BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A16 (876 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 39 0.005 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 39 0.006 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 39 0.006 02_05_0686 - 30900748-30902167,30903442-30904742 38 0.014 03_01_0515 - 3864796-3865425 37 0.018 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 36 0.032 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 36 0.043 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 36 0.056 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 35 0.074 09_06_0125 - 21011757-21012428 35 0.098 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 35 0.098 12_02_1174 - 26696869-26698191 34 0.13 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 34 0.13 03_05_0630 + 26260159-26260272,26260520-26260894 34 0.17 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 33 0.23 06_03_0790 - 24636805-24637770 33 0.23 06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 33 0.23 04_03_0833 + 20147242-20147849,20147937-20148081,20148157-201482... 33 0.23 03_06_0599 + 34984869-34985319,34986581-34987563 33 0.23 03_01_0023 + 198414-198968 33 0.23 02_04_0400 - 22608519-22608844,22609044-22609122 33 0.23 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 33 0.30 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 33 0.30 03_05_0704 - 26953474-26953643,26953770-26953801,26953915-269540... 33 0.30 08_01_0059 - 394001-394708 33 0.40 07_03_1090 + 23891294-23892222,23892317-23892516,23895241-238954... 33 0.40 06_03_1326 - 29355467-29355817 33 0.40 04_01_0034 - 401208-402923 33 0.40 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 33 0.40 01_07_0122 - 41196081-41196205,41197561-41198245,41198961-411993... 33 0.40 07_01_0080 + 587674-588510 32 0.52 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 32 0.52 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 32 0.52 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 32 0.52 12_01_0135 + 1042889-1044255,1045368-1045809 32 0.69 11_01_0133 + 1121392-1122731,1123417-1123858 32 0.69 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 32 0.69 08_02_0839 + 21693348-21694853 32 0.69 06_01_0931 + 7192519-7194075 32 0.69 02_05_0750 - 31479876-31480985 32 0.69 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 32 0.69 11_01_0066 - 536281-537196,537397-537452 31 0.92 08_02_1256 + 25645085-25645396 31 0.92 07_03_1710 - 28903614-28903673,28904982-28905146,28905453-289056... 31 0.92 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 31 0.92 01_05_0490 + 22672241-22674679 31 0.92 10_08_0553 - 18720436-18720494,18721102-18721106,18721136-187212... 31 1.2 10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526,595... 31 1.2 09_02_0543 + 10427321-10428315,10428440-10429154 31 1.2 07_01_0516 - 3850252-3852870 31 1.2 06_01_0486 - 3455030-3455770 31 1.2 06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-38... 31 1.2 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 31 1.2 04_04_0146 + 23106325-23108154 31 1.2 04_03_0925 - 20856628-20856690,20856786-20856845,20856924-208570... 31 1.2 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 31 1.6 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 31 1.6 09_04_0506 - 18188785-18190599 31 1.6 07_03_0154 + 14509979-14512033 31 1.6 06_01_0178 + 1386981-1387505 31 1.6 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 31 1.6 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 31 1.6 04_04_0053 + 22389227-22389613,22390528-22390981,22391618-223916... 31 1.6 04_03_0804 - 19844059-19844777,19844914-19844995,19846580-19846585 31 1.6 03_02_0786 - 11169820-11170158,11170245-11170433,11171173-111714... 31 1.6 03_02_0631 + 9969841-9969868,9969965-9970082,9970186-9970828,997... 31 1.6 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 31 1.6 12_02_1219 + 27096477-27096590,27096704-27097078 30 2.1 12_01_0252 + 1868670-1869200,1870167-1871120 30 2.1 11_01_0252 + 1934505-1935032,1936001-1936957 30 2.1 10_08_1008 - 22222051-22222377,22222479-22222640,22223179-222233... 30 2.1 07_03_0600 + 19866757-19867218,19867920-19868429 30 2.1 07_01_0862 - 7172083-7172931 30 2.1 05_06_0078 - 25412770-25413852 30 2.1 04_04_0679 + 27214577-27215023 30 2.1 02_01_0130 - 938530-939990 30 2.1 06_03_0214 + 18067945-18068463,18068940-18069839,18069918-18070652 25 2.5 10_08_0630 - 19410852-19411235,19411370-19412257,19412440-194129... 30 2.8 07_01_1123 - 10385215-10385574,10385676-10385810,10386385-103870... 30 2.8 06_03_0696 + 23617687-23617851,23618838-23619536 30 2.8 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 30 2.8 05_01_0380 + 2978256-2979284 30 2.8 03_03_0008 - 13674602-13674708,13675272-13675439,13676169-136767... 30 2.8 02_05_0860 - 32296743-32296769,32297328-32297357,32298432-322985... 30 2.8 02_04_0056 + 19313422-19313967,19314035-19314168,19314263-193143... 30 2.8 01_01_0070 - 542603-542686,542803-543441 30 2.8 10_08_0213 - 15912048-15912716 29 3.7 10_07_0161 - 13674631-13675433,13675793-13675862 29 3.7 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 29 3.7 08_01_1038 + 10540185-10540709 29 3.7 07_03_1636 + 28290642-28291574 29 3.7 07_03_1573 + 27829967-27830338,27830821-27831510,27831594-278317... 29 3.7 07_03_0890 - 22332768-22333382 29 3.7 07_03_0527 - 19085828-19086319 29 3.7 06_02_0126 + 12130409-12130532,12131015-12131373 29 3.7 06_02_0120 + 12055076-12055175,12055322-12055725 29 3.7 05_01_0351 + 2750253-2751042,2751951-2751958,2752122-2752149,275... 29 3.7 04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 29 3.7 04_03_0098 + 11183039-11183752 29 3.7 02_03_0227 + 16601538-16601908,16603197-16603378,16603495-166035... 29 3.7 01_07_0081 - 40959279-40959375,40959463-40959589,40960138-409603... 29 3.7 01_06_1758 - 39681942-39682030,39682115-39682345,39682643-396826... 29 3.7 01_02_0031 + 10364487-10365407 29 3.7 01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827,896... 27 4.2 10_08_0936 - 21679002-21679800,21679893-21680116,21681174-216813... 29 4.9 06_03_1368 - 29612463-29612638,29613135-29613222,29613334-296134... 29 4.9 06_01_1013 - 7931756-7935109 29 4.9 06_01_0760 - 5676973-5677830 29 4.9 06_01_0690 + 5033943-5034740 29 4.9 05_07_0280 - 28920864-28920971,28921076-28921175,28921267-289213... 29 4.9 05_06_0026 - 25024807-25025300,25025432-25025495,25025567-250256... 29 4.9 04_01_0607 + 7955026-7955664 29 4.9 04_01_0500 - 6540769-6541482,6541819-6541877,6541965-6542064,654... 29 4.9 03_05_1153 + 30787574-30787608,30787982-30788089,30788651-307886... 29 4.9 03_02_0784 - 11154395-11154888,11155284-11155360,11155447-111554... 29 4.9 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 29 4.9 02_05_0246 + 27136590-27138610,27138933-27139056,27139401-271396... 29 4.9 02_04_0021 + 18975992-18976408 29 4.9 02_02_0240 + 8196140-8198248,8198381-8198650 29 4.9 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 29 4.9 01_06_1827 + 40169001-40169263,40169358-40169472,40170090-401702... 29 4.9 01_01_0929 - 7344911-7345978 29 4.9 12_02_0299 - 17051570-17052474,17053542-17053755 29 6.5 12_01_0477 + 3742751-3745200,3747192-3747502,3747886-3748232 29 6.5 12_01_0442 + 3495333-3496484 29 6.5 11_06_0610 - 25449085-25453284 29 6.5 10_08_0214 - 15915156-15915713 29 6.5 09_06_0148 - 21214460-21214561,21214993-21215339,21215428-212155... 29 6.5 09_06_0083 + 20753191-20754480 29 6.5 09_02_0369 - 8012470-8013120 29 6.5 08_02_1615 + 28257275-28258428,28258523-28259144 29 6.5 07_03_1382 - 26170563-26170631,26171151-26171843 29 6.5 07_03_1160 - 24430240-24431268 29 6.5 07_03_0559 + 19475893-19476783 29 6.5 06_01_0944 + 7264833-7265120,7265511-7265600,7265702-7265798,726... 29 6.5 05_02_0081 + 6432957-6433289,6433367-6433882,6434283-6434570 29 6.5 04_04_1641 + 34993807-34994589,34994924-34995022,34995521-349956... 29 6.5 04_04_1126 + 31095651-31096115 29 6.5 04_01_0069 - 697811-697876,697956-698166,698265-698359,698448-69... 29 6.5 03_02_0738 - 10824121-10825572 29 6.5 02_01_0158 - 1103461-1104186 29 6.5 01_05_0024 - 17262504-17263308,17264251-17264399,17264879-172649... 29 6.5 01_01_0720 - 5593311-5595371,5597550-5598027,5598118-5598146 29 6.5 12_02_0848 + 23636478-23638058 28 8.5 12_01_0841 - 7873458-7874225 28 8.5 08_02_0410 - 16842306-16842950,16844994-16845182 28 8.5 08_01_0774 + 7482311-7482919,7484012-7484077,7484211-7484384,748... 28 8.5 08_01_0134 + 1067826-1068158 28 8.5 06_03_1310 + 29238644-29240260 28 8.5 06_02_0271 + 13618149-13618297,13618311-13618560 28 8.5 06_01_0824 - 6219477-6219556,6220427-6220808,6221415-6221448,622... 28 8.5 04_04_0233 + 23801944-23802598,23802914-23803047,23803548-238037... 28 8.5 03_06_0289 - 32870581-32871238,32871271-32871275 28 8.5 03_06_0212 + 32400982-32402055 28 8.5 03_05_0690 + 26778567-26778804,26778950-26779024,26779995-267800... 28 8.5 03_05_0576 + 25765137-25766420 28 8.5 03_03_0106 - 14500935-14501263,14501357-14501432,14501531-14501542 28 8.5 03_02_0027 + 5100865-5100878,5102241-5102708,5102795-5103021,510... 28 8.5 01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 28 8.5 01_01_0715 - 5542648-5543219,5543352-5543544 28 8.5 01_01_0046 - 331758-332627 28 8.5 01_01_0796 + 6190931-6192745 23 9.4 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -1 Query: 864 GXGPXXXFVFFXXGGGGGXXAXGRGGXGGXXGGXRXG 754 G P VFF GGGGG G GG GG GG G Sbjct: 32 GSAPDWLVVFFVGGGGGGRGRGGGGGGGGGYGGGGVG 68 Score = 33.1 bits (72), Expect = 0.30 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = -1 Query: 834 FXXGGGGGXXAXGRGGX--GGXXGGXRXGXXVC 742 + GGGGG G GG GG GG R G VC Sbjct: 98 YGGGGGGGRGGGGGGGGRGGGGRGGGRDGDWVC 130 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXGGXRXG 754 GGGGG GRGG GG G G Sbjct: 80 GGGGGYGGGGRGGGGGGGYGGGGG 103 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P PP PP PP P PPPPP + P P P Sbjct: 1150 PSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPPLP 1189 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P L P PP PP P PPP P P P P Sbjct: 1173 PPLSPSLPPPPPPPPLPSGPPPQPAPPPLPIQPPPIPPPP 1212 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 743 QTXXPXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQ 868 Q P PP PP PP PPPPP GP PQ Sbjct: 1157 QPPLPPSPPPATPPPPPPLSPSLPPPPP---PPPLPSGPPPQ 1195 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP P PP P + PPPP P P P Sbjct: 1164 PPPATPPPPPPLSPSLPPPPPPPPLPSGPPPQPAPP 1199 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP P PP P P PPP + G P P Sbjct: 1192 PPPQPAPPPLPIQPPPIPPPPVPSSPSSLGYQPPAP 1227 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P L PP PP PP P P P P + P P P Sbjct: 1177 PSLPPP--PPPPPLPSGPPPQPAPPPLPIQPPPIPPPPVP 1214 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 747 PXXPFSXPPXXPLXPPXPXRGXPPP 821 P P PP P PP P PPP Sbjct: 1147 PPLPSDSPPCQPPLPPSPPPATPPP 1171 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGP 859 P PP PP PP P PPPPP KK P Sbjct: 355 PPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAP 389 Score = 36.3 bits (80), Expect = 0.032 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPP-PXXKKTKXXXGPXPQXP 874 P L PP PP PP P PPPP P G P P Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAP 389 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PP PP P PP PP P P P Sbjct: 355 PPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 Score = 31.5 bits (68), Expect = 0.92 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKT 841 P PP PP PP P PPP K T Sbjct: 365 PPPPPPPRPPPPPPPIKKGAPPPAPPKAT 393 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 747 PXXPFSXPPXXPLXPPXPXRGXPPPXXXXK 836 P P PP P PP P R PPP K Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPPPIKK 382 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKT---KXXXGPXPQXP 874 P PP PP+P A PPPPP K GP P P Sbjct: 311 PAPPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPP 349 Score = 35.9 bits (79), Expect = 0.043 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 755 PXLXPPXXPPX--PPRPXAXXPPPPPXXKKTKXXXGPXP 865 P PP PP PP P A PPPPP K P P Sbjct: 332 PKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPP 370 Score = 35.5 bits (78), Expect = 0.056 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P P PP PP P PPPPP K GP P P Sbjct: 345 PPPPPAKGPPPPPPPKGPSPPPPPPPGGKK--GGPPPPPP 382 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 779 PPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PP A PPPP GP P P Sbjct: 327 PPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPP 358 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPP-PXXKKTKXXXGPXPQXP 874 P PP P PP P PPPP GP P P Sbjct: 327 PPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPP 367 >03_01_0515 - 3864796-3865425 Length = 209 Score = 37.1 bits (82), Expect = 0.018 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PP PP P A PPPPP P P Sbjct: 85 PPPLPPPPPPPAASPPPPPPSPPPPSPVKSSPPPPP 120 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +2 Query: 755 PXLXPPXXPPX----PPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P + PP PP PP P PPPPP P P P Sbjct: 68 PLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPPSP 111 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P P PP PP P PPPP P P Sbjct: 63 PPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPP 102 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGP 859 P L PP PP P PPPP K+ P Sbjct: 86 PPLPPPPPPPAASPPPPPPSPPPPSPVKSSPPPPP 120 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P P PP PP PPPPP P P Sbjct: 64 PAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPP 103 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXA---XXPPPPPXXKKTKXXXGPXPQXP 874 P PP PP P A PPPPP + P P P Sbjct: 50 PLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPP 92 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 36.3 bits (80), Expect = 0.032 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P PP PP P PPPPP T P P P Sbjct: 345 PSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPP 380 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P P P PP P PPPPP K P P P Sbjct: 340 PRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPP 379 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +2 Query: 755 PXLXPPXXPPXPPR---PXAXXPPPPPXXKKTKXXXGPXPQXP 874 P PP PP PP+ PPPPP P P P Sbjct: 353 PPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVPSNNNLPKPAEP 395 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 35.9 bits (79), Expect = 0.043 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 779 PPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PPRP PPPPP K GP P P Sbjct: 614 PPPPPRPPGAPPPPPPPGK----PGGPPPPPP 641 Score = 31.5 bits (68), Expect = 0.92 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPP 826 P PP PP PP P PPPP Sbjct: 616 PPPRPPGAPPPPPPPGKPGGPPPP 639 Score = 28.3 bits (60), Expect = 8.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPP 826 P P PP PP PPPPP Sbjct: 617 PPRPPGAPPPPPPPGKPGGPPPPP 640 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 35.5 bits (78), Expect = 0.056 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP P PP P A PPPPP P P P Sbjct: 585 PPPEPSPPPAPKAAPPPPPPKSTGPGPPRPPPPAMP 620 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +2 Query: 755 PXLXPPXXPPXP-PRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P P PP P P P PPPP K T GP P P Sbjct: 578 PLKASPVPPPEPSPPPAPKAAPPPPPPKST----GPGPPRP 614 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPP--PXXKKTKXXXGPXPQXP 874 P PP PP P PPPP P KT+ P P P Sbjct: 595 PKAAPPPPPPKSTGPGPPRPPPPAMPGSSKTRP---PPPLKP 633 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 35.1 bits (77), Expect = 0.074 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKT 841 PP PP PP P PPPPP T Sbjct: 75 PPQTPPSPPPPPPPPPPPPPPLSPT 99 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 770 PXXPPXPPRPXAXXPPPPP 826 P P PP P PPPPP Sbjct: 73 PPPPQTPPSPPPPPPPPPP 91 >09_06_0125 - 21011757-21012428 Length = 223 Score = 34.7 bits (76), Expect = 0.098 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 761 LXPPXXPPXPPRPXAXXPPPPP 826 L PP PP PPR PPPPP Sbjct: 166 LPPPSPPPPPPRAPFLAPPPPP 187 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 34.7 bits (76), Expect = 0.098 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPP 826 PP PP PP P PPPPP Sbjct: 106 PPPPPPPPPSPPPSAPPPPP 125 Score = 33.1 bits (72), Expect = 0.30 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPP 826 PP PP P P A PPPPP Sbjct: 108 PPPPPPPSPPPSAPPPPPPP 127 Score = 31.9 bits (69), Expect = 0.69 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPP 826 PP PP P P + PPPPP Sbjct: 107 PPPPPPPPSPPPSAPPPPPP 126 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 779 PPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PP+ PPPPP P P P Sbjct: 82 PPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPP 113 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +2 Query: 770 PXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P PP P + PPPPP + P P P Sbjct: 92 PPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPP 126 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/37 (37%), Positives = 17/37 (45%), Gaps = 7/37 (18%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPP-------PPPXXKKTK 844 P PP PP PP P PP PPP +++K Sbjct: 113 PPSPPPSAPPPPPPPPTQPPPREAQLAPPPPREQQSK 149 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/37 (32%), Positives = 13/37 (35%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXP 865 P PP P PP PPPP + P P Sbjct: 106 PPPPPPPPPSPPPSAPPPPPPPPTQPPPREAQLAPPP 142 >12_02_1174 - 26696869-26698191 Length = 440 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTK-XXXGPXPQXP 874 P + P P PP P PPPPP K P PQ P Sbjct: 142 PPVKPQPPPSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPP 182 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +2 Query: 755 PXLXPPXXPPXPP-RPXAXXPP---PPPXXKKTKXXXGPXPQXP 874 P L PP PP PP RP + PP P P T P P P Sbjct: 183 PSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPPPPPP 226 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 7/47 (14%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPP-------PPPXXKKTKXXXGPXPQXP 874 P PP PP PPRP + PP PPP + P + P Sbjct: 153 PPPPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPPTRPP 199 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPP--PPXXKKTKXXXGPXPQXP 874 P L P PP PPR PP PP K P P P Sbjct: 117 PALSPVPPPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPP 158 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTK-XXXGPXPQXP 874 P + P PP +P + PPPP K P PQ P Sbjct: 173 PVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPP 213 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 746 TXXPXLXPPXXPPXPPRPXAXXPPPPPXXKKT 841 T P + PP P P P PP PP T Sbjct: 196 TRPPSVKPPVVQPKPQPPPTLPPPSPPPPPPT 227 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPP 826 P PP P PP PPPPP Sbjct: 137 PPHRPPPVKPQPPPSLPPPPPPPP 160 Score = 28.3 bits (60), Expect = 8.5 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P P PP PP P PP P T P PQ P Sbjct: 210 PQPPPTLPPPSPPPPPPTVPPRTPG--DTPAVVEPKPQPP 247 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXP 865 P L PP PP PP P P + K P P Sbjct: 214 PTLPPPSPPPPPPTVPPRTPGDTPAVVEPKPQPPPPP 250 Score = 28.3 bits (60), Expect = 8.5 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = +2 Query: 755 PXLXPPXXPPXPPR----PXAXXPPPPPXXKKTKXXXGPXPQXP 874 P PP P PP P A PP P K P PQ P Sbjct: 265 PSPPPPSPLPPPPEDYWSPTAVTPPEPTKPKPPPPSPPPPPQQP 308 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 34.3 bits (75), Expect = 0.13 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPP 826 PP PP PP P PPPPP Sbjct: 49 PPRPPPPPPPPTQPAPPPPP 68 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +2 Query: 770 PXXPPXPPRPXAXXPPPPPXXKKTKXXXG 856 P PP PP P PPPP ++ G Sbjct: 49 PPRPPPPPPPPTQPAPPPPPPARSGGGGG 77 >03_05_0630 + 26260159-26260272,26260520-26260894 Length = 162 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 822 GGGGXXAXGRGGXGGXXGGXRXG 754 GGGG GRGG GG GG R G Sbjct: 128 GGGGGYGGGRGGGGGGYGGSRGG 150 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXGGXRXG 754 GGGGG GRGG GG GG G Sbjct: 97 GGGGGGYGGGRGG-GGYGGGGGGG 119 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 33.5 bits (73), Expect = 0.23 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 770 PXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQ 868 P PP PP P PPPPP P P+ Sbjct: 425 PPPPPLPPPPPPPPPPPPPLPPNMPPPLPPPPE 457 Score = 31.9 bits (69), Expect = 0.69 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 779 PPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PP P PPPPP P P P Sbjct: 425 PPPPPLPPPPPPPPPPPPPLPPNMPPPLPPPP 456 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPP 826 P L PP PP PP P PPP Sbjct: 428 PPLPPPPPPPPPPPPPLPPNMPPP 451 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPP 826 P PP PP PP P PP PP Sbjct: 431 PPPPPPPPPPPPPLPPNMPPPLPP 454 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPP 823 P PP PP PP PPPP Sbjct: 434 PPPPPPPPPPLPPNMPPPLPPPP 456 >06_03_0790 - 24636805-24637770 Length = 321 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXGGXRXG 754 GGGGG GRGG GG GG G Sbjct: 111 GGGGGGGGGGRGGGGGGGGGGGGG 134 >06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 Length = 304 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +2 Query: 761 LXPPXXPPXPPRPXAXXPPPP--PXXKKTKXXXGPXPQXP 874 L P PP PP+P A PPPP P K K P P P Sbjct: 52 LPHPPPPPPPPQP-AKEPPPPTKPKHPKPKQQQHPPPPPP 90 >04_03_0833 + 20147242-20147849,20147937-20148081,20148157-20148210, 20148297-20148388,20148957-20149093,20149210-20149464, 20149598-20149771,20149863-20149960 Length = 520 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXGGXRXG 754 GGGGG GRGG GG GG G Sbjct: 47 GGGGGAGKKGRGGGGGGGGGVAAG 70 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 33.5 bits (73), Expect = 0.23 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 Query: 779 PPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PP+P PPPP + P PQ P Sbjct: 398 PPPPPQPPPPPPPPPHQRETPSPSPPPQPQFP 429 >03_01_0023 + 198414-198968 Length = 184 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXGGXRXG 754 GGGGG GRGG GG GG G Sbjct: 42 GGGGGGGGGGRGGGGGSGGGSGGG 65 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXGGXRXG 754 GGGGG GRGG GG GG G Sbjct: 54 GGGGGGGGGGRGGGGGGGGGGGGG 77 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 33.1 bits (72), Expect = 0.30 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 782 PXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P PPRP PPPPP K GP P P Sbjct: 920 PPPPRPPGAPPPPPPPGK----PGGPPPPPP 946 Score = 31.5 bits (68), Expect = 0.92 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPP 826 P PP PP PP P PPPP Sbjct: 921 PPPRPPGAPPPPPPPGKPGGPPPP 944 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPP 826 P PP PP P +P PPPPP Sbjct: 926 PGAPPP--PPPPGKPGGPPPPPPP 947 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 33.1 bits (72), Expect = 0.30 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPP 826 PP PP P+P PPPPP Sbjct: 764 PPPPPPQAPKPPGTVPPPPP 783 Score = 32.7 bits (71), Expect = 0.40 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +2 Query: 761 LXPPXXPPXPPR-PXAXXPPPPPXXKKTKXXXGPXPQXP 874 L PP PP PP P PPPP K P P P Sbjct: 633 LPPPPPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPP 671 Score = 31.5 bits (68), Expect = 0.92 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPP 826 PP PP PP P P PPP Sbjct: 585 PPPPPPPPPLPNCLVPSPPP 604 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PP P PPPPP P P P Sbjct: 621 PPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAP 656 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PP P PPPPP P P P Sbjct: 605 PPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPP 640 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 7/47 (14%) Frame = +2 Query: 755 PXLXPPXXPPXPPRP-------XAXXPPPPPXXKKTKXXXGPXPQXP 874 P PP PP PP P + PPPPP P P P Sbjct: 559 PAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPP 605 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 4/40 (10%) Frame = +2 Query: 767 PPXXPPXPP----RPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PP PP R PPPPP P P P Sbjct: 602 PPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPP 641 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 4/24 (16%) Frame = +2 Query: 767 PPXXPPXPPRP----XAXXPPPPP 826 PP PP PP P A PPPPP Sbjct: 544 PPPPPPPPPPPSGNKPAFSPPPPP 567 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/23 (52%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = +2 Query: 767 PPXXPPXPP---RPXAXXPPPPP 826 PP PP PP +P PPPPP Sbjct: 546 PPPPPPPPPSGNKPAFSPPPPPP 568 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 6/42 (14%) Frame = +2 Query: 767 PPXXPPXPPRPXAXX------PPPPPXXKKTKXXXGPXPQXP 874 PP PP PP P + PPPPP P P P Sbjct: 566 PPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPP 607 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P P P PP P PPPPP K P P P Sbjct: 535 PSPSPTAAAPPPPPP----PPPPPSGNKPAFSPPPPPPPP 570 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 5/41 (12%) Frame = +2 Query: 767 PPXXPPXPP-----RPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PP P P A PPP KK P PQ P Sbjct: 732 PPLPPPLPAAANKRNPPAPPPPPLMTGKKAPAPPPPPPQAP 772 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 4/37 (10%) Frame = +2 Query: 767 PPXXPPXPPRPX----AXXPPPPPXXKKTKXXXGPXP 865 PP PP PP P PPPPP P P Sbjct: 618 PPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPP 654 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 9/45 (20%) Frame = +2 Query: 767 PPXXPPXPPR--------PXAXX-PPPPPXXKKTKXXXGPXPQXP 874 PP PP PP P A PPPPP ++ P P P Sbjct: 691 PPPPPPLPPANRTNGPGVPSAPPPPPPPPPANRSNGPSAPAPPLP 735 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PP P P PPP + G P P Sbjct: 747 PPAPPPPPLMTGKKAPAPPPPPPQAPKPPGTVPPPP 782 >03_05_0704 - 26953474-26953643,26953770-26953801,26953915-26954009, 26954107-26954180,26954283-26954412,26954522-26954585, 26954660-26954722,26954795-26954937,26955386-26955523, 26955610-26955731,26955805-26955976,26956559-26956630, 26956753-26956887,26956987-26957103,26957184-26957316, 26957455-26957561,26958060-26958077,26958235-26958379, 26958472-26958671,26960744-26961421 Length = 935 Score = 33.1 bits (72), Expect = 0.30 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXGGXRXG 754 GGGGG GRGG GG GG G Sbjct: 5 GGGGGGRRGGRGGGGGREGGGGGG 28 >08_01_0059 - 394001-394708 Length = 235 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPP 823 P PP PP PP P PPPP Sbjct: 26 PPPSPPIRPPPPPTPRPYAPPPP 48 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +3 Query: 747 PXXPFSXPPXXPLXPPXPXRGXPPPXXXXKKQKXXXGRP 863 P P PP PP P R PPP + RP Sbjct: 4 PPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRP 42 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PP PPR PPPP + P P P Sbjct: 13 PPATPPPPPR---RAPPPPSPPIRPPPPPTPRPYAP 45 >07_03_1090 + 23891294-23892222,23892317-23892516,23895241-23895482, 23895771-23896461,23896486-23896562 Length = 712 Score = 32.7 bits (71), Expect = 0.40 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +2 Query: 743 QTXXPXLXPPXXPPX-PPRPXAXXPPPPPXXKK 838 QT P + P P PPRP PPPPP ++ Sbjct: 202 QTAMPPMAAPAPPQTNPPRPVRPPPPPPPPRQR 234 >06_03_1326 - 29355467-29355817 Length = 116 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -1 Query: 822 GGGGXXAXGRGGXGGXXGGXRXG 754 GGGG G+GG GG GG R G Sbjct: 14 GGGGGGGGGKGGGGGSGGGGRSG 36 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXGGXRXG 754 G GGG G+GG GG GG G Sbjct: 3 GKGGGGGGGGKGGGGGGGGGKGGG 26 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXGGXRXG 754 GGGGG G GG G GG G Sbjct: 39 GGGGGGKGGGEGGSGKYGGGYSGG 62 >04_01_0034 - 401208-402923 Length = 571 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +2 Query: 770 PXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P P P +P PPPPP ++ K P P P Sbjct: 294 PHAPRLPLQPRPAPPPPPPQQQRAKPSRPPPPPPP 328 Score = 28.3 bits (60), Expect = 8.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPP 826 P PP PP R PPPPP Sbjct: 303 PRPAPPPPPPQQQRAKPSRPPPPP 326 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 761 LXPPXXPPXPPRPXAXXPPPP 823 L PP PP PP P PPPP Sbjct: 36 LCPPPPPPPPPPPPPPPPPPP 56 Score = 31.5 bits (68), Expect = 0.92 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 770 PXXPPXPPRPXAXXPPPPP 826 P PP PP P PPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPP 56 >01_07_0122 - 41196081-41196205,41197561-41198245,41198961-41199329, 41199405-41199514,41200539-41200833 Length = 527 Score = 32.7 bits (71), Expect = 0.40 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 822 GGGGXXAXGRGGXGGXXGGXRXGXXVC 742 GGGG GRGG GG G R G C Sbjct: 21 GGGGGGRGGRGGGGGRGGSGRLGWWWC 47 >07_01_0080 + 587674-588510 Length = 278 Score = 32.3 bits (70), Expect = 0.52 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPP 826 PP PP PP + PPPPP Sbjct: 91 PPPPPPPPPSSGSPPPPPPP 110 Score = 31.5 bits (68), Expect = 0.92 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +2 Query: 755 PXLXPPXX--PPXPPRPXAXXPPPPPXXKKTKXXXGP 859 P PP PP PP P PPPPP T+ P Sbjct: 94 PPPPPPSSGSPPPPPPPPPPPPPPPPPPLFTRRSHAP 130 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 32.3 bits (70), Expect = 0.52 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXP-PPPPXXKKTKXXXGPXP 865 P PP P PRP P PPPP + GP P Sbjct: 349 PPPPPPPAAPAAPRPPGPGPGPPPPPGAAGRGGGGPPP 386 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +2 Query: 779 PPXPPRPXAXXPPPP-PXXKKTKXXXGPXPQXP 874 PP P P A PPPP P GP P P Sbjct: 322 PPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPP 354 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 779 PPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PP A PPPP + G P P Sbjct: 321 PPPPPAHPAAPAPPPPAPSPSAAGAGSGPPPP 352 Score = 28.3 bits (60), Expect = 8.5 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 6/41 (14%) Frame = +2 Query: 770 PXXPPXPPRPXAXX------PPPPPXXKKTKXXXGPXPQXP 874 P PP P P A PPPPP GP P P Sbjct: 331 PAPPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPGPP 371 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 32.3 bits (70), Expect = 0.52 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPP 826 P P PP PP P PPPPP Sbjct: 124 PPHPPEDPPPHPPHPPDHPPPPPP 147 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPP 826 P PP PP PP PP PP Sbjct: 116 PPRPPPPPPPHPPEDPPPHPPHPP 139 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKK 838 P PP P PP P PPPP ++ Sbjct: 131 PPPHPPHPPDHPPPPPPCRVPPPPGYRQ 158 Score = 25.8 bits (54), Expect(2) = 5.6 Identities = 11/32 (34%), Positives = 11/32 (34%) Frame = +2 Query: 779 PPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PP P PP P P P P Sbjct: 116 PPRPPPPPPPHPPEDPPPHPPHPPDHPPPPPP 147 Score = 21.4 bits (43), Expect(2) = 5.6 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 767 PPXXPPXPPRP 799 PP PP PP P Sbjct: 84 PPPPPPVPPCP 94 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 32.3 bits (70), Expect = 0.52 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXK 835 PP PP PP PPPPP K Sbjct: 354 PPAPPPPPPFAPTLPPPPPPRRK 376 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 770 PXXPPXPPRPXAXXPPPPPXXKK 838 P PP PP PPPPP +K Sbjct: 354 PPAPPPPPPFAPTLPPPPPPRRK 376 >12_01_0135 + 1042889-1044255,1045368-1045809 Length = 602 Score = 31.9 bits (69), Expect = 0.69 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +2 Query: 755 PXLXPPXX--PPXPPRPXAXXPPPPP 826 P L PP PP PP A PPPPP Sbjct: 144 PALLPPDATAPPPPPTSVAALPPPPP 169 >11_01_0133 + 1121392-1122731,1123417-1123858 Length = 593 Score = 31.9 bits (69), Expect = 0.69 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +2 Query: 755 PXLXPPXX--PPXPPRPXAXXPPPPP 826 P L PP PP PP A PPPPP Sbjct: 143 PALLPPDATAPPPPPTSVAALPPPPP 168 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 31.9 bits (69), Expect = 0.69 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPP 826 PP PP P R A PPPPP Sbjct: 223 PPPPPPSPHRHPAAHPPPPP 242 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 743 QTXXPXLXPPXXPPXPPRPXAXXPPPPPXXK 835 Q P P PP PP P PP PP K Sbjct: 138 QEPPPPHVPKAAPPPPPPPPPHAPPGPPPTK 168 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPP 826 P PP P P A PPPPP Sbjct: 136 PGQEPPPPHVPKAAPPPPPP 155 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPP 823 P P PP PP A PPPP Sbjct: 230 PHRHPAAHPPPPPHHPAPRPPPP 252 >08_02_0839 + 21693348-21694853 Length = 501 Score = 31.9 bits (69), Expect = 0.69 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 743 QTXXPXLXPPXXPPXPPRPXAXXPPPP 823 Q P L PP PP PP PPPP Sbjct: 22 QLPLPYLPPPPPPPQPPLLQLQPPPPP 48 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP P P P PPPPP + P P P Sbjct: 16 PPTSPLQLPLPYLPPPPPPPQPPLLQLQPPPPPSSP 51 >06_01_0931 + 7192519-7194075 Length = 518 Score = 31.9 bits (69), Expect = 0.69 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 Query: 770 PXXPPXPPRPXAXXPPPPPXXKKTK 844 P PP PPR A PPPP +T+ Sbjct: 130 PSPPPPPPRSQAPPPPPPASSVRTR 154 >02_05_0750 - 31479876-31480985 Length = 369 Score = 31.9 bits (69), Expect = 0.69 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPP 826 PP P PP P PPPPP Sbjct: 194 PPPSPSPPPEPEPQLPPPPP 213 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 31.9 bits (69), Expect = 0.69 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPP 826 PP P PP P + PPPPP Sbjct: 430 PPPPPEHPPPPESTSPPPPP 449 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P PP PP P PPP P T P P P Sbjct: 434 PEHPPPPESTSPPPPPTSDPPPVPPPPPTTGSFMPIPSAP 473 Score = 28.3 bits (60), Expect = 8.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 747 PXXPFSXPPXXPLXPPXPXRGXPPP 821 P F PP P PP P PPP Sbjct: 423 PSDAFEQPPPPPEHPPPPESTSPPP 447 >11_01_0066 - 536281-537196,537397-537452 Length = 323 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPP-PXXKKTKXXXGPXP 865 PP P PP P PPPP P T+ P P Sbjct: 223 PPPSPASPPPPSTATPPPPSPTPTTTRASPTPPP 256 >08_02_1256 + 25645085-25645396 Length = 103 Score = 31.5 bits (68), Expect = 0.92 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPP 823 PP PP PP P PPPP Sbjct: 61 PPPPPPPPPLPSPPPPPPP 79 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 779 PPXPPRPXAXXPPPPPXXKKTKXXXGP 859 PP PP P PPPPP ++ + P Sbjct: 62 PPPPPPPPLPSPPPPPPPQQQEEQSPP 88 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +2 Query: 779 PPXPPRPXAXXPPPPPXXKKTKXXXGPXP 865 PP PP P PPPP + + P P Sbjct: 61 PPPPPPPPPLPSPPPPPPPQQQEEQSPPP 89 >07_03_1710 - 28903614-28903673,28904982-28905146,28905453-28905638, 28905784-28905927,28906281-28906460,28906559-28907215 Length = 463 Score = 31.5 bits (68), Expect = 0.92 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXP 865 PP PP P P PP PP ++ P P Sbjct: 65 PPASPPPAPTPPQTRPPSPPPQQQQPRPVSPPP 97 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 31.5 bits (68), Expect = 0.92 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPP 826 P P PP PPR PPPPP Sbjct: 47 PPPPQPTLPPPPPRTLPPPPPPPP 70 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 759 FSXPPXXPLXPPXPXRGXPPP 821 F+ PP P PP P R PPP Sbjct: 45 FAPPPPQPTLPPPPPRTLPPP 65 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 1/25 (4%) Frame = +2 Query: 755 PXLXPPXXPP-XPPRPXAXXPPPPP 826 P PP P PP P PPPPP Sbjct: 43 PRFAPPPPQPTLPPPPPRTLPPPPP 67 >01_05_0490 + 22672241-22674679 Length = 812 Score = 31.5 bits (68), Expect = 0.92 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 770 PXXPPXPPRPXAXXPPPPP 826 P PP PP P PPPPP Sbjct: 688 PLPPPSPPLPPPPPPPPPP 706 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 779 PPXPPRPXAXXPPPPP 826 PP PP A PPPPP Sbjct: 655 PPQPPSRPAPPPPPPP 670 >10_08_0553 - 18720436-18720494,18721102-18721106,18721136-18721257, 18721390-18721478,18722136-18722316,18722403-18722654, 18722755-18722993,18723680-18723914,18724072-18724132, 18724632-18724987 Length = 532 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXGGXRXG 754 GGGGG GRG GG GG G Sbjct: 18 GGGGGGGGGGRGNGGGGFGGGGGG 41 >10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526, 5956971-5957592 Length = 357 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 746 TXXPXLXPPXXPPXPPRPXAXXPPPPP 826 T P + PP PP PP P PP P Sbjct: 69 TPPPAIVPPALPPPPPLPAIVVPPALP 95 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 743 QTXXPXLXPPXXPPXPPRPXAXXPPPPP 826 Q P P PP PP P PPP P Sbjct: 23 QATPPPAIPESGPPPPPAPDMPPPPPTP 50 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/41 (31%), Positives = 15/41 (36%) Frame = +2 Query: 743 QTXXPXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXP 865 ++ P P PP PP P P PP GP P Sbjct: 32 ESGPPPPPAPDMPPPPPTPAPQSSPAPPPAPDMTPPPGPGP 72 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 746 TXXPXLXPPXXPPX--PPRPXAXXPPPPPXXKKTKXXXGPXP 865 T P PP P PP P A PPPP + P P Sbjct: 19 TPAPQATPPPAIPESGPPPPPAPDMPPPPPTPAPQSSPAPPP 60 >07_01_0516 - 3850252-3852870 Length = 872 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPP 826 P P PP PP P A P PPP Sbjct: 20 PPTSRPLPPPPPPPPPAHGPSPPP 43 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPP 826 P L PP PP RP PPPPP Sbjct: 12 PRLLPP-QPPPTSRPLPPPPPPPP 34 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQ 868 P PP PP PPPPP P P+ Sbjct: 12 PRLLPPQPPPTSRPLPPPPPPPPPAHGPSPPPPR 45 >06_01_0486 - 3455030-3455770 Length = 246 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 755 PXLXPP-XXPPXPPRPXAXXPPPPPXXKKT 841 P PP PP PP P PPP P KT Sbjct: 129 PPSPPPYVPPPTPPSPPPYVPPPSPPATKT 158 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P + P PP PP PPP P P P P Sbjct: 98 PYVPPYIPPPTPPYVPPYIPPPTPPYVPPPTPPSPPPYVP 137 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P + P PP PP PP PP P P P Sbjct: 110 PYVPPYIPPPTPPYVPPPTPPSPPPYVPPPTPPSPPPYVP 149 >06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-388276, 388355-388482,388914-389048,389122-389250,389620-389787, 389897-390019,390099-390227,390543-390866,390946-392901 Length = 1448 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 779 PPXPPRPXAXXPPPPP 826 PP PP+P PPPPP Sbjct: 48 PPPPPQPHTAPPPPPP 63 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +2 Query: 743 QTXXPXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 Q P P P PP P A PPP + K P P Sbjct: 45 QAAPPPPPQPHTAPPPPPPNAEPEAPPPPQLEVKAPAATLPPNP 88 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +2 Query: 755 PXLXPPXXPPXPPR--PXAXXPPPPPXXKKTKXXXGPXPQXP 874 P PP PP P P A PPPPP + P P+ P Sbjct: 56 PTSPPPASPPLPSATPPLAASPPPPPPPPPPRNSPSP-PKPP 96 Score = 28.3 bits (60), Expect = 8.5 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 746 TXXPXLXPPXXPPXPPRPXAXXPPPPP 826 T P PP PP + PPPPP Sbjct: 57 TSPPPASPPLPSATPPLAASPPPPPPP 83 >04_04_0146 + 23106325-23108154 Length = 609 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPP 826 P P PP PRP PPPPP Sbjct: 14 PPPVPAQAPPPSPRPWYAAPPPPP 37 >04_03_0925 - 20856628-20856690,20856786-20856845,20856924-20857001, 20857127-20857192,20857542-20858675,20858991-20860283 Length = 897 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +2 Query: 767 PPXXPPXP-PRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PP P P P PPP P + P P P Sbjct: 9 PPEHPPTPAPAPAPASPPPHPAASGNEAAAPPKPNPP 45 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PP PP P P PP + P P P Sbjct: 26 PPPPPPHPPPPPPLEPAPPSTPQLRGEASPPPPPPP 61 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P L P PP P P P PP + + P P P Sbjct: 21 PELRLPPPPPPHPPPPPPLEPAPPSTPQLRGEASPPPPPP 60 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 779 PPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PP P PP PP P P P Sbjct: 264 PPPPPPPPPPPPPMPPRTDNASTQAAPAPPPP 295 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKT 841 PP PP P PPPPP +T Sbjct: 257 PPPQSVRPPPPPPPPPPPPPMPPRT 281 >09_04_0506 - 18188785-18190599 Length = 604 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 873 GXXGXGPXXXFVFFXXGGGGGXXAXGRGGXGGXXGGXRXG 754 G GP V GGG G G GG GG GG G Sbjct: 294 GGAAGGPGGAQVGGNYGGGRGGGGGGPGGGGGGGGGGNWG 333 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPP 826 P PP P P A PPPPP Sbjct: 127 PVHLPPQPQPPVAAAPPPPP 146 >07_03_0154 + 14509979-14512033 Length = 684 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P P PP PP P PPPPP + P P P Sbjct: 45 PLPLPAAAPPPPPPPP---PPPPPPQVQAATVATPVPATP 81 >06_01_0178 + 1386981-1387505 Length = 174 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXG 769 GGGGG A G+GG GG G Sbjct: 47 GGGGGGGAGGKGGKGGAGG 65 Score = 28.3 bits (60), Expect = 8.5 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXG-GXRXG 754 GGGG GRGG GG G G R G Sbjct: 97 GGGGKGRKGGRGGDGGSGGAGGRGG 121 Score = 28.3 bits (60), Expect = 8.5 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXG-GXRXG 754 G GG A GRGG GG G G R G Sbjct: 109 GDGGSGGAGGRGGDGGSGGQGGRGG 133 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P PP PP PP P + P P + P P P Sbjct: 306 PIPPPPPPPPPPPMPRSRSASPSPSTSSSGSAGPPAPPPP 345 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPP 826 P PP P PPR PPPPP Sbjct: 70 PTPPPPPPAPRPPRRHHRIPPPPP 93 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 761 LXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXP 865 + P PP PP P A PPP P K P P Sbjct: 106 ISPTPAPPLPP-PPAPAPPPTPTPKFPSSSANPSP 139 Score = 28.3 bits (60), Expect = 8.5 Identities = 16/49 (32%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +2 Query: 743 QTXXPXLXPPXXPPXPPRPXAXX-----PPPPPXXKKTKXXXGPXPQXP 874 QT L P PP PP P PPPPP + + P P Sbjct: 45 QTTLQQLHSPDSPPPPPLPTPTVTTPTPPPPPPAPRPPRRHHRIPPPPP 93 >04_04_0053 + 22389227-22389613,22390528-22390981,22391618-22391673, 22391757-22391887,22391976-22392072,22393329-22393484 Length = 426 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 782 PXPPRPXAXXPPPPPXXKKTKXXXGPXP 865 P PP P PPPPP GP P Sbjct: 51 PPPPPPMVAAPPPPPPQYAKHFAAGPPP 78 >04_03_0804 - 19844059-19844777,19844914-19844995,19846580-19846585 Length = 268 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXK 835 PP P PP+P PPP P K Sbjct: 141 PPCKPEEPPKPPPEKPPPKPECK 163 >03_02_0786 - 11169820-11170158,11170245-11170433,11171173-11171469, 11171568-11171630,11171884-11171997,11173011-11173091, 11173176-11173307,11174265-11174363,11174453-11174530, 11174641-11174901 Length = 550 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 3/27 (11%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXX---PPPPP 826 P + PP PP PP P PPPPP Sbjct: 32 PPMGPPPPPPMPPVPVMYLRGVPPPPP 58 >03_02_0631 + 9969841-9969868,9969965-9970082,9970186-9970828, 9971146-9971935,9972002-9972051,9972618-9972704 Length = 571 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 Query: 779 PPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP +P PPPPP K K P + P Sbjct: 91 PPPAQKPSKVSPPPPPPQKSAKVSPPPAAKPP 122 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +2 Query: 755 PXLXPPXXPPXP-PRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P P PP P P+P P P P K K P P+ P Sbjct: 172 PKPGPKPKPPKPGPKPKPPKPGPKPKPKPPKPGPKPKPKPP 212 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +2 Query: 755 PXLXPPXXPPXP-PRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P P PP P P P P P P K K P P+ P Sbjct: 161 PKPKPKPSPPKPKPGPKPKPPKPGPKPKPPKPGPKPKPKPP 201 >12_02_1219 + 27096477-27096590,27096704-27097078 Length = 162 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 822 GGGGXXAXGRGGXGGXXGG 766 GGGG GRGG GG GG Sbjct: 129 GGGGGYGGGRGGGGGYGGG 147 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXGGXRXG 754 GGGGG RGG GG GG G Sbjct: 90 GGGGGGGYGQRGGGGGYGGGGGYG 113 >12_01_0252 + 1868670-1869200,1870167-1871120 Length = 494 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXG 769 GGGGG GRGG GG G Sbjct: 78 GGGGGSGGGGRGGAGGGGG 96 >11_01_0252 + 1934505-1935032,1936001-1936957 Length = 494 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXG 769 GGGGG GRGG GG G Sbjct: 77 GGGGGSGGGGRGGAGGGGG 95 >10_08_1008 - 22222051-22222377,22222479-22222640,22223179-22223310, 22224556-22224608,22224713-22225256 Length = 405 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPP 823 PP PP PP P A PPP Sbjct: 30 PPSQPPPPPLPFAQQAPPP 48 >07_03_0600 + 19866757-19867218,19867920-19868429 Length = 323 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 5/47 (10%) Frame = +2 Query: 743 QTXXPXLXPPXXPPX-----PPRPXAXXPPPPPXXKKTKXXXGPXPQ 868 Q P PP PP PP P PPPP + P PQ Sbjct: 55 QAGPPHAPPPQQPPAMWGQPPPPPPQYAPPPPQQFQLPHQQYAPPPQ 101 >07_01_0862 - 7172083-7172931 Length = 282 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 761 LXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXP 865 L PP PP PP P P PP K P P Sbjct: 183 LPPPSPPPQPPLPEKENTPLPPLLLPPKKKPLPPP 217 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +2 Query: 755 PXLXPPXXPPXP-PRPXAXXPPPPPXXKKTKXXXGP 859 P L PP PP P P PP PP +K P Sbjct: 169 PLLYPPPLPPKKKPLPPPSPPPQPPLPEKENTPLPP 204 Score = 28.3 bits (60), Expect = 8.5 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +2 Query: 782 PXPPRPXAXXPPPP-PXXKKTKXXXGPXPQXP 874 P PPR PPP P KK P PQ P Sbjct: 162 PLPPRKKPLLYPPPLPPKKKPLPPPSPPPQPP 193 >05_06_0078 - 25412770-25413852 Length = 360 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXGG 766 GGGGG GRG GG GG Sbjct: 267 GGGGGGDGVGRGATGGAGGG 286 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXGGXRXG 754 GGGGG A G G GG GG R G Sbjct: 284 GGGGGDAAGGEG--GGAAGGGRDG 305 >04_04_0679 + 27214577-27215023 Length = 148 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 858 GPXXXFVFFXXGGGGGXXAXGRGGXGGXXG 769 G F F GGGGG GRGG G G Sbjct: 63 GTAFGFGFGGGGGGGGGGVGGRGGSSGRGG 92 >02_01_0130 - 938530-939990 Length = 486 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 779 PPXPPRPXAXXPPPPPXXKKTKXXXGPXPQ 868 PP PP P P P P KT+ P P+ Sbjct: 102 PPKPPNPVRQRPLPLPLPHKTRLPNAPAPK 131 >06_03_0214 + 18067945-18068463,18068940-18069839,18069918-18070652 Length = 717 Score = 25.0 bits (52), Expect(2) = 2.5 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 788 PPRPXAXXPPPPPXXKK 838 PP+ A PPPPP K Sbjct: 239 PPQHNAPPPPPPPQHSK 255 Score = 23.4 bits (48), Expect(2) = 2.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 755 PXLXPPXXPPXPP 793 P L PP PP PP Sbjct: 200 PPLPPPPPPPPPP 212 >10_08_0630 - 19410852-19411235,19411370-19412257,19412440-19412941, 19413662-19414135,19414982-19415040,19415468-19415629 Length = 822 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQ 868 P PP P P A PPPPP P PQ Sbjct: 429 PQPPPPPSHPTPITSVAPAPPPPPPAAAAAAASQPSPQ 466 >07_01_1123 - 10385215-10385574,10385676-10385810,10386385-10387091, 10387158-10387455 Length = 499 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 770 PXXPPXPPRPXAXXPPPPPXXKKTK 844 P PP PP P PPPPP K T+ Sbjct: 3 PANPPIPPPP----PPPPPTRKPTR 23 >06_03_0696 + 23617687-23617851,23618838-23619536 Length = 287 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 4/24 (16%) Frame = +2 Query: 767 PPXXPPXPPRPXAXX----PPPPP 826 PP PP PP P A PPPPP Sbjct: 79 PPPPPPPPPSPPATHDVGQPPPPP 102 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPP 826 P PP PP PP PPPP Sbjct: 78 PPPPPPPPPPSPPATHDVGQPPPP 101 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 5/33 (15%) Frame = +2 Query: 755 PXLXPPXXPPXP-----PRPXAXXPPPPPXXKK 838 P PP PP P P+P PPPPP K Sbjct: 1927 PPHAPPPPPPPPPVEGKPKPPPHAPPPPPPEAK 1959 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 5/34 (14%) Frame = +2 Query: 755 PXLXPPXXPPXP----PRPXAXXPPPPP-XXKKT 841 P PP PP P P+P PPPPP KK+ Sbjct: 1928 PHAPPPPPPPPPVEGKPKPPPHAPPPPPPEAKKS 1961 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P PP PP PP PPPP K P P P Sbjct: 1923 PKQPPPHAPPPPP------PPPPVEGKPKPPPHAPPPPPP 1956 >05_01_0380 + 2978256-2979284 Length = 342 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +2 Query: 743 QTXXPXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGP 859 +T + PP PP PP P PPP P +K P Sbjct: 19 RTERVRMPPPPPPPPPPPP---PPPPRPFSRKPSEPAAP 54 >03_03_0008 - 13674602-13674708,13675272-13675439,13676169-13676787, 13676868-13677330,13677855-13678036,13678093-13678235, 13678315-13678423,13679000-13679456,13680490-13682473, 13682507-13682626,13682920-13682971 Length = 1467 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKT 841 P PP PP P P PPPP +T Sbjct: 1119 PDDRPPSPPPLPSSPPPVPPPPPAPITQT 1147 >02_05_0860 - 32296743-32296769,32297328-32297357,32298432-32298503, 32298967-32299812 Length = 324 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +2 Query: 770 PXXPPXPPRPXAXXPPPPPXXKKTKXXXG 856 P PP P A PPPPP ++T G Sbjct: 151 PPVPPAPTPTAAAVPPPPPPQQQTPMLFG 179 >02_04_0056 + 19313422-19313967,19314035-19314168,19314263-19314398, 19314870-19314923,19314995-19315135,19315220-19315546, 19315647-19315916,19316080-19316226,19316890-19317045, 19317223-19317290,19318210-19318309,19318696-19318985, 19319074-19319274,19319840-19319902,19320263-19320356, 19320964-19321035,19321979-19322077,19322254-19322376 Length = 1006 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 770 PXXPPXPPRPXAXXPPPPPXXKKTK 844 P PP PP P P PP K TK Sbjct: 49 PHGPPPPPPPSPSPSPSPPAGKPTK 73 >01_01_0070 - 542603-542686,542803-543441 Length = 240 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +2 Query: 746 TXXPXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 T P + P PP P PPPP K P P P Sbjct: 60 TPTPPVAPAKAPPVAPAVAPVTPPPPTPKKAPPPPVTPPPVTP 102 >10_08_0213 - 15912048-15912716 Length = 222 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -1 Query: 834 FXXGGGGGXXAXGRGGXGGXXGGXRXG 754 + GGG G G GG GG GG G Sbjct: 62 YGEGGGAGAGGYGHGGGGGGGGGEGGG 88 >10_07_0161 - 13674631-13675433,13675793-13675862 Length = 290 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXGGXRXG 754 GGGGG G GG G GG G Sbjct: 185 GGGGGWTGGGNGGGGSGGGGGARG 208 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +2 Query: 743 QTXXPXLXPPXXPPXPPRPXA----XXPPPPPXXKKTKXXXGP 859 Q P PP PP PP P + P PPP + GP Sbjct: 319 QMASPPSNPPPAPPPPPPPPSRFNNTTPKPPPPPPPPEPPTGP 361 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PP P P PPPP T P P P Sbjct: 323 PPSNPPPAPPPP---PPPPSRFNNTTPKPPPPPPPP 355 >08_01_1038 + 10540185-10540709 Length = 174 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -1 Query: 825 GGGGGXXAXG-RGGXGGXXGGXR 760 GGGGG G RGG GG GG R Sbjct: 34 GGGGGLGKGGVRGGGGGLGGGRR 56 >07_03_1636 + 28290642-28291574 Length = 310 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 779 PPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PP P PPPPP + P P P Sbjct: 182 PPSPP-PAKLSPPPPPQTQTQPLAKPPAPATP 212 >07_03_1573 + 27829967-27830338,27830821-27831510,27831594-27831781, 27832286-27832318,27832364-27832605,27833178-27833320, 27833649-27833825,27834104-27834256,27834639-27834694, 27834998-27835157,27835301-27835348 Length = 753 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 770 PXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P PP PPR PPPP GP PQ P Sbjct: 34 PTPPPPPPRRRTPPPPPP--------GSGPGPQRP 60 >07_03_0890 - 22332768-22333382 Length = 204 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +2 Query: 761 LXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 L P PP P PPPPP + P P P Sbjct: 72 LGSPPPPPAEATPPPPPPPPPPERAVPEAADTPPPPPP 109 >07_03_0527 - 19085828-19086319 Length = 163 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -1 Query: 825 GGGGGXXAXG-RGGXGGXXGGXR 760 GGGGG G RGG GG GG R Sbjct: 34 GGGGGLGEGGVRGGGGGLGGGRR 56 >06_02_0126 + 12130409-12130532,12131015-12131373 Length = 160 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -1 Query: 873 GXXGXGPXXXFVFFXXGGGGGXXAXGRGGXGGXXGGXRXG 754 G G G + + GGGG GRG GG GG G Sbjct: 103 GYGGGGGGGGYGGYGGYGGGGYEGYGRGYGGGGGGGGYGG 142 >06_02_0120 + 12055076-12055175,12055322-12055725 Length = 167 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -1 Query: 873 GXXGXGPXXXFVFFXXGGGGGXXAXGRGGXGGXXGGXRXG 754 G G GP + G GGG + G GG G GG G Sbjct: 97 GGGGSGPGYGGGYGSPGYGGGYGSPGYGGGSGYGGGYGGG 136 >05_01_0351 + 2750253-2751042,2751951-2751958,2752122-2752149, 2754692-2754775,2755780-2757548 Length = 892 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +2 Query: 755 PXLXPPXXPPX-PPRPXAXXPPPPP 826 P L PP P PPRP P PPP Sbjct: 719 PHLQPPARPAQQPPRPPVTQPLPPP 743 >04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 Length = 389 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 761 LXPPXXPPXPPRPXAXXPPPP 823 L PP P PP P PPPP Sbjct: 17 LGPPAPAPVPPPPPPPPPPPP 37 >04_03_0098 + 11183039-11183752 Length = 237 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -1 Query: 858 GPXXXFVFFXXGGGGGXXAXGRGGXGGXXGGXRXGXXV 745 GP V GGG G + G G GG G R G V Sbjct: 155 GPGGVTVTHGGGGGAGGGSGGGGASGGGSGTGRSGNAV 192 >02_03_0227 + 16601538-16601908,16603197-16603378,16603495-16603577, 16604609-16604717,16606754-16606806,16606988-16607023 Length = 277 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXGGXRXGXXVC 742 GG GG A GRG GG GG G VC Sbjct: 42 GGAGGGGAAGRGEDGGAGGG---GESVC 66 >01_07_0081 - 40959279-40959375,40959463-40959589,40960138-40960339, 40962414-40963361 Length = 457 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +2 Query: 782 PXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P P P + PPPPP +TK P P+ P Sbjct: 12 PPNPNPVSDDPPPPPPVTETK----PEPEPP 38 >01_06_1758 - 39681942-39682030,39682115-39682345,39682643-39682679, 39683604-39683835,39683937-39684022,39684126-39684218, 39684302-39684465,39684541-39684702,39684783-39684962, 39685079-39685515,39685614-39685669 Length = 588 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -1 Query: 825 GGGGGXXAXGRGGXG-GXXGGXRXG 754 GGG G GRGG G G GG R G Sbjct: 66 GGGAGGGGWGRGGGGGGGAGGYRGG 90 >01_02_0031 + 10364487-10365407 Length = 306 Score = 29.5 bits (63), Expect = 3.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 779 PPXPPRPXAXXPPPPP 826 PP PP P PPPPP Sbjct: 170 PPPPPPPALPAPPPPP 185 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 779 PPXPPRPXAXXPPPPP 826 PP PP P A PPPP Sbjct: 169 PPPPPPPPALPAPPPP 184 >01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827, 8960964-8961054,8961877-8961937,8962172-8962216, 8962318-8962391,8962565-8962637,8963288-8963345, 8963398-8963468,8963801-8963837,8964040-8964128, 8964207-8964263,8964366-8964449,8964529-8964627, 8964765-8964869,8965145-8965216,8965308-8965497, 8965810-8966207 Length = 744 Score = 27.1 bits (57), Expect(2) = 4.2 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 779 PPXPPRPXAXXPPPP 823 PP PP P PPPP Sbjct: 76 PPTPPSPPPPPPPPP 90 Score = 20.6 bits (41), Expect(2) = 4.2 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = +2 Query: 812 PPPPPXXKKTKXXXGP 859 PPPPP + T P Sbjct: 129 PPPPPLPRPTSARATP 144 >10_08_0936 - 21679002-21679800,21679893-21680116,21681174-21681361, 21681505-21682597 Length = 767 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 746 TXXPXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 T P L P PP PP A PPP K P P P Sbjct: 75 TAAPALAPTPTPP-PPSSTASSSLPPPTPLLPKHQQAPPPPPP 116 >06_03_1368 - 29612463-29612638,29613135-29613222,29613334-29613474, 29613561-29613595,29613990-29614054,29614286-29614335, 29614417-29614521,29614608-29614688,29614771-29614852, 29614941-29614995,29615111-29616164,29617202-29617289, 29617379-29617485,29617568-29617686,29617784-29617994 Length = 818 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 5/32 (15%) Frame = +2 Query: 746 TXXPXLXPPXXPPX-----PPRPXAXXPPPPP 826 T P L PP PP PP PPPPP Sbjct: 3 TDQPHLPPPAPPPGAAAADPPESTPAPPPPPP 34 >06_01_1013 - 7931756-7935109 Length = 1117 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +2 Query: 782 PXPPRPXAXXPPPPPXXKKTKXXXGPXP 865 P RP A PPPPP ++ + P P Sbjct: 87 PPQERPSAAPPPPPPQQQQRQQHAAPAP 114 >06_01_0760 - 5676973-5677830 Length = 285 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 819 GGGXXAXGRGGXGGXXGGXRXG 754 GGG A G GG GG GG G Sbjct: 106 GGGAYAQGEGGGGGGGGGQNGG 127 >06_01_0690 + 5033943-5034740 Length = 265 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = -1 Query: 864 GXGPXXXFVFFXXGGGGGXXAXGRGGXGGXXGGXRXG 754 G GP + GGGGG G+ G G G G Sbjct: 140 GYGPYGGGAYAQGGGGGGGGGGGQNGGSGYGSGSGYG 176 >05_07_0280 - 28920864-28920971,28921076-28921175,28921267-28921394, 28922013-28922180,28922280-28922395,28922584-28922736, 28922904-28923047,28923401-28924133 Length = 549 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 746 TXXPXLXPPXXPPXPPRPXAXXPPPP 823 T P P PP P +P + PPPP Sbjct: 33 TRAPKPKPKPQPPPPQQPRSQPPPPP 58 >05_06_0026 - 25024807-25025300,25025432-25025495,25025567-25025662, 25025719-25025929,25026616-25026690,25026820-25027037 Length = 385 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 779 PPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PP PPPPP P P P Sbjct: 18 PPPPPVQVPVPPPPPPPLPPAAAAVEPLPPQP 49 >04_01_0607 + 7955026-7955664 Length = 212 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXGGXRXG 754 G GGG G+GG GG GG G Sbjct: 66 GEGGGGEGDGKGGDGGREGGGDGG 89 >04_01_0500 - 6540769-6541482,6541819-6541877,6541965-6542064, 6542113-6542322,6542507-6542765,6544022-6544215 Length = 511 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/23 (52%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = +2 Query: 767 PPXXPPXPPRPX---AXXPPPPP 826 PP PP PP P + PPPPP Sbjct: 32 PPPLPPPPPGPLQRRSSLPPPPP 54 >03_05_1153 + 30787574-30787608,30787982-30788089,30788651-30788689, 30789181-30789184,30789496-30789580,30789609-30790321 Length = 327 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +2 Query: 767 PPXXPPXP-PRPXAXXPPPPPXXKK 838 PP P P P P PPPPP K+ Sbjct: 213 PPAPAPEPEPEPPKKEPPPPPPPKQ 237 >03_02_0784 - 11154395-11154888,11155284-11155360,11155447-11155497, 11155599-11155672,11156127-11156215,11156533-11156618, 11157570-11157669,11158540-11158622,11158776-11159194 Length = 490 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPP 826 PP PP PP P PPPPP Sbjct: 424 PPYAPPPPPPP----PPPPP 439 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +2 Query: 767 PPXXPPX--PPRPXAXXPPPPP 826 PP PP PP P PPPPP Sbjct: 264 PPRPPPPQVPPPPPQAPPPPPP 285 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXP 865 P PP PP P PPPPP P P Sbjct: 288 PMGMPPRIPPPPVGGTQPPPPPPPLANGPPRSIPPPP 324 >02_05_0246 + 27136590-27138610,27138933-27139056,27139401-27139694, 27139776-27139978,27140307-27140589 Length = 974 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXGGXR 760 G GG GRGG GG GG R Sbjct: 118 GDGGSDGGGGRGGGGGGGGGRR 139 >02_04_0021 + 18975992-18976408 Length = 138 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 782 PXPPRPXAXXPPPPPXXKKTKXXXGPXP 865 P PP+P PPP P K P P Sbjct: 97 PPPPKPKPTPPPPAPTPKPPAPSPSPPP 124 >02_02_0240 + 8196140-8198248,8198381-8198650 Length = 792 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTK 844 P P PP PP+P A PP P + K Sbjct: 654 PIGIPQPPPPLPPQPPAEEQPPQPDEPEPK 683 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P P PP PP P A PPP + P P+ P Sbjct: 128 PRAWDPSPPPPPPAPAAPVLVPPP-APAPRPAPAPAPRVP 166 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 779 PPXPPRPXAXXPPPPP 826 PP PPR PPPPP Sbjct: 124 PPQPPRAWDPSPPPPP 139 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +2 Query: 770 PXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P PP PPR PPP + P P P Sbjct: 108 PYRPPPPPRKKPQFQPPPQPPRAWDPSPPPPPPAP 142 >01_06_1827 + 40169001-40169263,40169358-40169472,40170090-40170201, 40170556-40170623,40170798-40170852,40170948-40171027, 40171811-40171924,40172178-40172296,40173064-40173181, 40173264-40173394,40173535-40173688,40173922-40174017 Length = 474 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPP 826 PP PP P A PPPPP Sbjct: 27 PPRTRVRPPPPPAPPPPPPP 46 >01_01_0929 - 7344911-7345978 Length = 355 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPP 826 P P PP PP PPPPP Sbjct: 15 PAPPTPPLPPSPPSKTRRPPPPPP 38 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 747 PXXPFSXPPXXPLXPPXPXRGXPPPXXXXKK 839 P P+ PP PL PP P PPP +K Sbjct: 332 PSFPWPFPPLAPLFPPYP---SPPPSMYSRK 359 >12_01_0477 + 3742751-3745200,3747192-3747502,3747886-3748232 Length = 1035 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGG 778 GGGGG GRGG GG Sbjct: 67 GGGGGGGGGGRGGRGG 82 >12_01_0442 + 3495333-3496484 Length = 383 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = +2 Query: 755 PXLXPPXX---PPXPPRPXAXXPPPPPXXKKTK 844 P PP PP P P PPP P KTK Sbjct: 202 PVTRPPRTKQAPPTAPAPAPPPPPPQPASPKTK 234 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 761 LXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 L PP PP P PPP P P P P Sbjct: 1136 LPPPVPVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAP 1173 >10_08_0214 - 15915156-15915713 Length = 185 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 834 FXXGGGGGXXAXGRGGXGGXXG 769 + GGGGG G GG GG G Sbjct: 29 YGPGGGGGGGGGGEGGGGGYGG 50 >09_06_0148 - 21214460-21214561,21214993-21215339,21215428-21215538, 21215673-21215835,21215921-21215999,21216110-21216228 Length = 306 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 782 PXPPRPXAXXPPPPP 826 P PP P A PPPPP Sbjct: 196 PPPPPPAAPPPPPPP 210 >09_06_0083 + 20753191-20754480 Length = 429 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPP 826 P L PP P P PPPPP Sbjct: 243 PLLPPPPADATPATPDLPLPPPPP 266 >09_02_0369 - 8012470-8013120 Length = 216 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 1/25 (4%) Frame = +2 Query: 755 PXLXPPXXPPXP-PRPXAXXPPPPP 826 P PP P P P P PPPPP Sbjct: 119 PAARPPSAPETPLPLPCCEKPPPPP 143 >08_02_1615 + 28257275-28258428,28258523-28259144 Length = 591 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP P PP P + PPPPP + T P P P Sbjct: 60 PPPAPLTPPPPKS--PPPPPHIQTTDLPP-PKPLPP 92 >07_03_1382 - 26170563-26170631,26171151-26171843 Length = 253 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKT 841 PP PP P PPPPP +T Sbjct: 185 PPPPPPQPSGDANENPPPPPPPLRT 209 >07_03_1160 - 24430240-24431268 Length = 342 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P + P P PP P PP PP P P P Sbjct: 78 PDVPPMNKPDVPPMPKPDGPPIPPVQPCPDQPPQPKPDGP 117 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = +2 Query: 743 QTXXPXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 Q P P P PP+P PP P + P P P Sbjct: 242 QPPQPNPDMPPKPDQPPQPCPDGPPKPDQPPQPNPNGPPKPDQP 285 >07_03_0559 + 19475893-19476783 Length = 296 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 841 CFFXXXXGGGXPRXGXGGXRGXXGGXEXGXXG 746 C F GGG G GG RG GG G G Sbjct: 55 CRFGRCHGGGGGFGGGGGFRGGGGGGLGGGGG 86 >06_01_0944 + 7264833-7265120,7265511-7265600,7265702-7265798, 7265927-7265988,7266508-7266596,7266702-7266822, 7266915-7267058,7267492-7267820,7268154-7268394, 7269042-7269245,7271150-7271619,7272703-7272746, 7273121-7273211,7273494-7273596,7273682-7273783, 7274214-7274300,7274421-7274531 Length = 890 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPP 826 P L PP PP R A PPPPP Sbjct: 577 PSLKPPCTPPV--RSIAPPPPPPP 598 >05_02_0081 + 6432957-6433289,6433367-6433882,6434283-6434570 Length = 378 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 782 PXPPRPXAXXPPPPPXXK 835 P PP P PPPPP K Sbjct: 163 PDPPEPSPPPPPPPPASK 180 >04_04_1641 + 34993807-34994589,34994924-34995022,34995521-34995648, 34996095-34996235,34996456-34996542,34996627-34996780, 34998569-34998628,34999019-34999447,34999524-34999819, 35000278-35000407,35000690-35001187 Length = 934 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 770 PXXPPXPPRPXAXXPPPPP 826 P PP PP P PPPP Sbjct: 36 PSPPPPPPSPVPSPAPPPP 54 >04_04_1126 + 31095651-31096115 Length = 154 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXP 865 P PP PP P PPPP G P Sbjct: 39 PKPPPPPPPAPSGVPCPPPPYTPTPATPTGKCP 71 >04_01_0069 - 697811-697876,697956-698166,698265-698359,698448-698513, 698595-698643,698720-698770,698856-698908,699263-699331, 699874-699928,700011-700099,700217-700302,700376-700432, 700575-700716,701637-702032 Length = 494 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 779 PPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP PP P PPPP P PQ P Sbjct: 69 PPRPPPPSTTTAPPPPAAPAVTPAR-PPPQQP 99 >03_02_0738 - 10824121-10825572 Length = 483 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPP 826 PP P P P + PPPPP Sbjct: 80 PPSPPSSSPPPLSFPPPPPP 99 Score = 28.3 bits (60), Expect = 8.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 747 PXXPFSXPPXXPLXPPXPXRGXPPP 821 P P S PP PP P PPP Sbjct: 81 PSPPSSSPPPLSFPPPPPPPSSPPP 105 >02_01_0158 - 1103461-1104186 Length = 241 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -1 Query: 858 GPXXXFVFFXXGGGGGXXAX--GRGGXGGXXGGXRXG 754 GP FV GGGGG RGG G GG G Sbjct: 72 GPDGSFVKGGAGGGGGGGGGFGSRGGGGSGGGGRSYG 108 >01_05_0024 - 17262504-17263308,17264251-17264399,17264879-17264978, 17265829-17265953,17267565-17267743,17269648-17270698 Length = 802 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 770 PXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQ 868 P PP PPRP P PP + T P PQ Sbjct: 201 PVTPPPPPRPN----PSPPATRTTPPPPMPEPQ 229 >01_01_0720 - 5593311-5595371,5597550-5598027,5598118-5598146 Length = 855 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 770 PXXPPXPPRPXAXXPPPPP 826 P PP P P PPPPP Sbjct: 54 PPLPPRSPSPSPSPPPPPP 72 >12_02_0848 + 23636478-23638058 Length = 526 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPP 826 PP PP P PPPPP Sbjct: 67 PPIIDASPPPPSTSPPPPPP 86 >12_01_0841 - 7873458-7874225 Length = 255 Score = 28.3 bits (60), Expect = 8.5 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = -1 Query: 873 GXXGXGPXXXFVFFXXGGGGGXXAXGRGGXGGXXGGXRXG 754 G G G + GGG G+GG GG GG G Sbjct: 45 GEGGGGGSGYGEGYGQGGGASGGGYGQGGGGGGGGGQGGG 84 >08_02_0410 - 16842306-16842950,16844994-16845182 Length = 277 Score = 28.3 bits (60), Expect = 8.5 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -1 Query: 873 GXXGXGPXXXFVFFXXGGGGGXXAXGRGGXGGXXGGXRXG 754 G G G V G GGG +GG GG G R G Sbjct: 206 GVCGGGAGGVGVCARSGEGGGGWRAKKGGRGGGDGSRRRG 245 >08_01_0774 + 7482311-7482919,7484012-7484077,7484211-7484384, 7484473-7484603,7484726-7484802,7484981-7485064, 7487885-7488066,7488189-7488266,7489813-7489945, 7491610-7491670,7491861-7491942,7492143-7492271, 7492510-7492653,7493102-7493204,7493382-7493513, 7494127-7494485,7495149-7495229,7495384-7495450, 7495636-7495706,7496087-7496178,7496365-7496458, 7497692-7497789,7498206-7498341,7498599-7498618, 7498781-7498876,7498973-7499060,7499171-7499288, 7499738-7499759,7500203-7500326,7500625-7500702, 7500837-7500955,7501816-7501869,7502260-7502362, 7503133-7503261,7503345-7503453,7503788-7503819 Length = 1424 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/38 (31%), Positives = 15/38 (39%) Frame = +2 Query: 761 LXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 L P PP PP+ PP P + + P P P Sbjct: 52 LPPELMPPSPPKASPTPPPQPQPHPQLQPPPPPAPLPP 89 >08_01_0134 + 1067826-1068158 Length = 110 Score = 28.3 bits (60), Expect = 8.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPP 826 P L PP PP P PPPP Sbjct: 3 PPLPSSRPPPPPPLPRPHPAPPPP 26 >06_03_1310 + 29238644-29240260 Length = 538 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 P PP P P PPPP + K P P Sbjct: 396 PTPPPPSSPTPSHLPPPPPTYSESPKSSMPPSTSPP 431 >06_02_0271 + 13618149-13618297,13618311-13618560 Length = 132 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXGGXRXG 754 G GGG G GG GG GG G Sbjct: 55 GEGGGGEGGGEGGDGGTEGGGDGG 78 >06_01_0824 - 6219477-6219556,6220427-6220808,6221415-6221448, 6222214-6222370,6224449-6224575,6224663-6224914 Length = 343 Score = 28.3 bits (60), Expect = 8.5 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 747 PXXPFSXPPXXPLXPPXPXRGXPPPXXXXKKQKXXXGRP 863 P F PP PP RG PPP Q G P Sbjct: 131 PGAQFQAPPPAFQGPPYIARGTPPPPAQMMPQPQHHGPP 169 >04_04_0233 + 23801944-23802598,23802914-23803047,23803548-23803730, 23804145-23804318 Length = 381 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 770 PXXPPXPPRPXAXXPPPPP 826 P PP RP PPPPP Sbjct: 13 PSPPPFSSRPRVVGPPPPP 31 >03_06_0289 - 32870581-32871238,32871271-32871275 Length = 220 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 770 PXXPPXPPRPXAXXPPPP 823 P PP PP P PPPP Sbjct: 201 PLSPPPPPPPVHYAPPPP 218 >03_06_0212 + 32400982-32402055 Length = 357 Score = 28.3 bits (60), Expect = 8.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGG 778 GGGGG GRGG GG Sbjct: 12 GGGGGRGKRGRGGGGG 27 >03_05_0690 + 26778567-26778804,26778950-26779024,26779995-26780099, 26780869-26781000,26781432-26781571,26782213-26782323, 26782690-26782812,26784166-26784267,26784536-26784546, 26784878-26785103,26785363-26785401,26785413-26785583, 26785674-26785753,26785976-26786039 Length = 538 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 825 GGGGGXXAXGRGGXGGXXGGXRXG 754 GGGGG RGG G GG G Sbjct: 25 GGGGGGVGGDRGGGGSGGGGPGMG 48 >03_05_0576 + 25765137-25766420 Length = 427 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/38 (31%), Positives = 14/38 (36%) Frame = +2 Query: 755 PXLXPPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQ 868 P P P PP+P + PPPP P Q Sbjct: 69 PSPSPSPSPSPPPQPSSPPPPPPSPPPAAAVSVSPPTQ 106 >03_03_0106 - 14500935-14501263,14501357-14501432,14501531-14501542 Length = 138 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 770 PXXPPXPPRPXAXXPPPPP 826 P PP P P PPPPP Sbjct: 82 PDDPPKKPDPPPPCPPPPP 100 >03_02_0027 + 5100865-5100878,5102241-5102708,5102795-5103021, 5103670-5104577 Length = 538 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +2 Query: 767 PPXXPPXPPRP-XAXXPPPPP 826 PP P PP P A PPPPP Sbjct: 203 PPQAPLPPPAPVPAPAPPPPP 223 >01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 Length = 448 Score = 28.3 bits (60), Expect = 8.5 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = -1 Query: 864 GXGPXXXFVFFXXGGGGGXXAXGRGG--XGGXXGGXRXG 754 G GP GGGGG G GG GG GG G Sbjct: 266 GAGPGAGTGAITGGGGGGKGGGGGGGGNTGGGIGGSTGG 304 >01_01_0715 - 5542648-5543219,5543352-5543544 Length = 254 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPPXXKKTKXXXGPXPQXP 874 PP P P P PPPP P P P Sbjct: 145 PPPPPTVPAAPTPRPSPPPPAAGTNGTARAPSPPVP 180 >01_01_0046 - 331758-332627 Length = 289 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 767 PPXXPPXPPRPXAXXPPPPP 826 PP PP PP PP PP Sbjct: 24 PPPPPPPPPSSSRYRPPSPP 43 >01_01_0796 + 6190931-6192745 Length = 604 Score = 23.4 bits (48), Expect(2) = 9.4 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 779 PPXPPRPXAXXPPPPP 826 P PP A PPPPP Sbjct: 226 PVAPPPFVADQPPPPP 241 Score = 23.0 bits (47), Expect(2) = 9.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 767 PPXXPPXPPRP 799 PP PP PP+P Sbjct: 195 PPPPPPPPPQP 205 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,969,671 Number of Sequences: 37544 Number of extensions: 356439 Number of successful extensions: 6909 Number of sequences better than 10.0: 162 Number of HSP's better than 10.0 without gapping: 2128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5008 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2467979640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -