPTAPPVKPPTPPP 209 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXT-PPXEXPTXXPXGPP 108 P P PP P PP T PP + PT P P Sbjct: 160 PTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTP 193 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +1 Query: 10 PXXPPXPPPP--PPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP PP PP +P T P PP Sbjct: 142 PTTPPVQSPPVQPPTYKPPTSPVKPPTTTPPVKPP 176 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 10 PXXPPX-PPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP P P TPP + PT P P Sbjct: 151 PVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQP 184 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 4 TXPXXPPXPP-PPPPXXXPPXTPPXEXPTXXPXGPP 108 T P P PP PP PP PP P PP Sbjct: 82 TIPVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKPP 117 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 4/34 (11%) Frame = +1 Query: 19 PPXPPPPPPXXXPPX----TPPXEXPTXXPXGPP 108 PP P PP PP TP + PT P PP Sbjct: 109 PPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPP 142 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PP P P P PP + PP +PP Sbjct: 71 PPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQPP 105 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXP 96 P P PP PP TPP + P P Sbjct: 126 PPTPTVKPPTTSPVKPPTTPPVQSPPVQP 154 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 35.9 bits (79), Expect = 0.044 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPP 73 PPPPP P PPPPPP Sbjct: 268 PPPPPGSWQPSPPPPPP 284 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRG-PRPPXLXXRGXASAAG 151 PPP P PP PPP P + G P+PP + S G Sbjct: 30 PPPSDSSSPSPPAPPP---PDDSSNGSPQPPSSDSQSPPSPQG 69 Score = 28.7 bits (61), Expect = 6.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 28 PPPPPPXXXPPXTPPXEXP 84 PPPPPP P PP P Sbjct: 267 PPPPPPGSWQPSPPPPPPP 285 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP---PPPXNXPPXTXRGPRPP 115 P P PPPP P PP PPP PP P PP Sbjct: 226 PHPPVKYPPPPYKTYPHPPIKTYPPPKECPPPPEHYPWPP 265 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 6/43 (13%) Frame = +2 Query: 5 PXPXXXPPPP---PXPXXPXPPPP---PPXNXPPXTXRGPRPP 115 P P PPP P P PPPP PP PP P PP Sbjct: 56 PPPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPP 98 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 7/44 (15%) Frame = +2 Query: 5 PXPXXXPPPP---PXPXXPXPPP----PPPXNXPPXTXRGPRPP 115 P P PPP P P PPP PPP PP P PP Sbjct: 186 PPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEYPPPIKTYPHPP 229 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 5/41 (12%) Frame = +2 Query: 5 PXPXXXPP---PPPXPXXPXPPP--PPPXNXPPXTXRGPRP 112 P P PP PPP P PP PPP PP + P P Sbjct: 77 PPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYPPP 117 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P PP PPP P PP + P PP P Sbjct: 47 PKFPYSPPKPPPIEKYP--PPVQYPPPIKKYPPPP 79 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PPP P PPP PP + P P Sbjct: 95 PHPPVKYPPPEQYPPPIKKYPPPEQYPPPIKKYPPP 130 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PPP P PPP PP + P P Sbjct: 121 PPPIKKYPPPEQYSPPFKKYPPPEQYPPPIKKYPPP 156 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PPP P PPP PP + P P Sbjct: 173 PPPIKKYPPPEKYPPPIKKYPPPEQYPPPIKKYPPP 208 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PPPP P PPP P + P P Sbjct: 69 PPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPP 104 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPP---PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P P PPP PP P P Sbjct: 249 PPPKECPPPPEHYPWPPKKKYPPPVEYPSPPYKKYPPADP 288 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 6/42 (14%) Frame = +2 Query: 5 PXPXXXPPPPPX--PXXPXPPP----PPPXNXPPXTXRGPRP 112 P P PPP P PPP PPP PP + P P Sbjct: 154 PPPEHYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPP 195 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PPP P PPP PP + P P Sbjct: 180 PPPEKYPPPIKKYPPPEQYPPPIKKYPPPIKKYPPP 215 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = +2 Query: 5 PXPXXXPPP-----PPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P P PPP PP P P PP PP PP PP + Sbjct: 225 PVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKI 268 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P PP P PPP P PP P P Sbjct: 238 PPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPP 273 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 22 PXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PP PP P + P PP P Sbjct: 245 PCPPKPPKIEHPPPVPVYKPPPKIEKPPPVP 275 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P P P PPP P + PP + P PP Sbjct: 288 PVPVHKLPKKPCPPKKVDPPPVPVHKPP--TKKPCPP 322 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP PP P PPP P P + P PP Sbjct: 357 PPPKIEHPPIYIPPIVKKPCPPPVPIYKPPVVIPKKPCPP 396 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +1 Query: 19 PPXP--PPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP P PPP PP P + P PP P Sbjct: 194 PPVPVYEPPPKKEIPPPVPVYDPPPKKEVPPPVP 227 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPP-----PPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP PP P PPP PP + P PP Sbjct: 210 PVPVYDPPPKKEVPPPVPVY---KPPPKVELPPPIPKKPCPP 248 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P P PPP P PP + PP Sbjct: 216 PPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPP 257 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +1 Query: 19 PPXP--PPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP P PPP PP P + P PP P Sbjct: 209 PPVPVYDPPPKKEVPPPVPVYKPPPKVELPPPIP 242 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +1 Query: 19 PPXP--PPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP P PPP PP P + P PP P Sbjct: 257 PPVPVYKPPPKIEKPPPVPVYKPPPKIEHPPPVP 290 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +2 Query: 5 PXPXXXPPPP-PXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PP P P PPP P + PP P P Sbjct: 308 PVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKIVIPPP 344 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 35.5 bits (78), Expect = 0.058 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPP 88 PPP P P PPPPPP + P Sbjct: 107 PPPPPPKPQPPPPPPRSQKP 126 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXP 96 P PPPPPP PP PP P Sbjct: 104 PKRPPPPPPKPQPPPPPPRSQKPMQP 129 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXE 78 P P PPPPPP P PP E Sbjct: 110 PPPKPQPPPPPPRSQKPMQPPTE 132 Score = 29.1 bits (62), Expect = 5.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPR 414 PP P P P P PPPR Sbjct: 107 PPPPPPKPQPPPPPPR 122 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXN---XPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PPP P P PPPP P PP + G P S + PP Sbjct: 45 PSPPPPPSNPSPPPPSPTTTACPPPPSSSGGGPYYYYPPASQSGSYRPPP 94 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPP 70 P P PPPP P PPPP Sbjct: 49 PPPSNPSPPPPSPTTTACPPPP 70 Score = 27.5 bits (58), Expect(2) = 0.28 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 370 PXPXPPPXXPXPPP 411 P P PPP P PPP Sbjct: 45 PSPPPPPSNPSPPP 58 Score = 24.6 bits (51), Expect(2) = 0.28 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 517 PPPPXPXPAAXPXPXS 564 PPPP P A P P S Sbjct: 56 PPPPSPTTTACPPPPS 71 >At3g43583.1 68416.m04636 hypothetical protein Length = 100 Score = 35.5 bits (78), Expect = 0.058 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PP P P P PPP P P P PP Sbjct: 22 PPEKPPSPEPPPSPEPPPSPEKPTSPEQPSSPEPP 56 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRG 103 P P P PPP P P P P PP +G Sbjct: 29 PEPPPSPEPPPSPEKPTSPEQPSSPEPPPHCQG 61 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 35.5 bits (78), Expect = 0.058 Identities = 19/36 (52%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXG--XGGGGGXXXG 10 GRG R GG GGGGG G G GGGGG G Sbjct: 13 GRGGRDGGGGGRFGGGGGRFGGGGGRFGGGGGRFGG 48 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 129 RXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 R GG G R G GGG G G GGGGG G G Sbjct: 2 RPPMRGGGGFRGRGGRDGGGGGRFGGGGGRFGGGGGRFGGGG 43 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +2 Query: 11 PXXXPPPP---PXPXXPXPPPPPPXNXPPXTXRGPRP 112 P PPPP P P P P PPP PP P P Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPP 102 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = +2 Query: 5 PXPXXXPPPP---PXPXXPXP---PPPPPXNXPPXTXRGPRP 112 P P PPPP P P P P PPP P PP P P Sbjct: 87 PPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAP 128 Score = 34.3 bits (75), Expect = 0.13 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 6/63 (9%) Frame = +2 Query: 5 PXPXXXPPP--PPXPXXPXPPP----PPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPX 166 P P PPP P P PPP PPP N PP P P A PP Sbjct: 39 PPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPV-SSPPPASPPPATPPPVASPPPPV 97 Query: 167 LXP 175 P Sbjct: 98 ASP 100 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 PP PPPP PP +PP P PP Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPP 95 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 10 PXXPPXP-PPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP P PPP PP TPP P P P Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPPPVASPPP 102 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Frame = +2 Query: 5 PXPXXXPPPP-PXPXXPXP---PPPPPXNXPPXT 94 P P PPP P P P P PPPP + PP T Sbjct: 71 PPPVSSPPPASPPPATPPPVASPPPPVASPPPAT 104 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXP-PPPPPXNXPPXTXRGPRP 112 P P PP P P P PPP + PP P P Sbjct: 26 PPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPP 60 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 4/38 (10%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPP----PPPXNXPPXTXRGPRP 112 P PPP P PPP PPP PP P P Sbjct: 78 PPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +1 Query: 10 PXXPPX--PPPPPPXXXPPXTPPXEXPTXXPXGP-PXP 114 P PP PPP P PP P PT P P P P Sbjct: 102 PATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSP 139 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXPA 707 PP P PP P PPP ASP A P P PA Sbjct: 70 PPPPVSSPPPASPPPATPPPVASP--PPPVASPPPATPPPVATPPPA 114 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/57 (28%), Positives = 17/57 (29%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPP P PPP P PP +S PP P Sbjct: 31 PAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATP 87 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPP--XTPPXEXPTXXPXGPPXP 114 P PP PPP PP +PP P PP P Sbjct: 79 PASPPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 4/41 (9%) Frame = +2 Query: 5 PXPXXXPPP----PPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP PP P PPP PP P P Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATP 105 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPP-XTPPXEXPTXXPXGPP 108 P P P PPP PP +PP + P PP Sbjct: 73 PVSSPPPASPPPATPPPVASPPPPVASPPPATPP 106 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/75 (24%), Positives = 19/75 (25%) Frame = +1 Query: 355 AXXGPPXPXPPPXXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXP 534 A PP P P P PP P PPP Sbjct: 22 APTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPAS 81 Query: 535 XPAAXPXPXSXPLXP 579 P A P P + P P Sbjct: 82 PPPATPPPVASPPPP 96 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 5/37 (13%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPP--PPPPXNXPPXTXRGP 106 P PPP PP P PP PPP PP P Sbjct: 83 PPATPPPVASPPPPVASPPPATPPPVATPPPAPLASP 119 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +2 Query: 11 PXXXPPPP---PXPXXPXPPPPPPXNXPPXTXRGPRP 112 P PPPP P P P P PPP PP P P Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPP 102 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = +2 Query: 5 PXPXXXPPPP---PXPXXPXP---PPPPPXNXPPXTXRGPRP 112 P P PPPP P P P P PPP P PP P P Sbjct: 87 PPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAP 128 Score = 34.3 bits (75), Expect = 0.13 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 6/63 (9%) Frame = +2 Query: 5 PXPXXXPPP--PPXPXXPXPPP----PPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPX 166 P P PPP P P PPP PPP N PP P P A PP Sbjct: 39 PPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPV-SSPPPASPPPATPPPVASPPPPV 97 Query: 167 LXP 175 P Sbjct: 98 ASP 100 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 PP PPPP PP +PP P PP Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPP 95 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 10 PXXPPXP-PPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP P PPP PP TPP P P P Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPPPVASPPP 102 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Frame = +2 Query: 5 PXPXXXPPPP-PXPXXPXP---PPPPPXNXPPXT 94 P P PPP P P P P PPPP + PP T Sbjct: 71 PPPVSSPPPASPPPATPPPVASPPPPVASPPPAT 104 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXP-PPPPPXNXPPXTXRGPRP 112 P P PP P P P PPP + PP P P Sbjct: 26 PPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPP 60 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 4/38 (10%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPP----PPPXNXPPXTXRGPRP 112 P PPP P PPP PPP PP P P Sbjct: 78 PPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +1 Query: 10 PXXPPX--PPPPPPXXXPPXTPPXEXPTXXPXGP-PXP 114 P PP PPP P PP P PT P P P P Sbjct: 102 PATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSP 139 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXPA 707 PP P PP P PPP ASP A P P PA Sbjct: 70 PPPPVSSPPPASPPPATPPPVASP--PPPVASPPPATPPPVATPPPA 114 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/57 (28%), Positives = 17/57 (29%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPP P PPP P PP +S PP P Sbjct: 31 PAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATP 87 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPP--XTPPXEXPTXXPXGPPXP 114 P PP PPP PP +PP P PP P Sbjct: 79 PASPPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 4/41 (9%) Frame = +2 Query: 5 PXPXXXPPP----PPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP PP P PPP PP P P Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATP 105 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPP-XTPPXEXPTXXPXGPP 108 P P P PPP PP +PP + P PP Sbjct: 73 PVSSPPPASPPPATPPPVASPPPPVASPPPATPP 106 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/75 (24%), Positives = 19/75 (25%) Frame = +1 Query: 355 AXXGPPXPXPPPXXPXPPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXP 534 A PP P P P PP P PPP Sbjct: 22 APTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPAS 81 Query: 535 XPAAXPXPXSXPLXP 579 P A P P + P P Sbjct: 82 PPPATPPPVASPPPP 96 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 5/37 (13%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPP--PPPPXNXPPXTXRGP 106 P PPP PP P PP PPP PP P Sbjct: 83 PPATPPPVASPPPPVASPPPATPPPVATPPPAPLASP 119 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPP--PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P P P PP P PP + P PP Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPP 184 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T PP P PPP PP +P E P+ PP P Sbjct: 141 TIAGQPPPPESPPPESLPPPSP--ESPSPPSPEPPPP 175 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 PPPP P PPP P + P + P P L Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPPPSSL 178 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPP 67 P P PPPP P PPPP Sbjct: 165 PSPPSPEPPPPSSLEPPPPPP 185 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = +2 Query: 50 PXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP + PP + P PP +S PP Sbjct: 147 PPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPP 184 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPX---PPPPPP 73 P P PP P P P PPPPPP Sbjct: 160 PSPESPSPPSPEPPPPSSLEPPPPPP 185 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPPP PP P PP Sbjct: 152 PPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPP 193 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPP---PPXNXPPXTXRGPRPP 115 P PPPPP PPPP P PP + P PP Sbjct: 144 PYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPP 183 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XN--XPPXTXRGPRPP 115 P P PPPP P PPPPP + PP + P PP Sbjct: 162 PPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPP 203 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP + P PP Sbjct: 92 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 133 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP + P PP Sbjct: 202 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 243 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP + P PP Sbjct: 222 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 263 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP + P PP Sbjct: 242 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 283 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP + P PP Sbjct: 282 PPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPP 323 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP + P PP Sbjct: 302 PPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPP 343 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPP-----PPXNXPPXTXRGPRPP 115 P PPPPP PPPP PP PP + P PP Sbjct: 74 PYVYSSPPPPPYVYNSPPPPPYVYSSPP--PPPYVYKSPPPP 113 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPP-----PPXNXPPXTXRGPRPP 115 P PPPPP PPPP PP PP + P PP Sbjct: 184 PYVYSSPPPPPYVYKSPPPPPYVYSSPP--PPPYVYKSPPPP 223 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP P PP Sbjct: 62 PPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPP 103 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP P PP Sbjct: 112 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPP 153 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP P PP Sbjct: 172 PPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 213 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP P PP Sbjct: 262 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPP 303 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP P PP Sbjct: 132 PPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPP 172 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XN--XPPXTXRGPRPP 115 P P PPP P PPPPP + PP + P PP Sbjct: 122 PPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPP 163 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/56 (30%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P PPPPP PP +PP + PP Sbjct: 322 PPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKPPPYVYNYSPP 377 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP-----PPPXNXPPXTXRGPRPP 115 P P PPP P PPP PPP PP P PP Sbjct: 55 PPPYVYKPPPYIYSSPPPPPYVYSSPPP---PPYVYNSPPPP 93 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPP 115 P P PPP P PPPPP + PP PP Sbjct: 102 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 141 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPP 115 P P PPP P PPPPP + PP PP Sbjct: 192 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 231 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPP 115 P P PPP P PPPPP + PP PP Sbjct: 212 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 251 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPP 115 P P PPP P PPPPP + PP PP Sbjct: 232 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 271 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPP 115 P P PPP P PPPPP + PP PP Sbjct: 252 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 291 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPP 115 P P PPP P PPPPP + PP PP Sbjct: 272 PPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPP 311 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPP 115 P P PPP P PPPPP + PP PP Sbjct: 292 PPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPP 331 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPP 115 P P PPP P PPPPP + PP PP Sbjct: 82 PPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP PP P PP P PP Sbjct: 396 PAPYVYKPPPYVYSYSPPPAPYVYKPPPYVYSSPSPP 432 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P PPPP P PPP P + PP P PP PP P Sbjct: 95 PPEPSPPPPLPTEA-PPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPP 148 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +2 Query: 5 PXPXXXPPPPPX----PXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPPP P P P PP N PP P P Sbjct: 118 PPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLP 158 Score = 35.1 bits (77), Expect = 0.077 Identities = 22/75 (29%), Positives = 23/75 (30%), Gaps = 4/75 (5%) Frame = +1 Query: 367 PPXPXPPPXXPX--PPPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPXXRPPPPXPXP 540 PP P PPP P PPP P PPPP P Sbjct: 95 PPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESP 154 Query: 541 AAXPXPX--SXPLXP 579 + P P S PL P Sbjct: 155 PSLPAPDPPSNPLPP 169 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P PPPP P PP P P PP P Sbjct: 94 PPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPP 128 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 7/44 (15%) Frame = +2 Query: 5 PXPXXXPPPPP------XPXXPXPPPPPPXNXPPXT-XRGPRPP 115 P P PPP P PPPPPP PP T P PP Sbjct: 101 PPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPP 144 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PPPPP P P PP N P Sbjct: 141 PSPPTNPPPPPESPPSLPAPDPPSNPLP 168 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPP P P P PPP P P PP Sbjct: 67 PLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPP 101 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PPPPP P T P P+ P PP P Sbjct: 120 PESSPPPPPPTEAPPTTPITSPS-PPTNPPPP 150 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 6/43 (13%) Frame = +2 Query: 5 PXPXXXPPPPP--XPXXPXPPPPPPXNXP----PXTXRGPRPP 115 P P PP P P P PPPPP + P P P PP Sbjct: 127 PPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPP 169 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PP P P P P PPP PP Sbjct: 148 PPPPESPPSLPAPDPPSNPLPPPKLVPP 175 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P P PPPP P PP PP Sbjct: 78 PSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPP 119 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P PP + PP P PP Sbjct: 184 PSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPP 220 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P PP P PP T P P PP P Sbjct: 71 PPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLP 105 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXP-PXTXRGPRPP 115 PPPP P P PP P + P P PP Sbjct: 231 PPPPGSKRPTPSPPSPSDSKRPVHPSPPSPP 261 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P P PPP P PP PP + P PP AS PP Sbjct: 160 PDPPSNPLPPPKLVPPSHSPPRHLPSPPAS-EIPPPPRHLPSPPASERPSTPP 211 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P P PPP P +PP P+ P P Sbjct: 160 PDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPP 194 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPP--XEXPTXXPXGPP 108 PP P PP P TPP E P+ P G P Sbjct: 194 PPRHLPSPPASERPSTPPSDSEHPSPPPPGHP 225 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGP 106 PPPP P PPPP P + P Sbjct: 219 PPPPGHPKRREQPPPPGSKRPTPSPPSP 246 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 35.5 bits (78), Expect = 0.058 Identities = 19/56 (33%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPP---PXNXPPXTXRGP-RPPXLXXRGXASAAGXDP 160 P P P P P PP PP P N PP + P PP + G A++ +P Sbjct: 138 PSPNVGPTNPESPPLQSPPAPPASDPTNSPPASPLDPTNPPPIQPSGPATSPPANP 193 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/59 (27%), Positives = 19/59 (32%), Gaps = 2/59 (3%) Frame = +2 Query: 5 PXPXXXPPPPPX--PXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PP P P PPPP + PP PP + + P P Sbjct: 58 PPPDSQLPPLPSILPPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPP 116 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXN--XPPXTXRGPRPP 115 P PP PP P PP P N PP P PP Sbjct: 8 PSSSPPAPPADTAP-PPETPSENSALPPVDSSPPSPP 43 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 35.5 bits (78), Expect = 0.058 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP PP P P PP PP + P PP Sbjct: 60 PPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPP 96 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 PPPP P P P PPPP PP P P Sbjct: 59 PPPPSP--PPPSPPPPACPPPPALPPPPP 85 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXN 79 P P PPPPP PPPPP N Sbjct: 75 PPPPALPPPPPKKVSSYCPPPPPAN 99 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPP 88 P PPPP P P PPPP PP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPP 84 Score = 31.5 bits (68), Expect = 0.95 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXSXPLXP 579 P PPPP P P A P P + P P Sbjct: 60 PPPSPPPPSPPPPACPPPPALPPPP 84 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +1 Query: 10 PXXPPXPP--PPPPXXXPPXTPPXEXPTXXPXGPP 108 P P PP PPPP PP PP + + P PP Sbjct: 65 PPPSPPPPACPPPPALPPP--PPKKVSSYCPPPPP 97 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPPXP 704 PP PPP + P A P P P P Sbjct: 61 PPSPPPPSPPPPACPPPPALPPP 83 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P P PPP + P PP Sbjct: 61 PPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPP 97 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G GG + GGGG G G GG GG G G Sbjct: 358 GGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGG 393 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G RG G GGG GG G G G GGG G G Sbjct: 368 GYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGG 404 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGG 25 GG G R G G GGGG G G GGGG Sbjct: 365 GGGGYRGGGGYDMGGVGGGGAGGYGAGGGG 394 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG GG G G G A GGG GG Sbjct: 362 GGAGGGGYRGGGGYDMGGVGGGGAGGYG-AGGGGNGG 397 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G G GGG GG G GGG G G G Sbjct: 378 GGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGG 414 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGG 28 G + GG G G GG F GGGGG G G G G Sbjct: 368 GYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGGSG 416 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 102 PRXVXGGXFXGGGGG-GXGXXGXGGGGGXXXGXG 4 P G + GGGGG G GGGGG G G Sbjct: 291 PALGYSGRYGGGGGGYNRGGYSMGGGGGYGGGPG 324 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GP GG + G GG G G GGG G G Sbjct: 337 GYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGG 373 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GP + GG + GGG G G GGG G G Sbjct: 320 GGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIG 355 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G G G G S G GG G GGGG G G Sbjct: 340 GPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGG 374 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXG--GGGGGXGXXGXGGGGGXXXGXG 4 GG V GG G GGGG G GGGG G G Sbjct: 373 GGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYG 411 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG G GG G G G + GG GG Sbjct: 373 GGYDMGGVGGG---GAGGYGAGGGGNGGGSFYGGGGG 406 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 736 AAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXR 629 + GG GG G GG G G GGG G R Sbjct: 253 SGGGYGGGRSGGYGGYGGEFGGYGGGGYGGGVGPYR 288 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = -1 Query: 742 GXAAGGAXGGXXAGXGGX---GXXGXAXXGEAXGGGXGG 635 G GGA GG G GG G G G GGG G Sbjct: 358 GGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNG 396 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/60 (28%), Positives = 18/60 (30%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 GG GG G G G G + GGG G GG G GG Sbjct: 315 GGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGG 374 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/58 (29%), Positives = 18/58 (31%) Frame = -1 Query: 742 GXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXG 569 G GG G + GG G G G GG GG GG G G Sbjct: 332 GEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYG 389 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -2 Query: 132 PRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGX-XXGXG 4 P GG G + G GGG GG G G GGGG G G Sbjct: 341 PSGSYGGGYGSSGIGG---YGGGMGGAGGGGYRGGGGYDMGGVG 381 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G G G GG GG GGGG GG G Sbjct: 348 GYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGG 382 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXG 638 GG AGG G GG G G GGG G Sbjct: 381 GGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGGSG 416 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP---PPPXNXPPXTXRGPRPP 115 P P P PPP P P P P P + PP T + PP Sbjct: 120 PTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPP 159 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTX--RGPRPPXL 121 P P P P PPPP P PP + P PP L Sbjct: 80 PIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPPSL 113 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP P PP P P + P PP Sbjct: 93 PAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPP 129 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 10 PXXPPXPP-PPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP P PPP P TP PT PP P Sbjct: 126 PSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPPP 161 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +2 Query: 5 PXPXXXPP--PPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P P P P P P PPP P PP + P P L Sbjct: 108 PSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPSTPSL 148 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 Query: 22 PXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PPPP P PP P + P+ P P Sbjct: 88 PSPPPPAPKKSPPPPTPKKSPSPPSLTPFVP 118 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPP 88 P PPPP P PPP P + P Sbjct: 85 PSTPSPPPPAPKKSPPPPTPKKSPSP 110 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 6/43 (13%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPP------PXNXPPXTXRGPRPP 115 P P P P P PPP P P PP + P PP Sbjct: 118 PHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPP 160 >At3g05920.1 68416.m00668 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 126 Score = 35.1 bits (77), Expect = 0.077 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPP 88 P PP PP P P P PPP PP Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPAPEPP 97 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPP 70 P PP PP P P PPP P Sbjct: 73 PPKPPEPPKPPEPEKPKPPPAP 94 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPR 109 PPP P P PP P PP P+ Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPAPEPPK 98 >At1g74720.1 68414.m08658 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1081 Score = 35.1 bits (77), Expect = 0.077 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXG 10 GGGGGG G G GGGGG G Sbjct: 611 GGGGGGGGGPGGGGGGGPYCG 631 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGG 22 G GGGG G G GGGGG Sbjct: 609 GEGGGGGGGGGPGGGGG 625 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 35.1 bits (77), Expect = 0.077 Identities = 19/57 (33%), Positives = 21/57 (36%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G K GG P+ G + GGG GG G GGGGG G G Sbjct: 25 GKKDGGLVVLKQTKPKKKRRDDVGAVSIDSCCCCGGGDGGGDGGGDGGGGGCGGGGG 81 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GGG G G GGGGG G G Sbjct: 60 GGDGGGDGGGDGGGGGCGGGGGCGGGGG 87 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GG GGG G G GGGG G G Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGG 86 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGG-GGXGXXGXGGGGG 22 G G GG GGGG GG G G GGGGG Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGGGGG 89 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 84 GXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GGG GG G G GGG G G G Sbjct: 63 GGGDGGGDGGGGGCGGGGGCGGGGGGG 89 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGG 25 GG G G GG GGG G G GGGG Sbjct: 60 GGDGGGDGGGDGGGGGCGGGGGCGGGGGGG 89 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 730 GGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG G GG G G G GGG GG Sbjct: 60 GGDGGGDGGGDGGGG--GCGGGGGCGGGGGGG 89 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PPPPP P P PP T P PP L A PP Sbjct: 227 PGRAALPPPPPLPMAVRKGVAAPPLPPPGTAALPPPPPLPMAAGKGVAAPPPP 279 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASA 145 PP PP PPPPP P PP RG A Sbjct: 249 PPLPPPGTAALPPPPPLPMAAGKGVAAPPPPPPGARGGLGA 289 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 5/28 (17%) Frame = +2 Query: 5 PXPXXXPPPPPXP-----XXPXPPPPPP 73 P PPPPP P PPPPPP Sbjct: 254 PGTAALPPPPPLPMAAGKGVAAPPPPPP 281 >At3g26400.1 68416.m03292 eukaryotic translation initiation factor 4B, putative/ eIF-4B, putative similar to eukaryotic initiation factor 4B [Arabidopsis thaliana] GI:6739518 Length = 532 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GR R G GGGG G G G GGGGG Sbjct: 187 GRQGRYSGDGGGFGGGGSGFGGGGGGGGGG 216 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGG 25 G +G GG F GGG G G G GGGG Sbjct: 187 GRQGRYSGDGGGFGGGGSGFGGGGGGGGGG 216 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -2 Query: 108 RGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 +G + G G GGGG G G GGGGG Sbjct: 186 QGRQGRYSGDGGGFGGGGSGFGGGGGGGG 214 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/26 (53%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = -2 Query: 84 GXFXGGGGG-GXGXXGXGGGGGXXXG 10 G + G GGG G G G GGGGG G Sbjct: 190 GRYSGDGGGFGGGGSGFGGGGGGGGG 215 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 104 GPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 G G G G GG GGGGGG GG Sbjct: 187 GRQGRYSGDGGGFGGGGSGFGGGGGGGGG 215 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 69 GGGGGXGXXGXGGGGGXXXGXG 4 G GGG G G G GGG G G Sbjct: 194 GDGGGFGGGGSGFGGGGGGGGG 215 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P P P PP P P T P PP Sbjct: 158 PPPTPCPPPTPTPTPPVVTPPTP-TPPVITPPTPTPP 193 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPP--PPPPXNXPPXTXRGPRPP 115 P PP P P P PP PPP PP T P P Sbjct: 115 PIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTP 151 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPP--PXNXPPXTXRGPRPP 115 P PP PP P P PP P PP P+PP Sbjct: 50 PAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPP 86 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP-PPPXNXPPXTXRGPRPP 115 P PP PP P PP PP PP P+PP Sbjct: 40 PKHPVKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPP 77 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 6/43 (13%) Frame = +2 Query: 5 PXPXXXPPP---PPXPXXPXPPPP---PPXNXPPXTXRGPRPP 115 P P PP PP P P PP PP PP T + P P Sbjct: 92 PKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKP 134 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P P P P PP PP PP P PP Sbjct: 104 PPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPP 136 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +2 Query: 5 PXPXXXPPP----PPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP PP P P PP + PP T P P Sbjct: 128 PKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTP 168 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P PP P P PPP P P T P PP + Sbjct: 147 PPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVI 185 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PP P P PP P P P T P P Sbjct: 210 PTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTP 245 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXP-PXTXRGPRPP 115 P P P P P P PP PP + P P T P P Sbjct: 102 PKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTP 139 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P P P P P PP + P+PP Sbjct: 108 PHPHPKPPIVKPPTKPPPSTPKPPTKPPPST--PKPP 142 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTP---PXEXPTXXPXGPPXP 114 PP P PP PP TP P PT PP P Sbjct: 146 PPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTP 180 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P PPP P P TPP PT PP P Sbjct: 158 PPPTPCPPPTPTPTPPVVTPP--TPTPPVITPPTP 190 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P P PP P P PP P P P T P PP + Sbjct: 180 PTPPVITPPTPTPPVVTPPTPTPPVITPPT---PTPPVI 215 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXP 96 P P PP PP PP P + PT P Sbjct: 39 PPKHPVKPPKPPAVKPPKPPAVKPPTPKP 67 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +2 Query: 5 PXPXXXPPPPPXPXX----PXPPPPPPXNXPPXTXRGPRPP 115 P P PP P P P PP P PP P+PP Sbjct: 55 PKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPP 95 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP P PP PP TP P P P Sbjct: 120 PTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPP 154 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P P PP P P PP P P P T P PP + Sbjct: 170 PTPPVVTPPTPTPPVITPPTPTPPVVTPPT---PTPPVI 205 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 3/39 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP---PPPPXNXPPXTXRGPRP 112 P PP P P P PP PPP PP P P Sbjct: 124 PPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTP 162 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P P PP P P P T P PP Sbjct: 190 PTPPVVTPPTPTPPVITPPTPTPPVITPPT---PTPP 223 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P P PP P P P T P PP Sbjct: 200 PTPPVITPPTPTPPVITPPTPTPPVVTPPT---PTPP 233 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T P P PP P PP + P + PT P P P Sbjct: 106 TKPHPHPKPPIVKPPTKPPPSTP-KPPTKPPPSTPKP 141 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P P P P PP + P T P P P Sbjct: 119 PPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKP 153 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PPP PP P P P P P Sbjct: 141 PPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTP 172 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXT 94 P P PP P P PP P P P T Sbjct: 220 PTPPVVTPPTPTPPVVTPPTPTPPTPIPET 249 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PP P P PP P P + P+PP Sbjct: 29 PPKPSPAPHKPPKHPVKPPKPPAVKPPKPP 58 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/46 (28%), Positives = 14/46 (30%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPPXP 704 P P PP P PP +P P P PP P Sbjct: 200 PTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTP 245 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 T P P P PP P TPP P P P Sbjct: 211 TPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTPIP 247 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXP 96 T P P P PP P TPP P P Sbjct: 221 TPPVVTPPTPTPPVVTPPTPTPPTPIPETCP 251 >At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ boundaries domain protein 18 (LBD18) identical to LOB DOMAIN 18 [Arabidopsis thaliana] GI:17227164; supported by full-length cDNA gi:17227163 Length = 262 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXGXG 4 GGGGGG G G GGGG G G Sbjct: 12 GGGGGGCGGGGSSGGGGSSGGGG 34 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GG V GG GGGG G G GGGG Sbjct: 4 GGNTITAVGGGGGGCGGGGSSGGGGSSGGGG 34 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG GGGG G GGGGG G Sbjct: 14 GGGGCGGGGSSGGGGSSGGGGGGPCG 39 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGGGG G G GGGG G G Sbjct: 79 GGHGGHYGGGGGHYGGGGG-HGGGGHYGGGGHHGGGG 114 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -2 Query: 111 GRGPRXVXGGXFXGG--GGGGXGXXGXGGGGGXXXGXG 4 G G GG GG GGGG G G GGG G G G Sbjct: 51 GGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGG 88 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GG G GG GGGG G G GGG G Sbjct: 45 GGHGGHG--GGGHYGGGGHGHGGHNGGGGHG 73 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG G G G G G GGGG G G Sbjct: 59 GGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGG 95 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGG-GGGXXXGXG 4 GG G GG GGGG G GG GGG G G Sbjct: 70 GGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGG 107 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G GG G GGG G GGGG G G Sbjct: 62 GHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGG 97 >At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical to cDNA glycine-rich protein 3 short isoform (GRP3S) GI:4206766 Length = 116 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/29 (55%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 87 GGXFXGGGG-GGXGXXGXGGGGGXXXGXG 4 GG + GGGG GG G G GGGG G G Sbjct: 49 GGRYQGGGGHGGHGGGGYQGGGGRYQGGG 77 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GG G GG + GGGG G G GGGG Sbjct: 54 GGGGHGGHGGGGYQGGGGRYQGGGGRQGGGG 84 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -2 Query: 105 GPRXVXGGXFXGGGGGGX-GXXGXGGGGGXXXGXG 4 G R GG G GGGG G G GGG G G Sbjct: 49 GGRYQGGGGHGGHGGGGYQGGGGRYQGGGGRQGGG 83 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +2 Query: 5 PXPXXXPPP----PPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPP PP P PPPP PP + P PP Sbjct: 81 PVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPP 121 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPP P P PPPP PP + P PP Sbjct: 40 PPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 81 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPP P P PPPP PP + P PP Sbjct: 56 PPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPP 97 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPP P P PPPP PP + P PP Sbjct: 96 PPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 137 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPP P P PPPP PP + P PP Sbjct: 112 PPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 153 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 5/36 (13%) Frame = +2 Query: 23 PPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPP P P PPPP PP + P PP Sbjct: 30 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 65 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/58 (31%), Positives = 20/58 (34%), Gaps = 5/58 (8%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP-----PPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPPP P PP PPP PP + PP + PP Sbjct: 87 PPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPP 144 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP PPP + PP + P PP Sbjct: 71 PPPVYKSPPPPVKYYS--PPPVYKSPPPPVYKSPPPP 105 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/58 (29%), Positives = 19/58 (32%), Gaps = 5/58 (8%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP-----PPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P PP PPP PP + PP + PP Sbjct: 103 PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPP 160 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/58 (29%), Positives = 19/58 (32%), Gaps = 5/58 (8%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP-----PPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P PP PPP PP + PP + PP Sbjct: 31 PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPP 88 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +2 Query: 5 PXPXXXPPP----PPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPP PP P PPPP PP + P PP Sbjct: 81 PVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPP 121 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPP P P PPPP PP + P PP Sbjct: 40 PPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 81 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPP P P PPPP PP + P PP Sbjct: 56 PPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPP 97 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPP P P PPPP PP + P PP Sbjct: 96 PPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 137 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPP P P PPPP PP + P PP Sbjct: 112 PPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 153 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 5/36 (13%) Frame = +2 Query: 23 PPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPP P P PPPP PP + P PP Sbjct: 30 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 65 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/58 (31%), Positives = 20/58 (34%), Gaps = 5/58 (8%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP-----PPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPPP P PP PPP PP + PP + PP Sbjct: 87 PPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPP 144 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP PPP + PP + P PP Sbjct: 71 PPPVYKSPPPPVKYYS--PPPVYKSPPPPVYKSPPPP 105 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/58 (29%), Positives = 19/58 (32%), Gaps = 5/58 (8%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP-----PPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P PP PPP PP + PP + PP Sbjct: 103 PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPP 160 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/58 (29%), Positives = 19/58 (32%), Gaps = 5/58 (8%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP-----PPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P PP PPP PP + PP + PP Sbjct: 31 PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPP 88 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 PP PP PP P +PP P P PP Sbjct: 97 PPQPPQSPPASAPTVSPPPVSPPPAPTSPP 126 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPP P P PPP P + PP P P Sbjct: 109 PTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAP 143 Score = 33.5 bits (73), Expect = 0.24 Identities = 20/62 (32%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = +2 Query: 5 PXPXXXPP-PPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXPXX 181 P P PP P P P PPP P + PP P P A + PP P Sbjct: 113 PPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAPAP 172 Query: 182 XK 187 K Sbjct: 173 TK 174 Score = 32.7 bits (71), Expect = 0.41 Identities = 21/83 (25%), Positives = 21/83 (25%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXPXXXXAXXXXXXXXXXXXLGPXPX 183 T P PPP P P P P P P P L P P Sbjct: 110 TVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPA 169 Query: 184 KMXXKKNCXKKKKXKXXXPDXAP 252 K K K P AP Sbjct: 170 PAPTKHKRKHKHKRHHHAPAPAP 192 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 4 TXPXXPPXPPPPP-PXXXPPXTPPXEXPTXXPXGPPXP 114 T P PP PP P PP P PT P P P Sbjct: 95 TPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASP 132 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P P PP PP P T P P Sbjct: 188 PAPAPIPPSPPSPPVLTDPQDTAPAPSP 215 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP-PPPPPXNXPPXTXRGPRP 112 P P PP P P PPP PP T P P Sbjct: 98 PQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPP 134 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/57 (26%), Positives = 18/57 (31%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P P P P PP PP + P + PP + A P P Sbjct: 83 PAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASP 139 Score = 23.8 bits (49), Expect(2) = 8.0 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P PP P PP Sbjct: 133 PPAPASPPPAPASPP 147 Score = 23.0 bits (47), Expect(2) = 8.0 Identities = 11/26 (42%), Positives = 11/26 (42%), Gaps = 1/26 (3%) Frame = +1 Query: 505 PXXRPPPPX-PXPAAXPXPXSXPLXP 579 P PP P P P P P S P P Sbjct: 143 PASPPPAPVSPPPVQAPSPISLPPAP 168 >At1g63550.1 68414.m07184 hypothetical protein low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 299 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXT-XRGPRPP 115 PPP P P P PPP + PP + + P PP Sbjct: 226 PPPSPSAPPPRSPPPKSSPPSSLPQTPSPP 255 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPP 73 PPPPP P P PPPPPP Sbjct: 247 PPPPPPP--PPPPPPPP 261 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPR 414 PP P PPP P PPP+ Sbjct: 247 PPPPPPPPPPPPPPPQ 262 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 19 PPXPPPPPPXXXPP 60 PP PPPPPP PP Sbjct: 247 PPPPPPPPPPPPPP 260 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 19 PPXPPPPPPXXXPP 60 PP PPPPPP PP Sbjct: 248 PPPPPPPPPPPPPP 261 Score = 29.1 bits (62), Expect = 5.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPR 414 PP P PPP P PP R Sbjct: 248 PPPPPPPPPPPPPPQR 263 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRG 103 PPPP PPPPPP PP G Sbjct: 247 PPPP------PPPPPPPPPPPQRLYG 266 Score = 28.3 bits (60), Expect = 8.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 10 PXXPPXPPPPPP 45 P PP PPPPPP Sbjct: 247 PPPPPPPPPPPP 258 Score = 28.3 bits (60), Expect = 8.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 10 PXXPPXPPPPPP 45 P PP PPPPPP Sbjct: 248 PPPPPPPPPPPP 259 Score = 28.3 bits (60), Expect = 8.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 10 PXXPPXPPPPPP 45 P PP PPPPPP Sbjct: 249 PPPPPPPPPPPP 260 Score = 28.3 bits (60), Expect = 8.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 10 PXXPPXPPPPPP 45 P PP PPPPPP Sbjct: 250 PPPPPPPPPPPP 261 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 34.3 bits (75), Expect = 0.13 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPP 73 P PPPP P P PPPP P Sbjct: 262 PPNRPPPPSSPPPPPPPPPTP 282 Score = 33.9 bits (74), Expect = 0.18 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXP 85 P PP P P PPPPPP P Sbjct: 263 PNRPPPPSSPPPPPPPPPTPP 283 Score = 33.5 bits (73), Expect = 0.24 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPP 72 P PP P PPP PP TPP Sbjct: 263 PNRPPPPSSPPPPPPPPPTPP 283 Score = 32.3 bits (70), Expect = 0.54 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPT 87 PP PPPP PP PP PT Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPPT 284 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXR 100 PP P PPPPPP P T R Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPPTSR 286 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPP 70 P P PPPPP P PP PP Sbjct: 266 PPPPSSPPPPP----PPPPTPP 283 Score = 26.6 bits (56), Expect(2) = 0.55 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP PPP P PPP Sbjct: 262 PPNRPPPPSSPPPPP 276 Score = 24.2 bits (50), Expect(2) = 0.55 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXPXS 564 P PPPP P P P S Sbjct: 268 PPSSPPPPPPPPPTPPTSRS 287 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PPP P P P PP + PP T P P Sbjct: 58 PTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPP 93 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 4/38 (10%) Frame = +2 Query: 11 PXXXPPPP----PXPXXPXPPPPPPXNXPPXTXRGPRP 112 P PPPP P PPPP P PP P P Sbjct: 51 PADLPPPPTPVYSPPPADLPPPPTPYYSPPADLPPPTP 88 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +1 Query: 19 PPXP--PPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP P PPP PP TP P P PP P Sbjct: 57 PPTPVYSPPPADLPPPPTPYYSPPADLP--PPTP 88 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP--PPPPPXNXPPXTXRGPR 109 P P PPPP P PPP P PP P+ Sbjct: 64 PPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPPQ 100 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPP P PPPP PP GP P Sbjct: 44 PPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSGP 78 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P PPPP PP P PP Sbjct: 30 PPPPQGAYPPPGGYPPQGYPPPPHGYPPAAY--PPPP 64 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPPPX-PXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPPP P P PP P P G PP Sbjct: 207 PIPSAYPPPPPSSAYPPQPYPPQPSYYPQGPYPGQYPP 244 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP---PPPPPXNXPPXTXRGPRP 112 P P PPP P P PPPPP + P P+P Sbjct: 192 PQPSAYPPPSTSGYPPIPSAYPPPPPSSAYPPQPYPPQP 230 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGP 105 P P PPPPP P P P+ P GP Sbjct: 206 PPIPSAYPPPPPSSAYPPQPYPPQPSYYPQGP 237 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXP-PPPPPXNXPPXTXRGPRPP 115 P P PP P P PPP PP P PP Sbjct: 179 PQPSGYPPASGYPPQPSAYPPPSTSGYPPIPSAYPPPP 216 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +2 Query: 23 PPPP---PXPXXPXPPPPPPXNXPP 88 PPPP P P PPPPPP PP Sbjct: 20 PPPPVGVPPQYYPPPPPPPPPPPPP 44 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPP 88 P PPP P PPPPPP PP Sbjct: 17 PQGPPPPVGVPPQYYPPPPPPPPPPP 42 Score = 32.3 bits (70), Expect = 0.54 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP 73 P P PP P P PPPPPP Sbjct: 20 PPPPVGVPPQYYPPPPPPPPPPP 42 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP 73 P P PP P P PPPPPP Sbjct: 21 PPPVGVPPQYYPPPPPPPPPPPP 43 Score = 24.2 bits (50), Expect(2) = 7.9 Identities = 10/18 (55%), Positives = 10/18 (55%), Gaps = 2/18 (11%) Frame = +1 Query: 364 GPPXPX--PPPXXPXPPP 411 GPP P PP P PPP Sbjct: 19 GPPPPVGVPPQYYPPPPP 36 Score = 23.0 bits (47), Expect(2) = 7.9 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXP 552 P PPPP P P P Sbjct: 28 PQYYPPPPPPPPPPPP 43 >At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibrillarin 2 GI:9965655 from [Arabidopsis thaliana] Length = 320 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GGRG GG GG GG G G GGG G Sbjct: 14 GGRGRGGYSGGRGDGGFSGGRGGGGRGGGRG 44 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 129 RXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGG 25 R GGRG GG GG GGG G GG G Sbjct: 18 RGGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRG 52 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/59 (28%), Positives = 19/59 (32%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXG 569 GG +GG G +G G G G GGG G GG G G Sbjct: 9 GGGFSGGRGRGGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGPPRGGARGGRG 67 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP------XNXPPXTXRGPRPP 115 P PPPPP P PPP PP PP P PP Sbjct: 762 PTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPP 804 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/26 (53%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Frame = +2 Query: 26 PPPPXPXX---PXPPPPPPXNXPPXT 94 PPPP P P PPPPP + PP T Sbjct: 702 PPPPAPYYYSSPQPPPPPHYSLPPPT 727 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/50 (38%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXN---XPPXTXRGPRPPXLXXRGXASAAGXDPP 163 PPPPP PPPP + PP GP PP G + A+ PP Sbjct: 791 PPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPP---IPGISYASPPPPP 837 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/55 (32%), Positives = 21/55 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P P P PP P P P P N PP P PP +S + PP + Sbjct: 552 PTPSSPIPSPPTPSTPPTPISPGQNSPPII---PSPPFTGPSPPSSPSPPLPPVI 603 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 9/46 (19%) Frame = +2 Query: 5 PXPXXXPPPPPXP----XXPXPPP-----PPPXNXPPXTXRGPRPP 115 P P PPP P P PPP PPP + PP P PP Sbjct: 716 PPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPP 761 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 22 PXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PPPPP PP TP + P PP P Sbjct: 713 PQPPPPPHYSLPPPTPTYHYISPPP--PPTP 741 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPPP PPPP P + P P PP Sbjct: 758 PPPPPTVHYNPPPPPSPAHYSPP----PSPP 784 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXP 85 P PPPPP PPPPP P Sbjct: 795 PAVHYSPPPPPVIHHSQPPPPPIYEGP 821 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/55 (29%), Positives = 21/55 (38%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PP P P PP P + P + P PP + G + P + P Sbjct: 530 PITVPSPPSTPTSPGSPPSP--SSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIP 582 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P P P PP P +PP T P G P Sbjct: 449 PPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSP 481 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P P PP P P P PP Sbjct: 501 PTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPP 537 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/61 (29%), Positives = 20/61 (32%), Gaps = 4/61 (6%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP--PPPPXNXP--PXTXRGPRPPXLXXRGXASAAGXDPPXLX 172 P PP P P PP P PP P P + P PP + PP Sbjct: 561 PPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPPST 620 Query: 173 P 175 P Sbjct: 621 P 621 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 2/59 (3%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXR--GXASAAGXDPPXLXP 175 P P PP P P PPP + P P PP + S A PP P Sbjct: 726 PTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPP 784 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXG-PPXP 114 T P PP P PP T P T P G PP P Sbjct: 415 TTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSP 452 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P P PP P PP P P P P G PP Sbjct: 430 PSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPP 482 >At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At3g25690, At5g61090 [Arabidopsis thaliana] Length = 681 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 2/19 (10%) Frame = +2 Query: 23 PPPPPXP--XXPXPPPPPP 73 PPPPP P P PPPPPP Sbjct: 326 PPPPPSPEHKAPAPPPPPP 344 >At3g55790.1 68416.m06199 expressed protein predicted protein, Arabidopsis thaliana; expression supported by MPSS Length = 103 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXGXG 4 GGGGG G G GGGGG G G Sbjct: 60 GGGGGRGGGGGHGGGGGEDFGNG 82 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 413 RGGGXGXXGGGXGXGG 366 RGGG G GGG G GG Sbjct: 58 RGGGGGGRGGGGGHGG 73 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 84 GXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GGGGG G G GGGGG G G Sbjct: 207 GMASGGGGGLGGGNGSGGGGGGGGGGG 233 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG GGG G G G GGGGG G Sbjct: 212 GGGGLGGGNGSGGGGGGGGGGGRISG 237 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGG G G G GGGGG G Sbjct: 211 GGGGGLGGGNGSGGGGGGGGGGGRISGG 238 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 93 VXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 V G GGGG G G GGGGG G Sbjct: 205 VHGMASGGGGGLGGGNGSGGGGGGGGGG 232 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGG 25 GG G + GG GGGGGG G G GG Sbjct: 211 GGGG--GLGGGNGSGGGGGGGGGGGRISGG 238 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXGXG 4 GGGGGG G G GGGG G G Sbjct: 73 GGGGGGRGGGGFGGGGRSFGGGG 95 Score = 32.3 bits (70), Expect = 0.54 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGG--GGXGXXGXGGGGGXXXGXG 4 GG G R GG F GGG GG G GGGG G G Sbjct: 74 GGGGGRG--GGGFGGGGRSFGGGGSSSRGGGGSSSRGGG 110 Score = 31.5 bits (68), Expect = 0.95 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = -2 Query: 114 GGRGPRXVXGG--XFXGGGG---GGXGXXGXGGGGGXXXGXG 4 GGRG GG F GGG GG G GGGG G G Sbjct: 77 GGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGGSSSRGGG 118 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXN---XPPXTXRGPRPP 115 P PPPPP PPPP N PP + P PP Sbjct: 114 PYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPP 153 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXN---XPPXTXRGPRPP 115 P PPPPP PPPP N PP + P PP Sbjct: 314 PYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPP 353 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP + P PP Sbjct: 412 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPP 453 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP + P PP Sbjct: 92 PPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPP 133 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP + P PP Sbjct: 152 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 193 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP + P PP Sbjct: 172 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 213 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP + P PP Sbjct: 192 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 233 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP + P PP Sbjct: 212 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 253 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP + P PP Sbjct: 232 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 273 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP + P PP Sbjct: 252 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 293 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP + P PP Sbjct: 272 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 313 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP + P PP Sbjct: 292 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 333 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP + P PP Sbjct: 352 PPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 393 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP + P PP Sbjct: 392 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 433 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP + P PP Sbjct: 52 PPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPP 93 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP + P PP Sbjct: 72 PPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPP 113 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PPP P PPPPP PP + P PP Sbjct: 132 PPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 173 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPP-----PPXNXPPXTXRGPRPP 115 P PPPPP PPPP PP PP + P PP Sbjct: 374 PYVYSSPPPPPYVYKSPPPPPYVYSSPP--PPPYVYKSPPPP 413 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXT---XRGPRPP 115 P PPPPP PPPP + PP + + P PP Sbjct: 334 PYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPP 373 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPP-----PPXNXPPXTXRGPRPP 115 P PPPPP PPPP PP PP P PP Sbjct: 364 PYVYKSPPPPPYVYSSPPPPPYVYKSPP--PPPYVYSSPPPP 403 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XN--XPPXTXRGPRPP 115 P P PPP P PPPPP + PP P PP Sbjct: 102 PPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPP 143 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XN--XPPXTXRGPRPP 115 P P PPP P PPPPP + PP P PP Sbjct: 302 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPP 343 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPP 115 P P PPP P PPPPP + PP PP Sbjct: 122 PPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPP 161 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPP 115 P P PPP P PPPPP + PP PP Sbjct: 142 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 181 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPP 115 P P PPP P PPPPP + PP PP Sbjct: 162 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 201 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPP 115 P P PPP P PPPPP + PP PP Sbjct: 182 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 221 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPP 115 P P PPP P PPPPP + PP PP Sbjct: 202 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 241 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPP 115 P P PPP P PPPPP + PP PP Sbjct: 222 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 261 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPP 115 P P PPP P PPPPP + PP PP Sbjct: 242 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 281 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPP 115 P P PPP P PPPPP + PP PP Sbjct: 262 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 301 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPP 115 P P PPP P PPPPP + PP PP Sbjct: 282 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 321 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPP 115 P P PPP P PPPPP + PP PP Sbjct: 322 PPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPP 361 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPP 115 P P PPP P PPPPP + PP PP Sbjct: 382 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 421 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXTXRGPRPP 115 P P PPP P PPPPP + PP PP Sbjct: 402 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 441 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXN---XPPXTXRGPRPP 115 PPPPP PPPP PP P PP Sbjct: 50 PPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPP 83 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 5/36 (13%) Frame = +2 Query: 23 PPPPPXPXXPXPPP-----PPPXNXPPXTXRGPRPP 115 PPPP P PPP PPP PP P PP Sbjct: 71 PPPPYVYSSPPPPPYIYKSPPP---PPYVYSSPPPP 103 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 5/36 (13%) Frame = +2 Query: 23 PPPPPXPXXPXPPP-----PPPXNXPPXTXRGPRPP 115 PPPP P PPP PPP PP P PP Sbjct: 91 PPPPYVYSSPPPPPYIYKSPPP---PPYVYSSPPPP 123 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GG GGG G GGGGG G G Sbjct: 400 GGGGGGGDGGGGQGTGIGGGGGGEQGTG 427 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGG 25 G GG+ GG G G GGGGGG G GGGG Sbjct: 383 GWGGGGAGAVTQVMQGCGGGGGGGDGGGGQGTGIGGGGGGEQGTGVGGGG 432 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GG A GG G GG G GGGG G G G GGG Sbjct: 385 GGGGAGAVTQVMQGCGGGGGGGDGGGGQGTGIGGGGGGEQGTGVGGG 431 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXGXG 4 GGGGG G G GGGG G G Sbjct: 451 GGGGGEQGVTGSDGGGGRGRGGG 473 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGG G G G GGGG G G Sbjct: 403 GGGGDGGGGQGTGIGG-GGGGEQGTGVG 429 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG P + R GG P + GG G GG GGG G G Sbjct: 20 GGGCPMTISGGRLFTGGG-DPVIITGGRLSTGAAGGVNVDRSKGGGRRKTGDG 71 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXGXV 3 G GG G S GGV G GGG GG GG G V Sbjct: 100 GIGGAAGIGGFHSIGGVGGLGGVGGGVGGLGGVGGGV 136 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G +G GGV GG GG GG GG G Sbjct: 141 GVGGLGGAGLG-GVGGVGGGIGKAGGIGGLGGLGG 174 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -3 Query: 113 GXGGPXGXXVGXSX-GGVXGGXXXGGGGGGXGGXXG 9 G GG G G GG+ G GG GGG GG G Sbjct: 149 GLGGVGGVGGGIGKAGGIGGLGGLGGAGGGLGGVGG 184 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -2 Query: 114 GGRGPRXVXG-GXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G V G G G GG G G GG GG G G Sbjct: 146 GGAGLGGVGGVGGGIGKAGGIGGLGGLGGAGGGLGGVG 183 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = -3 Query: 107 GGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 GG G +G GGV G GGG GG GG G Sbjct: 114 GGVGG--LGGVGGGVGGLGGVGGGVGGLGGVGG 144 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGG GG G G GG G G G Sbjct: 164 GGIGGLGGLGGA--GGGLGGVGGLGKAGGIGVGGGIG 198 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +2 Query: 23 PPPPPX--PXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAG 151 PPP P P P PPP P PP P PP AS G Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPPSPPSAASGRG 202 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP--PPPPXNXPPXTXRG 103 P PPP P P PP PPPP PP G Sbjct: 166 PFSPSIPPPSPPYFPPEPPSIPPPPPPSPPSAASG 200 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P P PPP PP PP P P P PP Sbjct: 166 PFSPSIPPPSPP-YFPP--EPPSIPPPPPPSPP 195 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPT 87 P PP PPPPPP TPP + T Sbjct: 298 PSPPPPPPPPPPQPLIAATPPRKQGT 323 Score = 33.5 bits (73), Expect = 0.24 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 29 PPPXPXXPXPPPPPP 73 PPP P P PPPPPP Sbjct: 381 PPPSPPPPPPPPPPP 395 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPR 109 PP P P PPPPPP P R R Sbjct: 244 PPQQPPATPPPPPPPPPVEVPQKPRRTHR 272 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP PPPP P TPP + P P P Sbjct: 423 PPPPPPPRYTQFDPQTPPRRVKSGRPPRPTKP 454 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRG 103 PPP P P P PPP P P +G Sbjct: 296 PPPSPPPPPPPPPPQPLIAATPPRKQG 322 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +2 Query: 41 PXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAA 148 P P PPPPPP P PR R ++AA Sbjct: 297 PPSPPPPPPPPPPQPLIAATPPRKQGTLQRRKSNAA 332 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 19 PPXPPPPPPXXXPP 60 PP PPPPPP PP Sbjct: 382 PPSPPPPPPPPPPP 395 Score = 30.3 bits (65), Expect = 2.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 23 PPPPPXPXXPXPPPP 67 PPP P P P PPPP Sbjct: 381 PPPSPPPPPPPPPPP 395 Score = 30.3 bits (65), Expect = 2.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 26 PPPPXPXXPXPPPPP 70 PPP P P PPPPP Sbjct: 381 PPPSPPPPPPPPPPP 395 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXP 57 P PP PPPPPP P Sbjct: 249 PATPPPPPPPPPVEVP 264 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP 73 P P PPPPP P P PP Sbjct: 296 PPPSPPPPPPPPPPQPLIAATPP 318 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 367 PPXPXPPPXXPXPPPR 414 PP P PPP P PP R Sbjct: 382 PPSPPPPPPPPPPPLR 397 Score = 28.3 bits (60), Expect = 8.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 10 PXXPPXPPPPPP 45 P PP PPPPPP Sbjct: 382 PPSPPPPPPPPP 393 Score = 28.3 bits (60), Expect = 8.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 10 PXXPPXPPPPPP 45 P PP PPPPPP Sbjct: 383 PSPPPPPPPPPP 394 Score = 28.3 bits (60), Expect = 8.9 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 50 PXPPPPPPXNXPP 88 P PPPPPP PP Sbjct: 473 PPPPPPPPFRVPP 485 >At2g39750.1 68415.m04881 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 694 Score = 33.5 bits (73), Expect = 0.24 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 26 PPPPXPXXPXPPPPP 70 PPPP P P PPPPP Sbjct: 107 PPPPPPPSPSPPPPP 121 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 23 PPPPPXPXXPXPPPP 67 PPPPP P P PP P Sbjct: 109 PPPPPSPSPPPPPGP 123 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPP 70 PPPPP P PPP P Sbjct: 108 PPPPPPSPSPPPPPGP 123 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/34 (50%), Positives = 18/34 (52%), Gaps = 3/34 (8%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGG---GGXGXXGXGGGGG 22 GG G GG + GGGG GG G G GG GG Sbjct: 80 GGGGRYQGGGGRYQGGGGRYQGGGGRQGGGGSGG 113 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXG-XGGGGGXXXGXG 4 GG G GG + GGGG G G GGGG G G Sbjct: 59 GGGGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGG 96 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG + GGGG G G GGG G G Sbjct: 73 GGGGNYQGGGGRYQGGGGRYQGGGGRYQGGGGRQGGG 109 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -2 Query: 132 PRXXXXGGRGPRXVXGGXFXGGGGGGXGXXG-XGGGGGXXXGXG 4 P G G GG + GGGG G G GGGG G G Sbjct: 39 PDQRGYGDNGGNYNNGGGYQGGGGNYQGGGGNYQGGGGNYQGGG 82 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGX-GGGGGXXXGXG 4 GG G GG + GGGG G G GGGG G G Sbjct: 66 GGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGRYQGGG 103 >At2g04190.1 68415.m00404 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 411 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -2 Query: 114 GGRG--PRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G P G GGGGGG G GGG G G G Sbjct: 8 GGWGDFPGKGVGSCVFGGGGGGPAFGGRGGGPGRGYGGG 46 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 105 GPRXVXGGXFXGGGGGGXGXXGXG-GGGGXXXGXG 4 GP GG G G GG G G G GGGG G G Sbjct: 64 GPGFFFGGAGPGPGYGGGGGHGPGYGGGGDGRGYG 98 Score = 31.5 bits (68), Expect = 0.95 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 4/61 (6%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXG----GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGX 7 G + GG PR G RGP G F GG G G G G GGG G G Sbjct: 33 GGRGGGPGRGYGGGPRVHGPGYGIGSRGPDP-GPGFFFGGAGPGPGYGG-GGGHGPGYGG 90 Query: 6 G 4 G Sbjct: 91 G 91 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = -3 Query: 557 GXGXAAGXGXGGGGRXXGPXXXXXXXXXXXXXXXXXXXXXXXXXGXXXRGGGXGXXGGGX 378 G G G G GGG R GP G G G GGG Sbjct: 34 GRGGGPGRGYGGGPRVHGPGYGIGSRGPDPGPGFFFGGAGPGPGYGGGGGHGPGYGGGGD 93 Query: 377 GXG 369 G G Sbjct: 94 GRG 96 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G + GG GGGG G G GGGG G G Sbjct: 31 GGEGKKKNGGGE--GGGGEGTSGEGGGGGGDGTKGGG 65 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -2 Query: 168 KXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 K GG GG G GG GGG G G GGGG G G Sbjct: 37 KNGGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGTKGGG 91 Score = 31.5 bits (68), Expect = 0.95 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 3/60 (5%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXG---GGGGXXXGXG 4 G K GG+ GG G GGGGGG G G G GGG G G Sbjct: 19 GTKGGGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLG 78 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/60 (28%), Positives = 18/60 (30%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 G GG G GG G G GE GGG G + G GG Sbjct: 24 GNTITGGGGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGG 83 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/59 (30%), Positives = 19/59 (32%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXG 569 GG GG G G GG G G G+ GG G GG G G Sbjct: 39 GGGEGGGGEGTSGEGGGGGGD-GTKGGGDGISGGGHGDGLGCSGGGGDGTKGGGRRGDG 96 >At1g35830.1 68414.m04452 VQ motif-containing protein contains PF05678: VQ motif Length = 302 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 50 PXPPPPPPXNXPPXTXRGPR 109 P PPPPP PP + R PR Sbjct: 81 PPQPPPPPPPPPPSSSRNPR 100 Score = 29.1 bits (62), Expect = 5.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 32 PPXPXXPXPPPPPPXNXPP 88 PP P P PPPPP + P Sbjct: 81 PPQPPPPPPPPPPSSSRNP 99 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPR 109 PP PP P P PPPP P R R Sbjct: 81 PPQPPPP--PPPPPPSSSRNPRKRTRASR 107 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PP P P P PPP N T R P Sbjct: 81 PPQPPPPPPPPPPSSSRNPRKRTRASRRAP 110 Score = 28.3 bits (60), Expect(2) = 0.26 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 10 PXXPPXPPPPPP 45 P PP PPPPPP Sbjct: 81 PPQPPPPPPPPP 92 Score = 28.3 bits (60), Expect = 8.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 10 PXXPPXPPPPPP 45 P PP PPPPPP Sbjct: 82 PQPPPPPPPPPP 93 Score = 23.8 bits (49), Expect(2) = 0.26 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 19 PPXPPPPPPXXXPP 60 PP PPPPP P Sbjct: 86 PPPPPPPPSSSRNP 99 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 PPPP P PPPPP + PP + P P Sbjct: 65 PPPPSPQYS-PPPPPSQSSPPRSRCPPVP 92 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 66 GGGGXGXXGXGGGGGXXXG 10 GGGG G G GGGGG G Sbjct: 127 GGGGQGGGGQGGGGGGAEG 145 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 71 GGVXGGXXXGGGGGGXGGXXG 9 GG GG GGGGG GG G Sbjct: 129 GGQGGGGQGGGGGGAEGGTTG 149 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPPP P PP + P PP Sbjct: 68 PSPQYSPPPPPSQSSPPRSRCPPVPTTGCCNQPPGPP 104 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGG 25 GGGG G G G GGGG Sbjct: 127 GGGGQGGGGQGGGGGG 142 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 33.1 bits (72), Expect = 0.31 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPP 70 PPPPP P PPPPP Sbjct: 151 PPPPPMPRRSPPPPPP 166 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PPPPPP +PP P PP P Sbjct: 22 PLPPPPPPPMRRSAPSPPPMSGRVPPPPPPPP 53 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRG 133 P PPPPP PPP PP P PP +G Sbjct: 22 PLPPPPPPPMRRSAPSPPPMSGRVPPPP---PPPPMFDPKG 59 Score = 31.5 bits (68), Expect = 0.95 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPR 109 PPPP P PPPPP +G R Sbjct: 150 PPPPPPMPRRSPPPPPPRFDAFDHKGAR 177 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 6/35 (17%) Frame = +2 Query: 29 PPPXPXXPXPPPPPP------XNXPPXTXRGPRPP 115 PP P PPPPPP + PP + R P PP Sbjct: 15 PPMRGRVPLPPPPPPPMRRSAPSPPPMSGRVPPPP 49 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXR 100 PPP P PPPPPP P R Sbjct: 38 PPPMSGRVPPPPPPPPMFDPKGAGR 62 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PPP PPPPPP P Sbjct: 30 PMRRSAPSPPPMSGRVPPPPPPPPMFDP 57 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 PPPP PPPPPP + P PP L Sbjct: 640 PPPPSMSGGAPPPPPPPPMLVASRTAP-PPHL 670 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPP 73 PPPP PPPPPP Sbjct: 640 PPPPSMSGGAPPPPPPP 656 Score = 29.1 bits (62), Expect = 5.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 22 PXPPPPPPXXXPPXTPP 72 P PPPP P PP PP Sbjct: 150 PPPPPPMPRRSPPPPPP 166 Score = 28.7 bits (61), Expect = 6.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPP 73 PPP P PPPPPP Sbjct: 641 PPPSMSGGAPPPPPPPP 657 >At5g07540.2 68418.m00864 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 190 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGG--VXGGXXXGGGGGGXGGXXG 9 G GGP G G + GG GG GG GG GG G Sbjct: 125 GAGGPSGDKPGGASGGGDKPGGASGGGPGGASGGAVG 161 >At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPP 73 P PPP P P PPPPPP Sbjct: 101 PHHLPPPFPGPYDSAPPPPPP 121 >At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPP 73 P PPP P P PPPPPP Sbjct: 101 PHHLPPPFPGPYDSAPPPPPP 121 >At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPP 73 P PPP P P PPPPPP Sbjct: 101 PHHLPPPFPGPYDSAPPPPPP 121 >At4g15460.1 68417.m02363 glycine-rich protein Length = 148 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG G V GG GGGG G GGGG G Sbjct: 67 GGGGHASVGGGHASGGGGHAVEGGGHAGGGGGGHG 101 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 G G V GG GGGGGG G G G G G Sbjct: 81 GGGGHAVEGGGHAGGGGGGHGEEEGGHGIGRGGG 114 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG A+GG G G G A G GG GG Sbjct: 62 GGHASGGGGHASVGGGHASGGGGHAVEGGGHAGGGGG 98 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P P P PPPPP P P PP Sbjct: 140 PPPPSKTHEPSRPNTPPPPPPPSKTHEPSRRITPSPP 176 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 7/44 (15%) Frame = +2 Query: 5 PXPXXXPPPPP-------XPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPPP P P PPPP + P P PP Sbjct: 116 PLAITPSPPPPSKTHERSRPITPSPPPPSKTHEPSRPNTPPPPP 159 >At3g07540.1 68416.m00900 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 841 Score = 33.1 bits (72), Expect = 0.31 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPP 70 PPPPP P P PPP P Sbjct: 59 PPPPPSPPQPLPPPAP 74 >At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi domain-containing protein similar to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}, SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1013 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 129 RXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 R GGRG GG GGGGGG G GG G G Sbjct: 3 RGGYRGGRGDGRGRGGRGYGGGGGGGEQGRDRGYGGGEQGRG 44 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPP---PPP-PXNXPPXTXRGPRPPXLXXR 130 P PP PP P PP PPP P + PP P P L R Sbjct: 865 PQSQPPEPPPEMMPPPPQALPPPLPHSHPPLVPPPPFSPLLSPR 908 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PPPP PP P P P PP Sbjct: 870 PEPPPEMMPPPPQALPPPLPHSHPPLVPP--PP 900 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPP 70 P P PPP P P PPPP Sbjct: 879 PPPQALPPPLPHSHPPLVPPPP 900 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P P PPPP P P PP PP Sbjct: 872 PPPEMMPPPPQALPPPLPHSHPPLVPPP 899 >At1g26110.1 68414.m03186 expressed protein Length = 611 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GG G R G GGGGGG G G G G G Sbjct: 575 GGYGGRGYGGYGGRGGGGGGYGYGGRGQGRG 605 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGG-GGGGXGXXGXGGGGGXXXGXG 4 GGRG G GG GG G G G GGGG G G Sbjct: 561 GGRGGYGRNNGYSRGGYGGRGYGGYGGRGGGGGGYGYG 598 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP PPPP P + P PP Sbjct: 727 PKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPP 763 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 5/41 (12%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRP 112 P PPPP P P PPPP N PP P P Sbjct: 260 PYVYSSPPPPYYSPSPKPIYKSPPPPYVYNSPPPPYYSPSP 300 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 5/41 (12%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRP 112 P PPPP P P PPPP N PP P P Sbjct: 310 PYVYSFPPPPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSP 350 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 5/41 (12%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRP 112 P PPPP P P PPPP N PP P P Sbjct: 485 PYVYSSPPPPYYSPSPKPSYKSPPPPYVYNSPPPPYYSPSP 525 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P P P PP P PP S PP Sbjct: 383 PPPYVYSSPPPPYYSPSPKPVYKSPPPPYIYNSPPPPYYSPSPKPSYKSPPPP 435 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P P P PP P PP PP Sbjct: 108 PPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPP 160 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P P PPPP PPPP P + P PP + Sbjct: 375 PKPTYKSPPPPY-VYSSPPPPYYSPSPKPVYKSPPPPYI 412 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPP P P P + PP P PP Sbjct: 567 PPPPPYYSPSPKPAYKSSPPPYVYSSPPPP 596 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP PPPP P + P PP Sbjct: 200 PKPTYKSPPPPY-IYSSPPPPYYSPSPKPVYKSPPPP 235 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP PPPP P + P PP Sbjct: 300 PKPAYKSPPPPY-VYSFPPPPYYSPSPKPVYKSPPPP 335 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P P P PP P PP Sbjct: 483 PPPYVYSSPPPPYYSPSPKPSYKSPPPPYVYNSPPPP 519 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P P P PP P PP + PP Sbjct: 585 PPPYVYSSPPPPYYSPAPKPVYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPP 637 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P P P PP P PP + PP Sbjct: 635 PPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPP 687 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P P P PP P PP + PP Sbjct: 660 PPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAPKPTYKSPPPP 712 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P P P PP P PP + PP Sbjct: 685 PPPYVYSSPPPPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPP 737 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P P P PP P PP + PP Sbjct: 208 PPPYIYSSPPPPYYSPSPKPVYKSPPPPYVYSSPPPPYYSPSPKPAYKSPPPP 260 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P P P PP P PP Sbjct: 233 PPPYVYSSPPPPYYSPSPKPAYKSPPPPYVYSSPPPP 269 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 5/41 (12%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRP 112 P PPPP P P PPPP + PP P P Sbjct: 235 PYVYSSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSP 275 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPPP PPPP P + P PP Sbjct: 250 PKPAYKSPPPPY-VYSSPPPPYYSPSPKPIYKSPPPP 285 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P P P PP P PP + PP Sbjct: 258 PPPYVYSSPPPPYYSPSPKPIYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPP 310 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P P P PP P PP + PP Sbjct: 333 PPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPP 385 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P P P PP P PP Sbjct: 358 PPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPP 394 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 5/41 (12%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRP 112 P PPPP P P PPPP + PP P P Sbjct: 360 PYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSP 400 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P P P PP P PP + PP Sbjct: 408 PPPYIYNSPPPPYYSPSPKPSYKSPPPPYVYSSPPPPYYSPSPKLTYKSSPPP 460 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P P P PP P PP + PP Sbjct: 610 PPPYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPP 662 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P P P PP P PP Sbjct: 710 PPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPP 746 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPP PPPP P + P PP Sbjct: 785 PPPPYVYSSPPPPPYYSPSPKVEYKSPPPP 814 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/40 (35%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPX-TXRGPRPPXL 121 P P PP P PPPP + P T + P PP + Sbjct: 173 PSPKVDYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYI 212 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 5/41 (12%) Frame = +2 Query: 5 PXPXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRP 112 P PPPP P P PPPP + PP P P Sbjct: 185 PYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSP 225 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPP PPPP P T + P PP Sbjct: 107 PPPPYVYSSPPPPYYSPSPKPTYKSPPPP 135 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P P P PP P PP Sbjct: 183 PPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSPPPP 219 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P P P PP P PP + PP Sbjct: 308 PPPYVYSFPPPPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPP 360 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P PPPPP P PP Sbjct: 776 PSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPP 812 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/40 (35%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXT-XRGPRPPXL 121 P P PP P PPPP + P + P PP L Sbjct: 854 PSPKIEYKSPPPPYVYSSPPPPSYSPSPKAEYKSPPPPSL 893 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 6/36 (16%) Frame = +2 Query: 23 PPPP---PXPXXPXPPPPPPX---NXPPXTXRGPRP 112 PPPP P P PPPP + PP T P P Sbjct: 795 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYYSPSP 830 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 PPPP P P PP P PP A PP L Sbjct: 846 PPPPAYYSPSPKIEYKSPPPPYVYSSPPPPSYSPSPKAEYKSPPPPSL 893 >At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein similar to human splicing factor GB:CAA59494 GI:899298 from [Homo sapiens]; contains Pfam profile PF01805: Surp module Length = 735 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 35 PXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PPPPPP PP P P Sbjct: 641 PPPMAEMPPPPPPGEAPPPLPEEPEP 666 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXP 84 P PPPPPP PP P P Sbjct: 642 PPMAEMPPPPPPGEAPPPLPEEPEP 666 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = -3 Query: 107 GGPXGXXVGXSXGGVXGGXXXGGGGGGXG 21 GG G VG GG+ GG GG GGG G Sbjct: 72 GGWIGGSVGGFGGGIGGGFGGGGFGGGAG 100 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -2 Query: 111 GRGPRXVXG--GXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G + G G F GG GGG G G GGG G G Sbjct: 69 GAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGG 106 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXG 638 GG GG GG G G G G G G G G Sbjct: 83 GGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAGKG 118 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GGG G G GGG G G G Sbjct: 57 GGGGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGG 93 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGX-GXXGXAXXGEAXGGGXGG 635 GG + GG G GG G G G GGG GG Sbjct: 60 GGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGG 97 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G G GG GGG G GGG G G G Sbjct: 66 GGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKG 102 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GG G + V GG G GGG G G GGG Sbjct: 169 GGAG-KGVDGGAIGGIGGGAGKEIGGGIGGG 198 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 32.7 bits (71), Expect = 0.41 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG DA G G GG GGG G G G G GG G G Sbjct: 22 GYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRG 78 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GGRG GG GGGGG G GG G G Sbjct: 48 GGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGG 82 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GGRG R GG + GG GG G GGG G Sbjct: 57 GGRGNRGGGGGGYQGGDRGGRG-----SGGGGRDG 86 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 413 RGGGXGXXGGGXGXGG 366 RGGG G GGG G GG Sbjct: 382 RGGGRGGGGGGYGGGG 397 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 69 GGGGGXGXXGXGGGGG 22 GGG G G G GGGGG Sbjct: 383 GGGRGGGGGGYGGGGG 398 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 32.7 bits (71), Expect = 0.41 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GG DA G G GG GGG G G G G GG G G Sbjct: 22 GYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRG 78 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GGRG GG GGGGG G GG G G Sbjct: 48 GGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGG 82 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GGRG R GG + GG GG G GGG G Sbjct: 57 GGRGNRGGGGGGYQGGDRGGRG-----SGGGGRDG 86 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 413 RGGGXGXXGGGXGXGG 366 RGGG G GGG G GG Sbjct: 382 RGGGRGGGGGGYGGGG 397 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 69 GGGGGXGXXGXGGGGG 22 GGG G G G GGGGG Sbjct: 383 GGGRGGGGGGYGGGGG 398 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 32.7 bits (71), Expect = 0.41 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPP 73 P PPP P P PPP PP Sbjct: 421 PSPPPSPVQPPPPPSPP 437 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPP-PXNXPPXTXRGPRP 112 PPPP P PPP P PP P+P Sbjct: 410 PPPPVIEITRDPSPPPSPVQPPPPPSPPPQP 440 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 PP PPP PP PP + P P P PP Sbjct: 1133 PPSPPPQPPSSPPPPSSP---PQLAPAPPP 1159 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXT---XRGPRPP 115 PP P P PPP PP + PP + P PP Sbjct: 1126 PPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPP 1158 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP-PPPXNXPPXTXRGPRP 112 P P PP PP P PP PPP + PP P P Sbjct: 1127 PLPHESPPSPP----PQPPSSPPPPSSPPQLAPAPPP 1159 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXN-XPPXT 94 P P PPPP P P PPP + PP T Sbjct: 1138 PQPPSSPPPPSSPPQLAPAPPPSDHCLPPPT 1168 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 10 PXXPPXPPP-PPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP PPP PP P P+ PP Sbjct: 1134 PSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPP 1167 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P P PP PP P PP P PP Sbjct: 1126 PPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPP 1158 Score = 23.8 bits (49), Expect(2) = 8.8 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 367 PPXPXPPPXXPXPPP 411 PP P P P PPP Sbjct: 1133 PPSPPPQPPSSPPPP 1147 Score = 22.6 bits (46), Expect(2) = 8.8 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +1 Query: 505 PXXRPPPPXPXPAAXPXP 558 P PPPP P P P Sbjct: 1140 PPSSPPPPSSPPQLAPAP 1157 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GG G R GG GGG G G G GGGG Sbjct: 72 GGGGGRGYGGGGRREGGGYGGGDGGSYGGGG 102 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGG-GGGXGXXGXGGGGG 22 GG G GG GGG GGG G GGGGG Sbjct: 73 GGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 104 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 5 PXPXXXPPPPP--XPXXPXPPPPPPXNXPPXTXRGP 106 P P PPP P P P PPP P PP P Sbjct: 56 PMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASP 91 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 93 VXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 + GG GGG GG G GGG G G G Sbjct: 10 ISGGAGGGGGHGGGAGGGFGGGAGGGGGHG 39 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPP-XN---XPPXTXRGPRPP 115 PPPPP PPPPP N PP + P PP Sbjct: 65 PPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPP 99 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 7/44 (15%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP--XNXPPXT-----XRGPRPP 115 P P PPP P PPPPP N PP PRPP Sbjct: 47 PSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPP 90 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP-----XNXPPXTXRGPRPP 115 P P PP P P PPP P PP P PP Sbjct: 37 PQPYVYSPPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPP 78 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPP 88 P PPPPP PPP N PP Sbjct: 90 PYVYKSPPPPPFVYSSPPPPTYIYNSPP 117 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP---XNXPPXT--XRGPRPP 115 P P PP P PPPPP + PP T P PP Sbjct: 78 PPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIYNSPPPP 119 >At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226 DnaJ domain Length = 580 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGG G G G GGGG G G Sbjct: 26 GGGGHGGGGHGRGGHGRGGGGIFFFGGG 53 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXGXG 4 GGGGGG G G G GG G G Sbjct: 24 GGGGGGHGGGGHGRGGHGRGGGG 46 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGG 22 GG G GGGG G G G GGG Sbjct: 24 GGGGGGHGGGGHGRGGHGRGGG 45 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PPPP P P PPP P N R P P Sbjct: 67 PHPMMFSPPPPQP--PPPPPRPCFNGVSAAQRLPLP 100 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 32.7 bits (71), Expect = 0.41 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPP 73 PP PP P PPPPPP Sbjct: 218 PPKPPSPPRKPPPPPPP 234 Score = 32.7 bits (71), Expect = 0.41 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPP 73 P PP P P PPPPPP Sbjct: 219 PKPPSPPRKPPPPPPPP 235 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/56 (30%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXD-PPXLXP 175 P PP PP PPP + PP T PP + PP L P Sbjct: 11 PSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPP 66 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/58 (31%), Positives = 22/58 (37%), Gaps = 5/58 (8%) Frame = +2 Query: 5 PXPXXXP-PPPPXPXXPXPPPPP----PXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P P PPP P PPP P + PP + G P L ++ PP Sbjct: 34 PPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPP 91 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P PPP PP P P PP P Sbjct: 59 PLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSP 93 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPP 73 PPP P P PPPPP Sbjct: 217 PPPKPPSPPRKPPPPP 232 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/60 (30%), Positives = 20/60 (33%), Gaps = 7/60 (11%) Frame = +2 Query: 5 PXPXXXPPPPPX----PXXPXPPPPPPXN---XPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P PPP P P P P P P P T PR P +G + P Sbjct: 59 PLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSPNQGPPNTPSGSTP 118 Score = 28.7 bits (61), Expect = 6.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPP 67 P PP PP P PPPP Sbjct: 217 PPPKPPSPPRKPPPPPPPP 235 >At3g08640.1 68416.m01003 alphavirus core protein family contains Pfam profile: PF00944 alphavirus core protein Length = 337 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 95 GXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G G S G GG GGGGGG GG G Sbjct: 61 GGGGGGSTGNNGGGSGSGGGGGGFGGSGG 89 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 5/28 (17%) Frame = -2 Query: 72 GGGGGG-----XGXXGXGGGGGXXXGXG 4 GGGGGG G G GGGGG G G Sbjct: 61 GGGGGGSTGNNGGGSGSGGGGGGFGGSG 88 >At2g34670.1 68415.m04259 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 561 Score = 32.7 bits (71), Expect = 0.41 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPP 73 PP PP P PPPPPP Sbjct: 75 PPSPPPTLPPSPPPPPP 91 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXP 85 PP P P P PPPPP P Sbjct: 75 PPSPPPTLPPSPPPPPPFSP 94 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = +2 Query: 11 PXXXPPP--PPXPXXPXPPPPPPXNXPPXTXRGP--RPP 115 P PPP PP P P PPP + PP P +PP Sbjct: 334 PPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPP 372 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 5/42 (11%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGP--RPPXL 121 P PPP PP P P PPP PP P +PP L Sbjct: 367 PPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPL 408 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/56 (32%), Positives = 22/56 (39%), Gaps = 5/56 (8%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGP--RPPXLXXRGXASAAGXDPP 163 P PPP PP P P PPP + PP P +PP + + PP Sbjct: 434 PPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPP 489 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGP--RPPXL 121 P PPP PP P P PPP + PP P +PP + Sbjct: 350 PPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPI 391 Score = 32.3 bits (70), Expect = 0.54 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 7/44 (15%) Frame = +2 Query: 5 PXPXXXPP--PPPXPXXPXP---PP--PPPXNXPPXTXRGPRPP 115 P P PP PPP P P PP PPP PP T P PP Sbjct: 698 PTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPP-TPTTPSPP 740 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGP--RPP 115 P PPP PP P P PPP + PP P +PP Sbjct: 215 PPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPP 254 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/56 (32%), Positives = 21/56 (37%), Gaps = 5/56 (8%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGP--RPPXLXXRGXASAAGXDPP 163 P PPP PP P P PPP PP P +PP + + PP Sbjct: 484 PPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPP 539 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGP--RPP 115 P PPP PP P P PPP PP P +PP Sbjct: 131 PPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPP 170 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGP--RPP 115 P PPP PP P P PPP + PP P +PP Sbjct: 148 PPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 187 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGP--RPP 115 P PPP PP P P PPP + PP P +PP Sbjct: 198 PPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPP 237 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGP--RPP 115 P PPP PP P P PPP + PP P +PP Sbjct: 232 PPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPP 271 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGP--RPP 115 P PPP PP P P PPP PP P +PP Sbjct: 249 PPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPP 288 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGP--RPP 115 P PPP PP P P PPP + PP P +PP Sbjct: 534 PPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPP 573 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGP--RPP 115 P PPP PP P P PPP + PP P +PP Sbjct: 551 PPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 590 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGP--RPP 115 P PPP PP P P PPP + PP P +PP Sbjct: 568 PPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 607 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGP--RPP 115 P PPP PP P P PPP + PP P +PP Sbjct: 585 PPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 624 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGP--RPP 115 P PPP PP P P PPP + PP P +PP Sbjct: 602 PPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 641 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGP--RPP 115 P PPP PP P P PPP + PP P +PP Sbjct: 619 PPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 658 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGP--RPP 115 P PPP PP P P PPP PP P +PP Sbjct: 653 PPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPP 692 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGP--RPP 115 P PPP PP P P PPP PP P +PP Sbjct: 670 PPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPP 709 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGP--RPP 115 P PPP PP P P PPP PP P +PP Sbjct: 687 PPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPP 726 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGP 106 P PPP PP P P PPP + PP P Sbjct: 266 PPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSP 300 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 PP PP P PP PP P PP Sbjct: 506 PPIQKPPTPTYSPPIKPPPVKPPTPTYSPP 535 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 9/46 (19%) Frame = +2 Query: 5 PXPXXXPP--PPPXPXXPXP---PP--PPPXNXPPXTXRGP--RPP 115 P P PP PPP P P PP PPP PP P +PP Sbjct: 108 PTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPP 153 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 PP PP P PP PP P PP Sbjct: 170 PPVHKPPTPTYSPPIKPPVHKPPTPIYSPP 199 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +2 Query: 11 PXXXPP-PPPXPXXPXPPPPPPXNXPPXTXRGP--RPP 115 P PP PP P P PPP + PP P +PP Sbjct: 419 PIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPP 456 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 PP PP P PP PP P PP Sbjct: 456 PPVHKPPTPTYSPPIKPPPVKPPTPTYSPP 485 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PP P P P P P PP + P P Sbjct: 462 PTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTP 497 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PP P P P P P PP + P P Sbjct: 512 PTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTP 547 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 PP PP P PP PP P PP Sbjct: 322 PPVQKPPTPTYSPPIKPPPVKPPTPIYSPP 351 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +2 Query: 11 PXXXPPP---PPXPXXPXPPPPPPXNXPPXTXRGP 106 P PPP PP P P PPP PP P Sbjct: 384 PPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSP 418 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 8/45 (17%) Frame = +2 Query: 5 PXPXXXPP--PPPXPXXPXP---PP--PPPXNXPPXTXRGP-RPP 115 P P PP PPP P P PP PPP P T P +PP Sbjct: 495 PTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPP 539 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 9/46 (19%) Frame = +2 Query: 5 PXPXXXPP--PPPXPXXPXP---PP--PPPXNXPPXTXRGP--RPP 115 P P PP PPP P P PP PPP PP P +PP Sbjct: 630 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPP 675 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PP P P P P P PP + P P Sbjct: 328 PTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTP 363 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP P PP PP PP PT P P P Sbjct: 461 PPTPTYSPPIKPPPVKPP--TPTYSPPVQPPP 490 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPP-XTPPXEXPTXXPXGPP 108 P PP PP P PP PP + P PP Sbjct: 469 PIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPP 502 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 7/41 (17%) Frame = +2 Query: 5 PXPXXXPP--PPPXPXXPXP---PP--PPPXNXPPXTXRGP 106 P P PP PPP P P PP PPP PP P Sbjct: 91 PTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSP 131 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = +2 Query: 11 PXXXPP--PPPXPXXPXPPPPPPXNXPPXTXRGP--RPP 115 P PP PP P P PPP + PP P +PP Sbjct: 182 PPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPP 220 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +2 Query: 5 PXPXXXPP--PPPXPXXPXPPPPPPXNXPP 88 P P PP PPP P P PP PP Sbjct: 311 PTPTYSPPIKPPPVQKPPTPTYSPPIKPPP 340 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +2 Query: 5 PXPXXXPP--PPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P PP PPP P P PP PP + P P Sbjct: 378 PTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQ-KPPTP 414 Score = 29.1 bits (62), Expect = 5.1 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 8/45 (17%) Frame = +2 Query: 5 PXPXXXPP--PPPXPXXPXP---PP--PPPXNXPPXTXRGP-RPP 115 P P PP PPP P P PP PPP P T P +PP Sbjct: 445 PTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPP 489 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PP P PP PP PP PT P P P Sbjct: 511 PPTPTYSPPIKPPPVKPP--TPTYSPPIKPPP 540 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 4/39 (10%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPP----XEXPTXXPXGPPXP 114 P PP PP P PP PP PT P P P Sbjct: 519 PIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 557 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPP--XEXPTXXPXGPPXP 114 P PPPP PP PP + PT P P P Sbjct: 53 PSYTTPPPPIYSPPIYPPPIQKPPTYSPPIYPPP 86 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP P PP PP P PT P P P Sbjct: 474 PVKPPTPTYSPPVQPPPVQKP-PTPTYSPPVKPPP 507 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/31 (38%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +1 Query: 19 PPXPPPPPPXXXPPX-TPPXEXPTXXPXGPP 108 PP PP P PP +PP + P PP Sbjct: 288 PPVHKPPTPTYSPPVKSPPVQKPPTPTYSPP 318 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTP-PXEXPTXXPXGPP 108 P P PPPPPP PP P P P PP Sbjct: 56 PHSPSPPPPPPPQWGPPSPHYPQGQPYSSPAYPP 89 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTP-PXEXPTXXPXGPP 108 P P PPPPPP PP P P P PP Sbjct: 56 PHSPSPPPPPPPQWGPPSPHYPQGQPYSSPAYPP 89 >At1g65440.1 68414.m07424 glycine-rich protein Length = 1647 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/60 (30%), Positives = 20/60 (33%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGGXRXXXXXXXXXXGXGGXXXGXGG 566 G GG+ GG + GG G G GGG G GG G GG Sbjct: 1537 GKKTGGGSTGGWGSESGGNKSDGAGSWGSGSGGGGSGGWGNDSGGKKSSEDGGFGSGSGG 1596 >At1g21310.1 68414.m02662 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 431 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP--XNXPPXTXRGPRPP 115 P P PPPP PPPP PP P PP Sbjct: 50 PPPVYHSPPPPKKHYEYKSPPPPVKHYSPPPVYHSPPPP 88 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP--XNXPPXTXRGPRPP 115 P P PPPP PPPP PP P PP Sbjct: 78 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 116 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP--XNXPPXTXRGPRPP 115 P P PPPP PPPP PP P PP Sbjct: 106 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 144 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP--XNXPPXTXRGPRPP 115 P P PPPP PPPP PP P PP Sbjct: 134 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 172 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP--XNXPPXTXRGPRPP 115 P P PPPP PPPP PP P PP Sbjct: 162 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 200 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP--XNXPPXTXRGPRPP 115 P P PPPP PPPP PP P PP Sbjct: 190 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 228 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP--XNXPPXTXRGPRPP 115 P P PPPP PPPP PP P PP Sbjct: 218 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 256 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP--XNXPPXTXRGPRPP 115 P P PPPP PPPP PP P PP Sbjct: 246 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 284 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP--XNXPPXTXRGPRPP 115 P P PPPP PPPP PP P PP Sbjct: 274 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 312 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP--XNXPPXTXRGPRPP 115 P P PPPP PPPP PP P PP Sbjct: 302 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 340 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP--XNXPPXTXRGPRPP 115 P P PPPP PPPP PP P PP Sbjct: 330 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 368 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP--XNXPPXTXRGPRPP 115 P P PPPP PPPP PP P PP Sbjct: 358 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 396 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 G GG G G G + GG GG GGG GG Sbjct: 75 GLGGGGGGLGGGGGGLLGGGGFGGGAGGGLGG 106 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG GGGGG G G GGG G G Sbjct: 80 GGGLGGGGGGLLGGGGFGGGAGGGLG 105 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -2 Query: 84 GXFXGGGGGGXGXXGXG--GGGGXXXGXG 4 G GGGGGG G G G GGGG G G Sbjct: 73 GLGLGGGGGGLGGGGGGLLGGGGFGGGAG 101 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G G G +G GG+ GG GGGG GG G Sbjct: 67 GIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAG 101 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G G G G GG GG GGGGGG G G Sbjct: 63 GIGAGIGAGAGLGLGG--GGGGLGGGGGGLLGGGG 95 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G GG G G G G GGGGG G G Sbjct: 52 GLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGG 87 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 111 GRGPRXVXGGXFXG-GGGGGXGXXGXGGGGGXXXGXG 4 G G GG G GGGGG G G GGG G G Sbjct: 69 GAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGGLG 105 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G G G GGG G G GGGGG G G Sbjct: 60 GGLGIGAGIGAGAGLGLGGGGGGLG-GGGGGLLGGGG 95 >At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein similar to beta-glucan-elicitor receptor GI:1752734 from [Glycine max] Length = 745 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/44 (34%), Positives = 18/44 (40%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXAS 142 P PP PP P P P PP + + R P L R +S Sbjct: 20 PKNRPPSPPPPLPLPPSPSPPPSQQMSSSRQKNTPFLFPRSDSS 63 >At4g23140.2 68417.m03338 receptor-like protein kinase 5 (RLK5) identical to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam domain PF00069: Protein kinase domain; identical to cDNA receptor-like protein kinase 5 (RLK5) GI:13506746 Length = 680 Score = 32.3 bits (70), Expect = 0.54 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPP 72 P PP PPPPPP TPP Sbjct: 254 PPLPPPPPPPPPRESLVSTPP 274 >At4g23140.1 68417.m03337 receptor-like protein kinase 5 (RLK5) identical to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam domain PF00069: Protein kinase domain; identical to cDNA receptor-like protein kinase 5 (RLK5) GI:13506746 Length = 674 Score = 32.3 bits (70), Expect = 0.54 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPP 72 P PP PPPPPP TPP Sbjct: 254 PPLPPPPPPPPPRESLVSTPP 274 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP---PPPXNXPPXTXRGPRPP 115 P P P PPP P P PPP PPP + T P PP Sbjct: 102 PAPIVNPNPPP-PSTPNPPPEFSPPPPDL--DTTTAPPPP 138 Score = 31.9 bits (69), Expect = 0.72 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +2 Query: 26 PPPPXPXX-PXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P PP P P PPPP N PP P PP L D P P Sbjct: 99 PNPPAPIVNPNPPPPSTPNPPPEF--SPPPPDLDTTTAPPPPSTDIPIPPP 147 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPP---PXNXPPXTXRGPRPP 115 P P PPPP PPPP P PP PP Sbjct: 118 PPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASPP 157 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = +2 Query: 26 PPPPXPXXPXPPPPP-PXN-XPPXT 94 PPPP P PPPPP P + PP T Sbjct: 135 PPPPSTDIPIPPPPPAPVSASPPLT 159 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P P P P PP P + T P PP Sbjct: 66 PFPNPNPNPNPNPPVLGSSPPSPTDSSSSTSISPNPP 102 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 22 PXPPPPPPXXXPPXTPPXEXPT 87 P PPP P PP TPP T Sbjct: 145 PPPPPAPVSASPPLTPPSSVVT 166 >At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1 predicted transmembrane domain; Length = 175 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGG 25 G G G GGGGGG G G GGGG Sbjct: 144 GGGSHGHGCGGGGGGGGGGLGGGGCGGGG 172 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 84 GXFXGGGGGGXGXXGXGGGGGXXXG 10 G GGGGGG G G G GGG G Sbjct: 151 GCGGGGGGGGGGLGGGGCGGGGCGG 175 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 733 AGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 +GG G G GG G G G GGG GG Sbjct: 143 SGGGSHGHGCGGGGGGGGGGLGGGGCGGGGCGG 175 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXGXG 4 GGG G G G GGGGG G G Sbjct: 144 GGGSHGHGCGGGGGGGGGGLGGG 166 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 69 GGGGGXGXXGXGGGGGXXXGXG 4 GGGGG G G GGGG G G Sbjct: 153 GGGGGGGGGGLGGGGCGGGGCG 174 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 95 GXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G S GG G GGGGGG GG G Sbjct: 137 GSASSCSGGGSHGHGCGGGGGGGGGGLGG 165 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GGG G G G GGG G G Sbjct: 145 GGSHGHGCGGGGGGGGGGLGGGGCGGGG 172 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGG-GXGXXGXGGGGG 22 GG GG GGGGG G G G GG GG Sbjct: 144 GGGSHGHGCGGGGGGGGGGLGGGGCGGGGCGG 175 >At2g28440.1 68415.m03455 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; + Length = 268 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 P P P P PPPPPP P + P P Sbjct: 131 PASSPKPESLADSPSPPPPPPQPESPSSPSYPEP 164 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 22 PXPPPPPPXXXPPXTPPXEXPTXXP 96 P PPPPPP P +P P P Sbjct: 144 PSPPPPPPQPESPSSPSYPEPAPVP 168 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -2 Query: 132 PRXXXXGGRGPRXVXG--GXFXGGGGGGXGXXGXGGGGG 22 PR GG GP G G GGGGG G G GGG Sbjct: 78 PRPGGGGGPGPGPWSGPRGPRPGGGGGPGSGCGSGTGGG 116 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G RGPR GG G G GGGGG G G Sbjct: 74 GPRGPRPGGGGGPGPGPWSGPRGPRPGGGGGPGSGCG 110 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = -2 Query: 159 GSXPAADAXPRXXXXGG-RGPRXVXGGXFXGGGGGGXGXXGXGGGG 25 G P P G RGPR GG G G G G G GG Sbjct: 77 GPRPGGGGGPGPGPWSGPRGPRPGGGGGPGSGCGSGTGGGNQGQGG 122 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 132 PRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 P GGRGPR G G G GGGGG G Sbjct: 49 PGGPGFGGRGPRGPGFGPRGPGPWSGPRGPRPGGGGGPGPG 89 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G G GGGGG G GGG G G G Sbjct: 176 GGYGGNPPYSGNAVGGGGGYGSNFGGGGGYGVAGGVG 212 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 138 AXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 A R GGRG GG GG G G GGG G G Sbjct: 109 ATERGSGFGGRGFGGPGGGYGASDGGYGAPAGGYGGGAGGYGG 151 >At1g55540.1 68414.m06356 proline-rich family protein contains proline rich extensin domain, INTERPRO:IPR002965 Length = 915 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/36 (47%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -1 Query: 745 GGXAAGGAXGGXX--AGXGGXGXXGXAXXGEAXGGG 644 GG A G+ GG AG GG G G G+A GGG Sbjct: 857 GGFAPQGSSGGFAGAAGGGGFGGFGGQAQGQAGGGG 892 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 84 GXFXGGGGGGXGXXGXGGGG 25 G GGGGGG G G G GG Sbjct: 836 GAAPGGGGGGFGGLGSGTGG 855 >At5g24316.1 68418.m02864 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 125 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXT 94 P P P P PPPPPP PP T Sbjct: 101 PKRPMPYVP-PPPPPPTRRPPFT 122 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 P P PPP P PPP PP P P A PP + P Sbjct: 24 PAPTPTATPPPATPPPVATPPPVATPPPAATPAPATP---PPAATPAPATTPPSVAP 77 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 31.9 bits (69), Expect = 0.72 Identities = 22/59 (37%), Positives = 23/59 (38%), Gaps = 2/59 (3%) Frame = -2 Query: 174 GXKXGGSXPAADAXPRXXXXGG-RGPRXVXG-GXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G G S + P GG GP G G F G GGG G G G G G G G Sbjct: 37 GYGGGYSGVGDNGLPFGGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLG 95 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G GG GG GG G G GG G Sbjct: 61 GPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLG 95 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 G AGG GG G G G G G G G G Sbjct: 70 GFGGAGGGLGGGLGGGAGSGLGGGLGGGSGIGAGTSG 106 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 742 GXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 G GG GG G G G G GGG GG Sbjct: 49 GLPFGGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGG 84 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = -1 Query: 745 GGXAAGGAXGGXXAGXGGXGXXGXAXXGEAXGGGXGG 635 GG GG GG +G GG G G + G GG G Sbjct: 75 GGGLGGGLGGGAGSGLGG-GLGGGSGIGAGTSGGSTG 110 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GG GGG G G GGG G G G Sbjct: 75 GGGLGGGLGGGAGS-GLGGGLGGGSGIG 101 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 PPPP PPPP P T + P PP + Sbjct: 392 PPPPYIYNSPPPPPYYSPSPKITYKSPPPPYI 423 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/40 (35%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXT-XRGPRPPXL 121 P P PP P PPPPP + P + P PP + Sbjct: 245 PSPKVNYKSPPPPYVYSSPPPPPYSPSPKVEFKSPPPPYI 284 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 PPPP PPPP P + P PP + Sbjct: 366 PPPPYVYNSPPPPPYYSPFPKVEYKSPPPPYI 397 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPP PPPP P + P PP Sbjct: 176 PPPPYVYSSPPPPPYYSPSPKVEYKSPPPP 205 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PPP P P P PP P PP Sbjct: 255 PPPYVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPP 291 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPP PPPP P + P PP Sbjct: 150 PPPPYIYSSPPPPPYYSPSPKVDYKSPPPP 179 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 6/37 (16%) Frame = +2 Query: 23 PPPP------PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 PPPP P P PPPPP P T PP Sbjct: 331 PPPPYVYNSLPPPYVYNSPPPPPYYSPSPTVNYKSPP 367 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P PPPPP P PP Sbjct: 167 PSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPP 203 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P PPPPP P PP Sbjct: 219 PSPKVGYKSPPAPYVYSSPPPPPYYSPSPKVNYKSPP 255 >At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 161 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P P P P P PPPP + P R PP Sbjct: 32 PSPKPKPVPSPKPKPVQCPPPPRPSVPSPNPRPVTPP 68 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +2 Query: 5 PXPXXXPPPPPXPXX-PXPPPPPPXNXPPXTXRGPRPP 115 P P P P P P P PP P + P PR P Sbjct: 34 PKPKPVPSPKPKPVQCPPPPRPSVPSPNPRPVTPPRTP 71 >At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / heat shock transcription factor 7 (HSTF7) identical to heat shock factor protein 7 (HSF7) SP:Q9T0D3 from [Arabidopsis thaliana] Length = 377 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 107 GGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 GG G G S G G GGGG G GG G Sbjct: 17 GGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGGG 49 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGG 22 G G GGGG G G GGGGG Sbjct: 29 GSSGCGAGGGGGGSGGGGGGGG 50 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 G G G G S G GG GGGGG GG Sbjct: 19 GAGCSAGNSGGSSGCGAGGGGGGSGGGGGGGG 50 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GG G G G G GG G GGGGG Sbjct: 18 GGAGCSAGNSGGSSGCGAGGGGGGSGGGGGG 48 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -2 Query: 132 PRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 P GG G G GG G G G GGG G G G Sbjct: 10 PTVAGVGGGGAGCSAGN---SGGSSGCGAGGGGGGSGGGGGGG 49 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 104 GPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G G G S G G G GGGG G G Sbjct: 14 GVGGGGAGCSAGNSGGSSGCGAGGGGGGSGGG 45 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPT 87 P P PPPPPP PP P T Sbjct: 68 PPSPSPPPPPPPRPPPPPLSPGSETT 93 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLXP 175 PP P P PPPPPP PP G +S PP P Sbjct: 68 PPSPSP----PPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPP 113 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPT 87 P P PPPPP PP +P E T Sbjct: 69 PSPSPPPPPPPRPPPPPLSPGSETTT 94 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 4 TXPXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 T PP PPPPPP P T P P PP Sbjct: 100 TSSVLPPPPPPPPPPPPPSSTWDFWDPFIPP--PP 132 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 31 PPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 PPPPP PP P P PP P Sbjct: 105 PPPPPPPPPPPPPSSTWDFWDPFIPPPP 132 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPP 67 P P PPPPP P PPPP Sbjct: 69 PSPSPPPPPPPRP----PPPP 85 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPP 70 P PPPPP P PPPPP Sbjct: 68 PPSPSPPPPPP----PRPPPPP 85 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P PP PPPPP T T PP P Sbjct: 74 PPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPP 108 >At3g11402.1 68416.m01388 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 708 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPP 70 P P PPPPP P PPPPP Sbjct: 60 PLPRHYPPPPP----PLPPPPP 77 Score = 25.4 bits (53), Expect(2) = 3.4 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 28 PPPPPPXXXPP 60 PPPPPP PP Sbjct: 66 PPPPPPLPPPP 76 Score = 25.0 bits (52), Expect(2) = 5.6 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 376 PXPPPXXPXPPP 411 P PPP P PPP Sbjct: 66 PPPPPPLPPPPP 77 Score = 22.6 bits (46), Expect(2) = 3.4 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 10 PXXPPXPPPP 39 P PP PPPP Sbjct: 32 PPPPPPPPPP 41 Score = 22.2 bits (45), Expect(2) = 5.6 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 367 PPXPXPPPXXP 399 PP P PPP P Sbjct: 34 PPPPPPPPVLP 44 >At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 341 Score = 31.9 bits (69), Expect = 0.72 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPP 73 PPPPP P PPPP P Sbjct: 24 PPPPPPPSSSLPPPPLP 40 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXE 78 PP PPPPP PP P E Sbjct: 23 PPPPPPPPSSSLPPPPLPTE 42 >At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 388 Score = 31.9 bits (69), Expect = 0.72 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPP 73 PPPPP P PPPP P Sbjct: 24 PPPPPPPSSSLPPPPLP 40 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXE 78 PP PPPPP PP P E Sbjct: 23 PPPPPPPPSSSLPPPPLPTE 42 >At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 359 Score = 31.9 bits (69), Expect = 0.72 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPP 73 PPPPP PPPPPP Sbjct: 24 PPPPPYYYLDPPPPPPP 40 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPP 88 PPP P PPPPP PP Sbjct: 24 PPPPPYYYLDPPPPPPPFPP 43 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXP 85 PPPP PPPPPP P Sbjct: 24 PPPPPYYYLDPPPPPPPFPP 43 >At1g35617.1 68414.m04424 hypothetical protein Length = 121 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 630 RXPPXPPPXASPXXAXPXXPXPPXP 704 R PP PPP +S P P PP P Sbjct: 20 RPPPAPPPESSSPPTPPEPPDPPDP 44 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPP 88 PPP P P PP PP PP Sbjct: 21 PPPAPPPESSSPPTPPEPPDPP 42 >At1g27090.1 68414.m03302 glycine-rich protein Length = 420 Score = 31.9 bits (69), Expect = 0.72 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 162 GGSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 G D PR RG R G GGGG G G GGGGG G Sbjct: 325 GAENAKRDYVPRGSYQNQRGRR----GARRGGGGYQNGRGGRGGGGGYQNG 371 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 31.9 bits (69), Expect = 0.72 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTP 69 P PP PPPPPP P +P Sbjct: 29 PPPPPLPPPPPPRQSHPESP 48 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 41 PXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXAS 142 P P PPPPP PP P P L R S Sbjct: 24 PSAPLPPPPPLPPPPPPRQSHPESPNLYGRSTQS 57 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +2 Query: 11 PXXXPPPPPXPXXPX-PPPPPPXNXPP 88 P PP P P P PPPPPP P Sbjct: 19 PHLHPPSAPLPPPPPLPPPPPPRQSHP 45 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPPXNXP 85 P PPPPP P PPPPP + P Sbjct: 23 PPSAPLPPPPPLP----PPPPPRQSHP 45 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 370 PXPXPPPXXPXPPPR 414 P P PPP P PPPR Sbjct: 27 PLPPPPPLPPPPPPR 41 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXP 96 PP P PPP PP PP + P Sbjct: 23 PPSAPLPPPPPLPPPPPPRQSHPESP 48 >At5g66960.1 68418.m08442 prolyl oligopeptidase family protein similar to OpdB [Treponema denticola] GI:13786054; contains Pfam profiles PF00326: prolyl oligopeptidase family, PF02897: Prolyl oligopeptidase, N-terminal beta-propeller domain Length = 792 Score = 31.5 bits (68), Expect = 0.95 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTP 69 P PP PPPPP PP P Sbjct: 27 PKSPPPPPPPPALPKPPKKP 46 >At5g56140.1 68418.m07003 KH domain-containing protein Length = 315 Score = 31.5 bits (68), Expect = 0.95 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGG 22 GGGGGG G GGGGG Sbjct: 10 GGGGGGGSGGGIGGGGG 26 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGG 22 GGGGGG G G G GGG Sbjct: 8 GGGGGGGGGSGGGIGGG 24 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGG 22 GGGGGG G G GGGG Sbjct: 9 GGGGGGGGSGGGIGGGG 25 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGG 28 GG GGGG G G G GGG Sbjct: 8 GGGGGGGGGSGGGIGGGGGG 27 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 84 GXFXGGGGGGXGXXGXGGGG 25 G GGGGG G G GGGG Sbjct: 8 GGGGGGGGGSGGGIGGGGGG 27 >At5g53060.1 68418.m06592 KH domain-containing protein Length = 652 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 102 PRXVXGGXFXGGGGGGXGXXGXGGGGG 22 PR F GGGGG G GGGGG Sbjct: 26 PRYNNNYHFGGGGGGNNRYRGGGGGGG 52 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXG 10 GGGGGG GGGGG G Sbjct: 35 GGGGGGNNRYRGGGGGGGGNG 55 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/46 (36%), Positives = 19/46 (41%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P P P PP PPP + P T P PP G S+ PP Sbjct: 42 PCSPVQSSPPPPSPPPPSTP--TTACPPPPSPPSSGGGSSYYYPPP 85 Score = 31.5 bits (68), Expect = 0.95 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 636 PPXPPPXASPXXAXPXXPXPP 698 PP PPP ++P A P P PP Sbjct: 52 PPSPPPPSTPTTACPPPPSPP 72 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPP 73 P PPPP P PPPP P Sbjct: 51 PPPSPPPPSTPTTACPPPPSP 71 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P P PPPP PP TP P P PP Sbjct: 42 PCSPVQSSPPPPSPPPPSTPTTACP--PPPSPP 72 >At5g22790.1 68418.m02664 expressed protein Length = 433 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -3 Query: 104 GPXGXXVGXSXGGVXGGXXXGGGGGGXG 21 G G G + GG GG GGGGGG G Sbjct: 101 GDGGDENGNNDGGGNGGNGDGGGGGGDG 128 >At5g02600.2 68418.m00195 heavy-metal-associated domain-containing protein low similarity to gi:3168840 copper homeostasis factor; contains Pfam heavy-metal-associated domain PF00403; predicted proteins, Arabidopsis thaliana Length = 319 Score = 31.5 bits (68), Expect = 0.95 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXN 79 PPPPP P PP PP N Sbjct: 227 PPPPPSPPQSSPPSPPEKN 245 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPP 72 PP PPPP P P +PP Sbjct: 225 PPPPPPPSPPQSSPPSPP 242 >At5g02600.1 68418.m00196 heavy-metal-associated domain-containing protein low similarity to gi:3168840 copper homeostasis factor; contains Pfam heavy-metal-associated domain PF00403; predicted proteins, Arabidopsis thaliana Length = 319 Score = 31.5 bits (68), Expect = 0.95 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXN 79 PPPPP P PP PP N Sbjct: 227 PPPPPSPPQSSPPSPPEKN 245 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPP 72 PP PPPP P P +PP Sbjct: 225 PPPPPPPSPPQSSPPSPP 242 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PP P PPPP P RGP PP +G PP Sbjct: 151 PQLSAPPIIRPPGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPP 201 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +2 Query: 11 PXXXPPPPPX-----PXXPXPPPPPPXNXPPXTXRGPRPPXLXXR 130 P PPPP P PPPP PP GP PP R Sbjct: 162 PGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQR 206 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXP-PXTXRGPRP 112 PPPP PPPP P P P PRP Sbjct: 219 PPPPPHGMQGPPPPRPGMPPAPGGFAPPRP 248 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PP P PPPP P RGP PP +G PP Sbjct: 151 PQLSAPPIIRPPGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPP 201 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +2 Query: 11 PXXXPPPPPX-----PXXPXPPPPPPXNXPPXTXRGPRPPXLXXR 130 P PPPP P PPPP PP GP PP R Sbjct: 162 PGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQR 206 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXP-PXTXRGPRP 112 PPPP PPPP P P P PRP Sbjct: 219 PPPPPHGMQGPPPPRPGMPPAPGGFAPPRP 248 >At4g03390.1 68417.m00461 leucine-rich repeat transmembrane protein kinase, putative similar to Z. mays leucine-rich repeat transmembrane protein kinase LRRTPK 1, GenBank accession number AF023164 Length = 776 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 PP PPPPPP PP P E T P P Sbjct: 427 PPPPPPPPP---PPPPPLDEKVTVMPIISP 453 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGP 105 PP PPPPPP P P P P Sbjct: 428 PPPPPPPPPPPPPLDEKVTVMPIISPERP 456 Score = 28.3 bits (60), Expect = 8.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 10 PXXPPXPPPPPP 45 P PP PPPPPP Sbjct: 427 PPPPPPPPPPPP 438 Score = 28.3 bits (60), Expect = 8.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 10 PXXPPXPPPPPP 45 P PP PPPPPP Sbjct: 428 PPPPPPPPPPPP 439 Score = 28.3 bits (60), Expect = 8.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 10 PXXPPXPPPPPP 45 P PP PPPPPP Sbjct: 429 PPPPPPPPPPPP 440 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 31.5 bits (68), Expect = 0.95 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPP 88 P PPPP P PPPPP P Sbjct: 10 PPPPPPPPSFRSIPRPPPPPSFRSIP 35 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 31.5 bits (68), Expect = 0.95 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +2 Query: 23 PPPPPXPXXPXPPPP---PPXNX-----PPXTXRGPRPPXLXXRGXASAAGXDPP 163 PPPP P PPP PP N PP G PP A+ G PP Sbjct: 283 PPPPNNMGGPRHPPPYGAPPQNNMGGPRPPQNYGGTPPPNYGGAPPANNMGGAPP 337 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXN---XPPXTXRGPRPP 115 PPP P PPPPP PP G PP Sbjct: 241 PPPQRPPMGGPPPPPHIGGSAPPPPHMGGSAPP 273 Score = 29.5 bits (63), Expect = 3.8 Identities = 22/66 (33%), Positives = 24/66 (36%), Gaps = 15/66 (22%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPP-------PPPXN-------XPPXTXRGPR-PPXLXXRGXASA 145 P PPPPP PPP PPP + PP GPR PP + Sbjct: 247 PMGGPPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPPPYGAPPQNNM 306 Query: 146 AGXDPP 163 G PP Sbjct: 307 GGPRPP 312 >At2g28500.1 68415.m03463 LOB domain protein 11 / lateral organ boundaries domain protein 11 (LBD11) identical to SP|Q9SK08 LOB domain protein 11 {Arabidopsis thaliana} Length = 229 Score = 31.5 bits (68), Expect = 0.95 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP 64 P P PPPPP P P PP Sbjct: 28 PSPTSSPPPPPSPQQPPQPP 47 >At2g18470.1 68415.m02151 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 633 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/36 (38%), Positives = 16/36 (44%), Gaps = 6/36 (16%) Frame = +2 Query: 26 PPPPXPXXPXPP------PPPPXNXPPXTXRGPRPP 115 PP P P P PP PPP + P + P PP Sbjct: 30 PPAPSPPSPTPPQGDSSSSPPPDSTSPPAPQAPNPP 65 >At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family protein Length = 558 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PPPPPP PP P PP Sbjct: 255 PFAPPTPPPPPP---PPPPRPLAKAARAQKSPP 284 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PP P P PPPPPP R + P Sbjct: 255 PFAPPTP--PPPPPPPPPRPLAKAARAQKSP 283 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 5/22 (22%) Frame = +2 Query: 23 PPPPPXPXXPXP-----PPPPP 73 PPPPP P P P PPPPP Sbjct: 222 PPPPPPPSQPLPRPLLLPPPPP 243 >At1g17790.1 68414.m02202 DNA-binding bromodomain-containing protein similar to SP|P13709 Female sterile homeotic protein (Fragile-chorion membrane protein) {Drosophila melanogaster}; contains Pfam profile PF00439: Bromodomain Length = 487 Score = 31.5 bits (68), Expect = 0.95 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXP 85 P P P P PPPPPP P Sbjct: 271 PSPSPSSPPPPPPPPVAAP 289 >At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family protein Common family member: At2g32840 [Arabidopsis thaliana] Length = 332 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGP 105 P P PPP PP PP PT P P Sbjct: 25 PVTPVNTVRPPPSQPPPAPPPLPPPTYRPIAP 56 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPPXNXPPXTXRGPRP 112 PPP P PP PPP P R P P Sbjct: 34 PPPSQPPPAPPPLPPPTYRPIAPLRHPNP 62 >At3g50190.1 68416.m05488 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 463 Score = 25.8 bits (54), Expect(2) = 1.2 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 56 PPPPPPXNXPPXTXRGPRPP 115 PPPPPP PP GP+ P Sbjct: 10 PPPPPP---PPQLPFGPKLP 26 Score = 23.8 bits (49), Expect(2) = 1.2 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 32 PPXPXXPXPPPPPP 73 P P PPPPPP Sbjct: 4 PSKRRSPPPPPPPP 17 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +2 Query: 5 PXPXXXPP--PPPXPXXPXPPPPPPXNXPPXTXRGPRPPXL 121 P P P P P PPPPPP P P PP L Sbjct: 330 PQPTLPPQLVEPSRVQSPSPPPPPPVIQPELPQPQPPPPQL 370 >At5g58540.1 68418.m07330 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 484 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 P PPPPP P P PT P PP Sbjct: 83 PLLPPPPPEGNETPSPPRSGVPTQTPETPP 112 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 3/52 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP---PPPPXNXPPXTXRGPRPPXLXXRGXASAAG 151 P PPP P PP PP P PP G PP G A G Sbjct: 33 PQQGYPPPPGAYPPAGYPPGAYPPAPGGYPPAPGYGGYPPAPGYGGYPPAPG 84 >At5g25550.1 68418.m03040 leucine-rich repeat family protein / extensin family protein similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana]; contains Pfam PF00560: Leucine Rich Repeat domains Length = 433 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +2 Query: 11 PXXXPPPP-PXPXXPXPPPPPPXNXPP 88 P PPP P P PPPPPP + P Sbjct: 404 PLSTPPPARPCPPVYSPPPPPPLSLAP 430 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXGPPXP 114 P P P P P P TPP P PP P Sbjct: 389 PSSQPLAPAPSPTSPPLSTPPPARPCPPVYSPPPP 423 >At5g12470.1 68418.m01465 expressed protein Length = 386 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 111 GRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 G G GG GGGGGG G G G G Sbjct: 65 GNGGSDNNGGGLSGGGGGGDGGKNDGDGHG 94 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPP-----PPP-XNXPPXTXRGPRP 112 P P PPPP P PPP PPP PP + P P Sbjct: 384 PPPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPPPSP 425 >At3g56990.1 68416.m06344 glycine-rich protein conserved hypothetical protein SPCC330.09 - Schizosaccharomyces pombe, PIR:T41319 Length = 711 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -2 Query: 105 GPRXVXGGXFXG-GGGGGXGXXGXGGGGG 22 G R GG F G GGGG G G GGG G Sbjct: 679 GFRGRGGGGFRGRGGGGSRGKGGRGGGRG 707 >At3g56140.1 68416.m06240 expressed protein At2g40400 - Arabidopsis thaliana, EMBL:AC007020 Length = 745 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPP 67 P PPPPP P PPPP Sbjct: 102 PAESAAPPPPPATTTPSPPPP 122 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXN 79 P PPP P P PPPP N Sbjct: 102 PAESAAPPPPPATTTPSPPPPVN 124 >At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, putative strong similarity to L-galactono-1,4-lactone dehydrogenase, Brassica oleracea, Z97060 [gi:2760543], and gi:3986289 from Ipomea batatas Length = 610 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPP 73 PPPPP P PPPPPP Sbjct: 44 PPPPPP---PRPPPPPP 57 Score = 28.7 bits (61), Expect = 6.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXT 66 PP PPPP P PP T Sbjct: 44 PPPPPPPRPPPPPPAT 59 Score = 28.3 bits (60), Expect = 8.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 10 PXXPPXPPPPPP 45 P PP PPPPPP Sbjct: 46 PPPPPRPPPPPP 57 >At3g24650.1 68416.m03095 abscisic acid-insensitive protein 3 (ABI3) identical to abscisic acid-insensitive protein 3 GI:16146 SP:Q01593 from [Arabidopsis thaliana], (Plant Cell 4 (10), 1251-1261 (1992)) Length = 720 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP--PPPPXNXPPXTXRGPRPP 115 P P P P P PP PPPP + P + P PP Sbjct: 373 PAPNYPPQPEFLPLLESPPSWPPPPQSGPMPHQQFPMPP 411 >At3g16350.1 68416.m02068 myb family transcription factor ; contains Pfam profile: PF00249 Myb-like DNA-binding domain Length = 387 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 71 GGVXGGXXXGGGGGGXGG 18 GG GG GGGGGG GG Sbjct: 23 GGTCGGSGGGGGGGGGGG 40 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGG 25 GG GG GGG G G GG G Sbjct: 22 GGGTCGGSGGGGGGGGGGGSG 42 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 66 GGGGXGXXGXGGGGGXXXGXG 4 GGG G G GGGGG G G Sbjct: 22 GGGTCGGSGGGGGGGGGGGSG 42 >At3g08630.1 68416.m01002 expressed protein Length = 339 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 95 GXXVGXSXGGVXGGXXXGGGGGGXGG 18 G G S G GG GGGGGG GG Sbjct: 61 GGGGGGSIGNHGGGSGSGGGGGGYGG 86 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPP P PPP PP P PP Sbjct: 542 PLPPPARARPLPPPARARPMPPPARARPLPP 572 >At2g28670.1 68415.m03485 disease resistance-responsive family protein / fibroin-related contains similarity to silk fibroin heavy chain [Bombyx mori] gi|765323|gb|AAB31861; contains disease resistance response protien domain Pfam:FP03018 Length = 447 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = -2 Query: 144 ADAXPRXXXXGGRGPRXVXG---GXFXGGGGGGXGXXGXGGGGGXXXGXG 4 A A P G GP G G GGGG G G GGG G G Sbjct: 147 AGAGPALGGGAGAGPALGGGAGAGSALGGGGAGAGPALGGGGAGAGPALG 196 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -2 Query: 159 GSXPAADAXPRXXXXGGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G P A + P GG G G G G G G G G G G G Sbjct: 96 GLLPTASSVPGSLAGGGSGSLPTTGSA-TGAGAGTGSALGGGPGAGSALGGG 146 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG G GG GG G G G G G G G G Sbjct: 165 GGAGAGSALGG---GGAGAGPALGGGGAGAGPALGGG 198 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 107 GGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 GG G GG G GGGG G G G Sbjct: 164 GGGAGAGSALGGGGAGAGPALGGGGAGAGPALG 196 >At2g11005.1 68415.m01177 glycine-rich protein Length = 170 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 GG GGGG G G G G GGG G G Sbjct: 15 GGGSGGGGGSGDG-SGSGDGGGSGDGGG 41 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 84 GXFXGGGGGGXGXXGXGGGGGXXXGXG 4 G GGG GG G G G G G G G Sbjct: 11 GSGDGGGSGGGGGSGDGSGSGDGGGSG 37 >At1g19960.1 68414.m02501 expressed protein Length = 64 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -3 Query: 101 PXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 P G + GG+ GG GGGGG G G Sbjct: 4 PSGQSSTTTVGGIAGGSGCNGGGGGSGSGSG 34 >At1g12810.1 68414.m01488 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 129 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 5/40 (12%) Frame = +2 Query: 11 PXXXPPPP-----PXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P PPP P P P PPPP PP G PP Sbjct: 8 PESYPPPGYQSHYPPPGYPSAPPPPGYPSPPSHHEGYPPP 47 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGPRPP 115 P P PP P P PP PP G PP Sbjct: 22 PPGYPSAPPPPGYPSPPSHHEGYPPPQPYGGYPPP 56 >At2g46300.1 68415.m05759 expressed protein Length = 252 Score = 25.0 bits (52), Expect(2) = 1.3 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 56 PPPPPPXNXPPXTXRGPRP 112 PPPPPP P P P Sbjct: 25 PPPPPPIQQQPMRKAVPMP 43 Score = 24.6 bits (51), Expect(2) = 1.3 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPP 73 PP P PPPPPP Sbjct: 13 PPGYRDPNMSSPPPPPP 29 >At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 561 Score = 27.1 bits (57), Expect(2) = 1.6 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 32 PPXPXXPXPPPPPP 73 PP P PPPPPP Sbjct: 359 PPLVYSPPPPPPPP 372 Score = 25.4 bits (53), Expect(2) = 4.4 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPP 73 PP P PPPPPP Sbjct: 359 PPLVYSPPPPPPPPPP 374 Score = 24.6 bits (51), Expect(2) = 3.4 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPP 70 PP P P PPPPP Sbjct: 359 PPLVYSPPPPPPPPPP 374 Score = 23.4 bits (48), Expect(2) = 3.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 50 PXPPPPPP 73 P PPPPPP Sbjct: 395 PPPPPPPP 402 Score = 22.2 bits (45), Expect(2) = 1.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 56 PPPPPPXNXP 85 PPPPPP P Sbjct: 394 PPPPPPPPPP 403 Score = 22.2 bits (45), Expect(2) = 4.4 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 59 PPPPPXNXPP 88 PPPPP PP Sbjct: 394 PPPPPPPPPP 403 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 4/34 (11%) Frame = +1 Query: 19 PPXPPPPPP----XXXPPXTPPXEXPTXXPXGPP 108 PP PP PPP PP PP + P PP Sbjct: 219 PPPPPGPPPKEQDFVRPPLPPPPQLPQSSQPPPP 252 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +2 Query: 5 PXPXXXPP--PPPXPXXPXPPPPPP 73 P P PP PPP P PP PPP Sbjct: 378 PRPPYGPPPGPPPMMRPPLPPGPPP 402 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/57 (33%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = +2 Query: 5 PXPXXXP-PPPPXPXXPXPP-PPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P P P PP P P PPPP PP RPP ++ PP L Sbjct: 198 PLPPLPPLPPTTGLTLPHSPFPPPPPGPPPKEQDFVRPPLPPPPQLPQSSQPPPPGL 254 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 567 PPXPXXXPPXXXXXXXXXXXXRXPPXPPPXASPXXAXPXXPXPP 698 PP P P R P PPP P P P PP Sbjct: 358 PPPPLDMHPPHPGMFVGHLIPRPPYGPPPGPPPMMRPPLPPGPP 401 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 10 PXXPPXPPPPPPXXXPPXTPPXEXPTXXPXG 102 P P PPP PP P PP P+ G Sbjct: 378 PRPPYGPPPGPPPMMRPPLPPGPPPSSFQDG 408 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 34 PPPPXXXPPXTPPXEXPTXXPXGPP 108 P PP PP PP P P PP Sbjct: 378 PRPPYGPPPGPPPMMRPPLPPGPPP 402 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 30.7 bits (66), Expect = 1.7 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 10/61 (16%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPP----------XNXPPXTXRGPRPPXLXXRGXASAAGXDPPXLX 172 PPPP P P PPPP P RGP PP S G PP Sbjct: 173 PPPPYGMRPPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQGPPPSRPGMPPPGGA 232 Query: 173 P 175 P Sbjct: 233 P 233 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/56 (32%), Positives = 20/56 (35%), Gaps = 5/56 (8%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPP----PP-XNXPPXTXRGPRPPXLXXRGXASAAGXDPP 163 P PP PP PPPP PP PP G + P + G PP Sbjct: 158 PGQMPPQPPFAGQGGPPPPYGMRPPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPP 213 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTPPXEXPTXXPXGPP 108 PP PP PP PP + P + P PP Sbjct: 364 PPNPPRQPPSHPPPGSAPSQQYYNAPPTPP 393 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +1 Query: 19 PPXPPPPPPXXX--PPXTPPXEXPTXXPXGPP 108 PP PPPP PP PP + P PP Sbjct: 312 PPYQPPPPTQSLHQPPYQPPPQQPQYPQQPPP 343 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDPPXL 169 P P P PP PP + PP + AS G PP L Sbjct: 235 PTAQPPASLPQPPASAAAPPSLTQQGLPPQQFIQPPASQHGLSPPSL 281 >At4g32340.1 68417.m04603 expressed protein Length = 238 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 105 GPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 G R GG GG GG G G GGGGG G Sbjct: 79 GSRLPQGGS--NGGFGGRGGDGAGGGGGGGGG 108 >At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi|20465684|gb|AY096677.1| Length = 158 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXGXV 3 G G G G GGV G GG GGG GG G V Sbjct: 57 GVGAGLGGVAG-GVGGVAGVLPVGGVGGGIGGLGGGV 92 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGGXXG 9 G GG G +G GG+ G G G GG GG G Sbjct: 100 GLGG--GSGLGHGVGGIGGDPGIGSGIGGLGGAGG 132 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -2 Query: 87 GGXFXGGGGGGXGXXGXGG-GGGXXXGXG 4 GG G GGG G G GG GGG G G Sbjct: 82 GGGIGGLGGGVGGLGGLGGLGGGSGLGHG 110 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GGR R GGGGGG G GGGG G Sbjct: 559 GGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGGG 593 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 G GG G G G GGGGGG GG Sbjct: 62 GGGGASGGGYRNDGGRTGYGYGAGGGGGGGGG 93 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXGXG 4 GGGGGG G GGGG G G Sbjct: 574 GGGGGGGGSDYYGGGGYGGGGYG 596 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG G G + GGGG G G G GG G Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGGYGGAPSGGYGAG 606 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GGR R GGGGGG G GGGG G Sbjct: 559 GGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGGG 593 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 113 GXGGPXGXXVGXSXGGVXGGXXXGGGGGGXGG 18 G GG G G G GGGGGG GG Sbjct: 62 GGGGASGGGYRNDGGRTGYGYGAGGGGGGGGG 93 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 72 GGGGGGXGXXGXGGGGGXXXGXG 4 GGGGGG G GGGG G G Sbjct: 574 GGGGGGGGSDYYGGGGYGGGGYG 596 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGGXXXG 10 GG G G + GGGG G G G GG G Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGGYGGAPSGGYGAG 606 >At3g55950.1 68416.m06217 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to cytokinin-regulated kinase 1 [Nicotiana tabacum] gi|10998537|gb|AAG25966 Length = 814 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 11 PXXXPPPPPXPXXPXPPPPPPXNXPPXTXRGP 106 P P PP P PPPPPP P T P Sbjct: 357 PIQFPASPPSQF-PLPPPPPPPPPSPSTSSPP 387 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPPPPPP 73 P PP P P PPPPPP Sbjct: 357 PIQFPASPPSQFPLPPPPPPPPP 379 Score = 28.7 bits (61), Expect = 6.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 5 PXPXXXPPPPPXPXXPXPP 61 P P PPPPP P PP Sbjct: 369 PLPPPPPPPPPSPSTSSPP 387 >At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 300 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGGG 22 GGRG G GGGG G G GGGGG Sbjct: 82 GGRGQSS--SDRRGGYGGGGSGYGGGGGGGG 110 >At3g49300.1 68416.m05388 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 86 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 23 PPPPPXPXXPXPPP 64 PPPPP P P PPP Sbjct: 70 PPPPPPPLSPPPPP 83 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 4/30 (13%) Frame = +2 Query: 11 PXXXPPPPPXPXXPX----PPPPPPXNXPP 88 P P P P P PPPPPP + PP Sbjct: 52 PEPGPDPKHDPTKPGYGFPPPPPPPLSPPP 81 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +2 Query: 5 PXPXXXPP-PPPXPXXPXPPPPPPXNXPP 88 P P P P P PPPPPP PP Sbjct: 52 PEPGPDPKHDPTKPGYGFPPPPPPPLSPP 80 Score = 29.1 bits (62), Expect = 5.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 364 GPPXPXPPPXXPXPPPR 414 G P P PPP P PPP+ Sbjct: 68 GFPPPPPPPLSPPPPPK 84 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 26 PPPPXPXXPXPPPPPP 73 PPPP P P PPPPP Sbjct: 70 PPPPPP--PLSPPPPP 83 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 29 PPPXPXXPXPPPPPPXN 79 PPP P PPPPP N Sbjct: 70 PPPPPPPLSPPPPPKMN 86 >At3g46740.1 68416.m05074 chloroplast outer envelope protein, putative similar to chloroplastic outer envelope membrane protein (OEP75) [Pisum sativum] GI:633607; contains Pfam profile PF01103: outer membrane protein, OMP85 family Length = 818 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/22 (63%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -2 Query: 72 GGGGGGXG-XXGXGGGGGXXXG 10 GGGGGG G G GGGGG G Sbjct: 102 GGGGGGDGNFGGFGGGGGGGDG 123 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 102 PRXVXGGXFXGGGGGGXGXXGXGGGGGXXXGXG 4 P + GG GGG G G G GGGGG G Sbjct: 97 PSVLTGGG--GGGDGNFGGFGGGGGGGDGNDGG 127 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 132 PRXXXXGGRGPRXVXGGXFXGGGGGGXGXXG 40 P GG G GG F GGGGGG G G Sbjct: 97 PSVLTGGGGGGDGNFGG-FGGGGGGGDGNDG 126 >At3g45540.1 68416.m04918 zinc finger (C3HC4-type RING finger) family protein contains a Prosite:PS00518 Zinc finger, C3HC4 type (RING finger), signature Length = 348 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +1 Query: 19 PPXPPPPPPXXXPPXTP 69 PP PPPPPP PP TP Sbjct: 306 PPRPPPPPP--SPPPTP 320 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = +2 Query: 23 PPPPPXPXXPXPPPPPPXNXPPXTXRGPRPPXLXXRGXASAAGXDP--PXLXP 175 PPPPP PPP P T PR AS +G +P P + P Sbjct: 57 PPPPPKAPVNVSLSPPPPPRSPSTSTPPRLGNRNPPPPASPSGQEPTTPTMTP 109 >At3g07195.1 68416.m00858 proline-rich family protein Length = 225 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 78 FXGGGGGGXGXXGXGGGGGXXXGXG 4 + GGG GG G G G GG G G Sbjct: 94 YGGGGSGGGGRSGSGSAGGLYGGYG 118 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGG----GGGXXXGXG 4 GG+G GG GG G G G G G GGG G G Sbjct: 256 GGKGAPAAGGGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGG 296 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 730 GGAXGGXXAGXGGXGXXGXAXXGEAXGGGXG 638 GGA GG AG G G G G GG G Sbjct: 266 GGAGGGKGAGGGAKGGPGNQNQGGGKNGGGG 296 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 114 GGRGPRXVXGGXFXGGGGGGXGXXGXGGGG 25 GG G + GG GGG G G GGGG Sbjct: 280 GGPGNQNQGGGKNGGGGHPQDGKNGGGGGG 309 >At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 177 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 2/19 (10%) Frame = +2 Query: 23 PPPPPXP--XXPXPPPPPP 73 PPPPP P P PP PPP Sbjct: 125 PPPPPYPRQVHPQPPAPPP 143 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.309 0.147 0.529 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,698,782 Number of Sequences: 28952 Number of extensions: 366997 Number of successful extensions: 24543 Number of sequences better than 10.0: 371 Number of HSP's better than 10.0 without gapping: 1188 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10407 length of database: 12,070,560 effective HSP length: 82 effective length of database: 9,696,496 effective search space used: 2559874944 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (21.9 bits)
- SilkBase 1999-2023 -